Citrus Sinensis ID: 008465

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPNLDAPLKEKNPGPSQGGQASSDRNHKAPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPPKRPSSSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQTESQSQIQEARLPSNAADS
cHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccc
cHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHccccccHHHccccEEEEccccccHHHHHHHHHcccccccccccEcccccccHHHHHHHHHHHHHHHccccccccccccccccccHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHcHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHEcccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
MTKFYEVTAQLEQALSAIsyenldisDEVKEQVELVLSQFRRakgrvdapdVELYEELLSLYnknndvtpdpaVLRGLAEKLQLMGIADLTQESLALHEMVastggdpgeTIEKMSMLLKKIKDFVqtenpnldaplkeknpgpsqggqassdrnhkapvipddfrcpislelmkdpvivstgqtYERSCIEKWLEaghrtcpktqqtltstavtpnYVLRSLIAQWCeangieppkrpsssrpsktssacspaeRTKIEILLCkltsgspedqrSAAGEIRLLAKRNADNRVAIAEAGAIPLLVgllstpdsrtQEHAVTALLNLSicednkgsivssgavpSIVHVLRIGSMEARENAAATLFSLSVidenkvtigasgaipplvtLLSEGTQRGKKDAATALFNLCIyqgnkgkavraGVVPTLMHlltepgggmvDEALAILAILsshpegkaaigaaEAVPVLVEVIgngsprnrENAAAVLVHLCAGDQQYLAEAKElgvmgplvdlaqngtdRGKRKAAQLLERMSRFIEQQKQAQVQTESQSQIQearlpsnaads
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQfrrakgrvdapDVELYEELLSLynknndvtpDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPNldaplkeknpgpsqggqassdrnhkapvIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHrtcpktqqtltstavtpNYVLRSLIAQWCEANGieppkrpsssrpsktssacspaerTKIEILLCkltsgspedqRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQtesqsqiqearlpsnaads
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPNLDAPLKEKNPGPSQGGQASSDRNHKAPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEppkrpsssrpsktssacspAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQTESQSQIQEARLPSNAADS
****YEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEM************************************************************IPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEAN***************************IEILLCKL**************IRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDL***************************************************
*TKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEEL******************GLAEKLQLMGIADLTQESLAL******************SMLLKKIKDFVQTENP****************************VIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGI********************************LTSG*PEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMS*******************************
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPNLDAPLK******************KAPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGI*********************ERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFI****************************
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPN*************************APVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPP***************S*AERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQ*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSLYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKKIKDFVQTENPNLDAPLKEKNPGPSQGGQASSDRNHKAPVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPPKRPSSSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQTESQSQIQEARLPSNAADS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query564 2.2.26 [Sep-21-2011]
Q9SNC6660 U-box domain-containing p yes no 0.991 0.846 0.740 0.0
Q9ZV31654 U-box domain-containing p no no 0.948 0.818 0.707 0.0
Q0IMG9694 E3 ubiquitin-protein liga yes no 0.932 0.757 0.693 0.0
A2ZLU6694 Protein spotted leaf 11 O N/A no 0.932 0.757 0.693 0.0
Q8VZ40632 U-box domain-containing p no no 0.932 0.832 0.594 1e-173
Q5VRH9611 U-box domain-containing p no no 0.916 0.846 0.578 1e-172
Q8GUG9612 U-box domain-containing p no no 0.888 0.818 0.481 1e-125
Q9C9A6628 U-box domain-containing p no no 0.874 0.785 0.478 1e-124
Q681N2660 U-box domain-containing p no no 0.914 0.781 0.431 1e-117
Q9C7R6729 U-box domain-containing p no no 0.946 0.732 0.366 9e-79
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function desciption
 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/566 (74%), Positives = 474/566 (83%), Gaps = 7/566 (1%)

Query: 2   TKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSL 61
           +K  EV+ +LEQ+LS I YE LDISDEV+EQVELVLSQFRRAKGRVD  D ELYE+L SL
Sbjct: 99  SKLMEVSVKLEQSLSQIPYEELDISDEVREQVELVLSQFRRAKGRVDVSDDELYEDLQSL 158

Query: 62  YNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKK 121
            NK++DV     VL  +A+KL LM I DL QES+ALHEMVAS+GGD GE IE+M+M+LK 
Sbjct: 159 CNKSSDVDAYQPVLERVAKKLHLMEIPDLAQESVALHEMVASSGGDVGENIEEMAMVLKM 218

Query: 122 IKDFVQTENPNLDAPLKEKNPGPSQ--GGQASSDRNHKAPVIPDDFRCPISLELMKDPVI 179
           IKDFVQTE+ N +    E+  G +    GQ S+  + K PVIPDDFRCPISLE+M+DPVI
Sbjct: 219 IKDFVQTEDDNGE----EQKVGVNSRSNGQTSTAASQKIPVIPDDFRCPISLEMMRDPVI 274

Query: 180 VSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPPKRP 239
           VS+GQTYER+CIEKW+E GH TCPKTQQ LTST +TPNYVLRSLIAQWCEAN IEPPK P
Sbjct: 275 VSSGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTPNYVLRSLIAQWCEANDIEPPKPP 334

Query: 240 SSSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAG 299
           SS RP K SS  SPAE  KIE L+ +L  G+PEDQRSAAGEIRLLAKRNADNRVAIAEAG
Sbjct: 335 SSLRPRKVSSFSSPAEANKIEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAG 394

Query: 300 AIPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEAREN 359
           AIPLLVGLLSTPDSR QEH+VTALLNLSICE+NKG+IVS+GA+P IV VL+ GSMEAREN
Sbjct: 395 AIPLLVGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKKGSMEAREN 454

Query: 360 AAATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAV 419
           AAATLFSLSVIDENKVTIGA GAIPPLV LL+EGTQRGKKDAATALFNLCIYQGNKGKA+
Sbjct: 455 AAATLFSLSVIDENKVTIGALGAIPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGKAI 514

Query: 420 RAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRN 479
           RAGV+PTL  LLTEPG GMVDEALAILAILSSHPEGKA IG+++AVP LVE I  GSPRN
Sbjct: 515 RAGVIPTLTRLLTEPGSGMVDEALAILAILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRN 574

Query: 480 RENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQ 539
           RENAAAVLVHLC+GD Q+L EA++LG+MGPL+DLA NGTDRGKRKAAQLLER+SR  EQQ
Sbjct: 575 RENAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERISRLAEQQ 634

Query: 540 KQAQV-QTESQSQIQEARLPSNAADS 564
           K+  V Q E +++       + AAD+
Sbjct: 635 KETAVSQPEEEAEPTHPESTTEAADT 660
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7R6|PUB17_ARATH U-box domain-containing protein 17 OS=Arabidopsis thaliana GN=PUB17 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
255587028662 Spotted leaf protein, putative [Ricinus 1.0 0.851 0.863 0.0
224104451663 predicted protein [Populus trichocarpa] 1.0 0.850 0.838 0.0
225434980 682 PREDICTED: U-box domain-containing prote 0.950 0.785 0.864 0.0
224054781663 predicted protein [Populus trichocarpa] 0.996 0.847 0.836 0.0
356539016661 PREDICTED: U-box domain-containing prote 1.0 0.853 0.810 0.0
356542449662 PREDICTED: U-box domain-containing prote 1.0 0.851 0.802 0.0
449464938 671 PREDICTED: U-box domain-containing prote 0.952 0.800 0.801 0.0
449521425 671 PREDICTED: LOW QUALITY PROTEIN: U-box do 0.952 0.800 0.799 0.0
297819214660 armadillo/beta-catenin repeat family pro 0.991 0.846 0.740 0.0
15231445660 U-box domain-containing protein 13 [Arab 0.991 0.846 0.740 0.0
>gi|255587028|ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus communis] gi|223525845|gb|EEF28280.1| Spotted leaf protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/564 (86%), Positives = 522/564 (92%)

Query: 1   MTKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLS 60
           M K++EVTAQLEQALS ISYENLDISDEVKEQVELVL+QFRRAKGR D PDVELYE+LL 
Sbjct: 99  MDKYHEVTAQLEQALSGISYENLDISDEVKEQVELVLAQFRRAKGRADTPDVELYEDLLL 158

Query: 61  LYNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLK 120
           L+NK+ND   DPAVLR  +EKLQL GIADLTQESLALHEMVA+TGGDPG  IEKMSMLLK
Sbjct: 159 LFNKSNDAAIDPAVLRRSSEKLQLRGIADLTQESLALHEMVAATGGDPGANIEKMSMLLK 218

Query: 121 KIKDFVQTENPNLDAPLKEKNPGPSQGGQASSDRNHKAPVIPDDFRCPISLELMKDPVIV 180
           KIKDFVQTENPN+DAP +EKN  PS  GQ S++ NHKAPVIPDDFRCPISLELMKDPVIV
Sbjct: 219 KIKDFVQTENPNMDAPGREKNLPPSSSGQTSTNTNHKAPVIPDDFRCPISLELMKDPVIV 278

Query: 181 STGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEPPKRPS 240
           STGQTYERSCIEKWLEAGH TCPKTQQ L STA+TPNYVLRSLIAQWCEANG+EPPKRPS
Sbjct: 279 STGQTYERSCIEKWLEAGHVTCPKTQQNLNSTALTPNYVLRSLIAQWCEANGMEPPKRPS 338

Query: 241 SSRPSKTSSACSPAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGA 300
           SSR +KT+SA SPAERTKIE LL KLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGA
Sbjct: 339 SSRSNKTTSAYSPAERTKIENLLHKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGA 398

Query: 301 IPLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENA 360
           IPLLV LLSTPDSRTQEHAVTALLNLSICEDNKGSI+S+GAVP IVHVL+ GSMEARENA
Sbjct: 399 IPLLVDLLSTPDSRTQEHAVTALLNLSICEDNKGSIISAGAVPGIVHVLKKGSMEARENA 458

Query: 361 AATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVR 420
           AATLFSLSV+DENKVTIG+SGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVR
Sbjct: 459 AATLFSLSVVDENKVTIGSSGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVR 518

Query: 421 AGVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNR 480
           AGVVPTLM LLTEPGGGMVDEALAILAIL+SHPEGK+AIGAAEAVPVLVEVIGNGSPRN+
Sbjct: 519 AGVVPTLMRLLTEPGGGMVDEALAILAILASHPEGKSAIGAAEAVPVLVEVIGNGSPRNK 578

Query: 481 ENAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQK 540
           ENAAAV+VHLCAGDQ++LAEA+ELG+MGPLVDLAQ GTDRGKRKA QLLE MSRF+EQQK
Sbjct: 579 ENAAAVMVHLCAGDQKHLAEAQELGIMGPLVDLAQTGTDRGKRKARQLLECMSRFVEQQK 638

Query: 541 QAQVQTESQSQIQEARLPSNAADS 564
           QAQ Q E+Q+Q  +    +N+ADS
Sbjct: 639 QAQAQAEAQTQQPQPSSTANSADS 662

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104451|ref|XP_002313440.1| predicted protein [Populus trichocarpa] gi|222849848|gb|EEE87395.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434980|ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224054781|ref|XP_002298363.1| predicted protein [Populus trichocarpa] gi|222845621|gb|EEE83168.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356539016|ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|356542449|ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|449464938|ref|XP_004150186.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521425|ref|XP_004167730.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297819214|ref|XP_002877490.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297323328|gb|EFH53749.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15231445|ref|NP_190235.1| U-box domain-containing protein 13 [Arabidopsis thaliana] gi|75266129|sp|Q9SNC6.1|PUB13_ARATH RecName: Full=U-box domain-containing protein 13; AltName: Full=Plant U-box protein 13 gi|6523054|emb|CAB62321.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|14596007|gb|AAK68731.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|22136270|gb|AAM91213.1| arm repeat containing protein homolog [Arabidopsis thaliana] gi|332644646|gb|AEE78167.1| U-box domain-containing protein 13 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.994 0.85 0.716 1.1e-204
UNIPROTKB|Q0IMG9694 SPL11 "E3 ubiquitin-protein li 0.968 0.786 0.665 6.4e-186
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.932 0.832 0.583 1.9e-154
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.916 0.846 0.569 1.1e-149
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.680 0.611 0.561 1.6e-113
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.670 0.617 0.547 8.9e-113
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.482 0.328 0.542 7e-95
TAIR|locus:2162276660 PUB15 "Plant U-Box 15" [Arabid 0.652 0.557 0.496 2.7e-93
TAIR|locus:2158252707 AT5G67340 [Arabidopsis thalian 0.484 0.386 0.501 1.5e-85
TAIR|locus:2013688729 PUB17 "plant U-box 17" [Arabid 0.936 0.724 0.374 1.3e-77
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1980 (702.1 bits), Expect = 1.1e-204, P = 1.1e-204
 Identities = 404/564 (71%), Positives = 459/564 (81%)

Query:     2 TKFYEVTAQLEQALSAISYENLDISDEVKEQVELVLSQFRRAKGRVDAPDVELYEELLSL 61
             +K  EV+ +LEQ+LS I YE LDISDEV+EQVELVLSQFRRAKGRVD  D ELYE+L SL
Sbjct:    99 SKLMEVSVKLEQSLSQIPYEELDISDEVREQVELVLSQFRRAKGRVDVSDDELYEDLQSL 158

Query:    62 YNKNNDVTPDPAVLRGLAEKLQLMGIADLTQESLALHEMVASTGGDPGETIEKMSMLLKK 121
              NK++DV     VL  +A+KL LM I DL QES+ALHEMVAS+GGD GE IE+M+M+LK 
Sbjct:   159 CNKSSDVDAYQPVLERVAKKLHLMEIPDLAQESVALHEMVASSGGDVGENIEEMAMVLKM 218

Query:   122 IKDFVQTENPNLDAPLKEKNPGPSQGGQASSDRNHKAPVIPDDFRCPISLELMKDPVIVS 181
             IKDFVQTE+ N +   ++        GQ S+  + K PVIPDDFRCPISLE+M+DPVIVS
Sbjct:   219 IKDFVQTEDDNGEE--QKVGVNSRSNGQTSTAASQKIPVIPDDFRCPISLEMMRDPVIVS 276

Query:   182 TGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSLIAQWCEANGIEXXXXXXX 241
             +GQTYER+CIEKW+E GH TCPKTQQ LTST +TPNYVLRSLIAQWCEAN IE       
Sbjct:   277 SGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTPNYVLRSLIAQWCEANDIEPPKPPSS 336

Query:   242 XXXXXXXXXXXXAERTKIEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAI 301
                         AE  KIE L+ +L  G+PEDQRSAAGEIRLLAKRNADNRVAIAEAGAI
Sbjct:   337 LRPRKVSSFSSPAEANKIEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAGAI 396

Query:   302 PLLVGLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPSIVHVLRIGSMEARENAA 361
             PLLVGLLSTPDSR QEH+VTALLNLSICE+NKG+IVS+GA+P IV VL+ GSMEARENAA
Sbjct:   397 PLLVGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKKGSMEARENAA 456

Query:   362 ATLFSLSVIDENKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRA 421
             ATLFSLSVIDENKVTIGA GAIPPLV LL+EGTQRGKKDAATALFNLCIYQGNKGKA+RA
Sbjct:   457 ATLFSLSVIDENKVTIGALGAIPPLVVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRA 516

Query:   422 GVVPTLMHLLTEPGGGMVDEALAILAILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRE 481
             GV+PTL  LLTEPG GMVDEALAILAILSSHPEGKA IG+++AVP LVE I  GSPRNRE
Sbjct:   517 GVIPTLTRLLTEPGSGMVDEALAILAILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRE 576

Query:   482 NAAAVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQ 541
             NAAAVLVHLC+GD Q+L EA++LG+MGPL+DLA NGTDRGKRKAAQLLER+SR  EQQK+
Sbjct:   577 NAAAVLVHLCSGDPQHLVEAQKLGLMGPLIDLAGNGTDRGKRKAAQLLERISRLAEQQKE 636

Query:   542 AQV-QTESQSQIQEARLPSNAADS 564
               V Q E +++       + AAD+
Sbjct:   637 TAVSQPEEEAEPTHPESTTEAADT 660
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0016567 "protein ubiquitination" evidence=IEA;IDA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0070696 "transmembrane receptor protein serine/threonine kinase binding" evidence=IPI
GO:0042742 "defense response to bacterium" evidence=IGI
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0032880 "regulation of protein localization" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162276 PUB15 "Plant U-Box 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158252 AT5G67340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013688 PUB17 "plant U-box 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZV31PUB12_ARATH6, ., 3, ., 2, ., -0.70720.94850.8180nono
Q9SNC6PUB13_ARATH6, ., 3, ., 2, ., -0.74020.99110.8469yesno
Q0IMG9SL11_ORYSJ6, ., 3, ., 2, ., -0.69380.93260.7579yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_IX4255
hypothetical protein (663 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
smart0050463 smart00504, Ubox, Modified RING finger domain 6e-29
pfam0456473 pfam04564, U-box, U-box domain 4e-23
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-16
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 4e-16
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-15
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-13
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 2e-13
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-13
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 2e-11
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 6e-11
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-08
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 3e-08
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 5e-08
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 7e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 8e-06
smart0018440 smart00184, RING, Ring finger 8e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-04
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 2e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-04
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 9e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.001
pfam05804 708 pfam05804, KAP, Kinesin-associated protein (KAP) 0.002
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.003
COG5113929 COG5113, UFD2, Ubiquitin fusion degradation protei 0.004
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information 
 Score =  108 bits (273), Expect = 6e-29
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 164 DFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPNYVLRSL 223
           +F CPISLE+MKDPVI+ +GQTYERS IEKWL   H T P T Q LT   + PN  L+S 
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWL-LSHGTDPVTGQPLTHEDLIPNLALKSA 59

Query: 224 IAQW 227
           I +W
Sbjct: 60  IQEW 63

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP) Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227444 COG5113, UFD2, Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 564
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.96
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.95
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.95
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.95
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.94
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.94
PF05804708 KAP: Kinesin-associated protein (KAP) 99.84
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.82
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.77
KOG1048717 consensus Neural adherens junction protein Plakoph 99.72
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.7
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.7
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.67
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.61
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.6
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.58
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.52
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.49
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.42
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.38
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.36
KOG1048717 consensus Neural adherens junction protein Plakoph 99.34
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.31
PRK09687280 putative lyase; Provisional 99.28
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.27
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.26
PRK09687280 putative lyase; Provisional 99.24
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.17
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.14
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.12
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.08
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.07
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 99.03
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.98
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.97
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.95
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.92
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.9
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.85
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.8
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.78
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.72
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.72
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.71
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.67
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.67
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.66
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.66
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.62
KOG4646173 consensus Uncharacterized conserved protein, conta 98.6
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.59
PHA02929238 N1R/p28-like protein; Provisional 98.57
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.57
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.56
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.53
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.51
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.48
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.48
KOG4646173 consensus Uncharacterized conserved protein, conta 98.48
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.43
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.43
PTZ00429 746 beta-adaptin; Provisional 98.43
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.42
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.42
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.41
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.38
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.37
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.36
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.32
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.27
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
PF05536 543 Neurochondrin: Neurochondrin 98.25
PHA02926242 zinc finger-like protein; Provisional 98.24
PTZ00429 746 beta-adaptin; Provisional 98.23
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
PF05536 543 Neurochondrin: Neurochondrin 98.21
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.21
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.19
TIGR02270410 conserved hypothetical protein. Members are found 98.19
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.18
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.13
PF1463444 zf-RING_5: zinc-RING finger domain 98.09
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.08
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.06
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.05
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 98.04
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.02
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.01
COG5222427 Uncharacterized conserved protein, contains RING Z 98.01
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.0
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.88
KOG4413 524 consensus 26S proteasome regulatory complex, subun 97.88
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.86
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.81
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.81
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.81
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.8
KOG2660331 consensus Locus-specific chromosome binding protei 97.8
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.8
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.79
KOG4413524 consensus 26S proteasome regulatory complex, subun 97.77
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.77
KOG0297391 consensus TNF receptor-associated factor [Signal t 97.73
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.72
COG5369743 Uncharacterized conserved protein [Function unknow 97.69
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.69
TIGR02270 410 conserved hypothetical protein. Members are found 97.67
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.66
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.64
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.64
KOG1242569 consensus Protein containing adaptin N-terminal re 97.64
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.5
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.5
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.48
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.45
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.41
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.41
COG5152259 Uncharacterized conserved protein, contains RING a 97.4
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
COG5369743 Uncharacterized conserved protein [Function unknow 97.35
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.33
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.29
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.27
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 97.23
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.22
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.19
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.18
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.16
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.15
KOG3036293 consensus Protein involved in cell differentiation 97.1
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.04
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.04
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.01
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.0
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 96.99
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.98
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 96.97
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.93
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.92
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.92
KOG1242569 consensus Protein containing adaptin N-terminal re 96.89
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.89
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.86
KOG1824 1233 consensus TATA-binding protein-interacting protein 96.83
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.82
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.8
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.78
KOG1824 1233 consensus TATA-binding protein-interacting protein 96.78
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.72
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.72
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.68
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 96.67
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.66
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.65
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.63
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.59
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 96.56
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.54
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.53
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 96.45
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 96.43
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.35
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 96.31
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.3
PF05004309 IFRD: Interferon-related developmental regulator ( 96.23
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.22
KOG3036293 consensus Protein involved in cell differentiation 96.18
KOG0289 506 consensus mRNA splicing factor [General function p 96.18
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 96.16
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.15
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.12
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.09
PF04641260 Rtf2: Rtf2 RING-finger 96.08
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 96.07
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.01
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.0
KOG0567289 consensus HEAT repeat-containing protein [General 95.96
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 95.89
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.78
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 95.67
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 95.51
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 95.48
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.45
PF05004309 IFRD: Interferon-related developmental regulator ( 95.42
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 95.42
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.4
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 95.28
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 95.1
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.08
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.08
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.04
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 95.02
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.95
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 94.92
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.82
KOG4653982 consensus Uncharacterized conserved protein [Funct 94.81
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.79
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 94.77
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 94.55
PF07814361 WAPL: Wings apart-like protein regulation of heter 94.53
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.45
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 94.38
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.38
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 94.32
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 94.32
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 94.31
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 94.29
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.16
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 94.15
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 94.1
COG5209315 RCD1 Uncharacterized protein involved in cell diff 94.06
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.04
KOG0567289 consensus HEAT repeat-containing protein [General 94.02
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 94.01
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 93.92
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 93.91
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 93.79
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.76
COG52191525 Uncharacterized conserved protein, contains RING Z 93.75
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.73
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.71
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.69
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 93.58
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 93.39
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 93.39
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.36
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 93.34
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 93.25
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 93.02
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 93.01
KOG2979262 consensus Protein involved in DNA repair [General 92.98
KOG2956516 consensus CLIP-associating protein [General functi 92.89
KOG149384 consensus Anaphase-promoting complex (APC), subuni 92.83
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 92.77
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.7
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.69
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.57
PF08045257 CDC14: Cell division control protein 14, SIN compo 92.45
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 92.42
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 92.42
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.42
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 92.4
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 92.35
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.26
COG5175480 MOT2 Transcriptional repressor [Transcription] 92.21
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 91.9
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 91.87
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 91.78
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 91.72
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 91.69
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.47
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.42
KOG4653982 consensus Uncharacterized conserved protein [Funct 91.34
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 91.33
KOG2062 929 consensus 26S proteasome regulatory complex, subun 91.22
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 91.17
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 90.81
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 90.73
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 90.65
KOG04141251 consensus Chromosome condensation complex Condensi 90.57
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 90.52
KOG3113293 consensus Uncharacterized conserved protein [Funct 90.45
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 90.22
PF14500262 MMS19_N: Dos2-interacting transcription regulator 90.08
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 89.92
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 89.79
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 89.78
KOG0301745 consensus Phospholipase A2-activating protein (con 89.68
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 89.65
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 89.61
KOG2137 700 consensus Protein kinase [Signal transduction mech 89.46
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 89.36
KOG1566342 consensus Conserved protein Mo25 [Function unknown 88.98
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 88.74
KOG1243 690 consensus Protein kinase [General function predict 88.65
KOG04141251 consensus Chromosome condensation complex Condensi 88.6
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 88.55
PF14500262 MMS19_N: Dos2-interacting transcription regulator 88.48
PF11701157 UNC45-central: Myosin-binding striated muscle asse 88.45
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 87.97
COG5209315 RCD1 Uncharacterized protein involved in cell diff 87.84
KOG2062 929 consensus 26S proteasome regulatory complex, subun 87.67
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 87.49
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 87.48
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 87.34
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.17
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 87.02
PRK14707 2710 hypothetical protein; Provisional 86.98
KOG2025 892 consensus Chromosome condensation complex Condensi 86.56
PRK14707 2710 hypothetical protein; Provisional 86.46
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 85.76
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 85.52
COG5109396 Uncharacterized conserved protein, contains RING Z 85.42
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 85.39
cd03561133 VHS VHS domain family; The VHS domain is present i 85.36
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 84.59
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 84.55
PF1036392 DUF2435: Protein of unknown function (DUF2435) 84.24
KOG2032533 consensus Uncharacterized conserved protein [Funct 84.24
KOG1941518 consensus Acetylcholine receptor-associated protei 83.98
KOG4535728 consensus HEAT and armadillo repeat-containing pro 83.96
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 83.81
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 83.29
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 83.29
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 83.1
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 83.09
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 82.53
COG5116 926 RPN2 26S proteasome regulatory complex component [ 82.06
KOG3002299 consensus Zn finger protein [General function pred 81.86
PF1472698 RTTN_N: Rotatin, an armadillo repeat protein, cent 81.59
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 81.57
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 81.21
KOG2025 892 consensus Chromosome condensation complex Condensi 81.12
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 80.98
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 80.98
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 80.8
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 80.7
KOG02981394 consensus DEAD box-containing helicase-like transc 80.36
KOG2933334 consensus Uncharacterized conserved protein [Funct 80.31
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=99.97  E-value=5.4e-29  Score=256.04  Aligned_cols=292  Identities=23%  Similarity=0.282  Sum_probs=259.5

Q ss_pred             hHHHHHHHHHcc-CCHHHHHHHHHHHHHHHhhChhhHHHHHHhCCHHHHHHhhCCCCHHHHHHHHHHHHhcccCCcc-ch
Q 008465          257 TKIEILLCKLTS-GSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICEDN-KG  334 (564)
Q Consensus       257 ~~i~~Lv~~L~s-~~~~~~~~al~~L~~L~~~~~~~r~~i~~~g~i~~Lv~lL~~~~~~i~~~A~~~L~nLs~~~~~-~~  334 (564)
                      |.++.+|+.|.. .++..|..|+++|.+++.++.+....+++.|++|.|+.+|.+++..+++.|+|+|+|++.+... |.
T Consensus       109 G~v~~lV~~l~~~~~~~lq~eAAWaLTnIAsgtse~T~~vv~agavp~fi~Ll~s~~~~v~eQavWALgNIagds~~~Rd  188 (514)
T KOG0166|consen  109 GVVPRLVEFLSRDDNPTLQFEAAWALTNIASGTSEQTKVVVDAGAVPIFIQLLSSPSADVREQAVWALGNIAGDSPDCRD  188 (514)
T ss_pred             CcHHHHHHHHccCCChhHHHHHHHHHHHHhcCchhhccccccCCchHHHHHHhcCCcHHHHHHHHHHHhccccCChHHHH
Confidence            779999999975 5589999999999999999999999999999999999999999999999999999999998765 88


Q ss_pred             hhhccCChHHHHHHHhcCCH-HHHHHHHHHHHhccCCcchhhHh-hhcCChHHHHHhhccCCHHHHHHHHHHHHHhhccc
Q 008465          335 SIVSSGAVPSIVHVLRIGSM-EARENAAATLFSLSVIDENKVTI-GASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQ  412 (564)
Q Consensus       335 ~i~~~g~i~~Lv~lL~~~~~-e~~~~a~~~L~~Ls~~~~~~~~i-~~~g~i~~Lv~lL~~~~~~~~~~a~~aL~nL~~~~  412 (564)
                      .+.+.|++++|+.++...+. ....++.|+|.||+........+ .-..++|.|..++.+.|+.+..+|+|||.+|+.+.
T Consensus       189 ~vl~~g~l~pLl~~l~~~~~~~~lRn~tW~LsNlcrgk~P~P~~~~v~~iLp~L~~ll~~~D~~Vl~Da~WAlsyLsdg~  268 (514)
T KOG0166|consen  189 YVLSCGALDPLLRLLNKSDKLSMLRNATWTLSNLCRGKNPSPPFDVVAPILPALLRLLHSTDEEVLTDACWALSYLTDGS  268 (514)
T ss_pred             HHHhhcchHHHHHHhccccchHHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhcCC
Confidence            88899999999999988754 78899999999999886433332 23478999999999999999999999999999887


Q ss_pred             ChhHH-HHHcCChHHHHHhccCCCcchHHHHHHHHHHhcCCh-hhHHHHHhcCChHHHHHHHh-cCChHHHHHHHHHHHH
Q 008465          413 GNKGK-AVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHP-EGKAAIGAAEAVPVLVEVIG-NGSPRNRENAAAVLVH  489 (564)
Q Consensus       413 ~~~~~-i~~~g~i~~Lv~lL~~~~~~~~~~al~~L~~L~~~~-~~~~~i~~~g~i~~Lv~lL~-~~~~~~k~~A~~~L~~  489 (564)
                      ..+.+ +++.|+++.|+.+|.+.++.++..|+.+++|++.+. ...+.+++.|+++.|..+|. +.....|..|+|+|.|
T Consensus       269 ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRaiGNIvtG~d~QTq~vi~~~~L~~l~~ll~~s~~~~ikkEAcW~iSN  348 (514)
T KOG0166|consen  269 NEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRAIGNIVTGSDEQTQVVINSGALPVLSNLLSSSPKESIKKEACWTISN  348 (514)
T ss_pred             hHHHHHHHHccchHHHHHHHcCCCcccccHHHhhccceeeccHHHHHHHHhcChHHHHHHHhccCcchhHHHHHHHHHHH
Confidence            77765 559999999999999999999999999999997655 55678899999999999998 4556689999999999


Q ss_pred             HhcCCHHHHHHHHHcCCHHHHHHhhhcCCHHHHHHHHHHHHHHHhhH-HHHHHHhhchhh
Q 008465          490 LCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFI-EQQKQAQVQTES  548 (564)
Q Consensus       490 L~~~~~~~~~~~~~~g~i~~L~~Ll~~~~~~~k~~A~~lL~~l~~~~-~~~~~~~~~~~~  548 (564)
                      ++.++..+.+.+++.|++|.|+.++++++.++|+.|+|++.|+.... +.+-..+.+.+.
T Consensus       349 ItAG~~~qiqaVida~l~p~Li~~l~~~ef~~rKEAawaIsN~ts~g~~~qi~yLv~~gi  408 (514)
T KOG0166|consen  349 ITAGNQEQIQAVIDANLIPVLINLLQTAEFDIRKEAAWAISNLTSSGTPEQIKYLVEQGI  408 (514)
T ss_pred             hhcCCHHHHHHHHHcccHHHHHHHHhccchHHHHHHHHHHHhhcccCCHHHHHHHHHcCC
Confidence            99999999999999999999999999999999999999999998644 555556655543

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF14726 RTTN_N: Rotatin, an armadillo repeat protein, centriole functioning Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 1e-31
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 6e-12
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 5e-11
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 2e-10
4b8j_A528 Rimp_alpha1a Length = 528 3e-10
2yns_A490 Rimp_alpha_b54nls Length = 490 4e-10
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 5e-09
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 6e-09
2f42_A179 Dimerization And U-Box Domains Of Zebrafish C-Termi 2e-06
3l6x_A 584 Crystal Structure Of P120 Catenin In Complex With E 4e-06
2c2v_S78 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 6e-06
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 6e-06
2oxq_C80 Structure Of The Ubch5 :chip U-Box Complex Length = 1e-04
2z6g_A 780 Crystal Structure Of A Full-Length Zebrafish Beta-C 2e-04
2kre_A100 Solution Structure Of E4bUFD2A U-Box Domain Length 6e-04
2z6h_A 644 Crystal Structure Of Beta-Catenin Armadillo Repeat 7e-04
2gl7_A 550 Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX 7e-04
3ouw_A 540 Structure Of Beta-Catenin With Lef-1 Length = 540 9e-04
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (337), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%)
Query: 158 APVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPN 217
           +P  P+ FRCPISLELMKDPVIVSTGQTYERS I+KWL+AGH+TCPK+Q+TL    +TPN
Sbjct: 2   SPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPN 61
Query: 218 YVLRSLIAQWCEANGIE 234
           YVL+SLIA WCE+NGIE
Sbjct: 62  YVLKSLIALWCESNGIE 78
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|2F42|A Chain A, Dimerization And U-Box Domains Of Zebrafish C-Terminal Of Hsp70 Interacting Protein Length = 179 Back     alignment and structure
>pdb|3L6X|A Chain A, Crystal Structure Of P120 Catenin In Complex With E-Cadherin Length = 584 Back     alignment and structure
>pdb|2C2V|S Chain S, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 78 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2OXQ|C Chain C, Structure Of The Ubch5 :chip U-Box Complex Length = 80 Back     alignment and structure
>pdb|2Z6G|A Chain A, Crystal Structure Of A Full-Length Zebrafish Beta-Catenin Length = 780 Back     alignment and structure
>pdb|2KRE|A Chain A, Solution Structure Of E4bUFD2A U-Box Domain Length = 100 Back     alignment and structure
>pdb|2Z6H|A Chain A, Crystal Structure Of Beta-Catenin Armadillo Repeat Region And Its C-Terminal Domain Length = 644 Back     alignment and structure
>pdb|2GL7|A Chain A, Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX Length = 550 Back     alignment and structure
>pdb|3OUW|A Chain A, Structure Of Beta-Catenin With Lef-1 Length = 540 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-72
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-37
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-26
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-62
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-61
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-49
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-46
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-31
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-29
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-25
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-62
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-55
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-51
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-47
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-32
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-29
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-26
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-62
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-40
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-61
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-52
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-47
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-46
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-33
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-25
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-60
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-38
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-27
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-56
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-43
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-40
3nmz_A458 APC variant protein; protein-protein complex, arma 7e-36
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-32
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-28
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-55
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-41
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-33
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-23
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-07
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-49
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-36
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-30
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 9e-30
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-26
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 8e-15
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 5e-49
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-45
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 6e-40
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-29
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 2e-16
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 1e-46
2f42_A179 STIP1 homology and U-box containing protein 1; cha 5e-41
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 6e-41
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-23
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-19
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-12
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-05
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-40
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-33
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-22
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-22
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-17
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-06
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-06
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-05
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-34
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-09
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-33
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-13
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-11
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 6e-33
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 7e-33
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 1e-29
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 7e-27
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 4e-22
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 8e-21
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-20
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 6e-18
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-16
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 7e-14
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 5e-13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-13
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 5e-12
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 6e-12
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-12
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 6e-12
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 1e-10
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 5e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-11
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-10
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-10
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-10
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-10
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-10
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-10
3grl_A 651 General vesicular transport factor P115; vesicle t 2e-09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-09
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-08
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 6e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 7e-08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 8e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 3e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 3e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 3e-05
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 7e-05
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 1e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
 Score =  231 bits (590), Expect = 2e-72
 Identities = 63/238 (26%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 259 IEILLCKLTSGSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEH 318
           +  +  +L S   ++Q SA  +   +     +   A+ +AGA+P LV LLS+P+ +  + 
Sbjct: 14  LPQMTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQE 73

Query: 319 AVTALLNLSI-CEDNKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVI-DENKVT 376
           A+ AL N++    +   +++ +GA+P++V +L   + +  + A   L +++   +E    
Sbjct: 74  ALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQA 133

Query: 377 IGASGAIPPLVTLLSEGTQRGKKDAATALFNLCIYQGNKGKA-VRAGVVPTLMHLLTEPG 435
           +  +GA+P LV LLS   ++  ++A  AL N+      + +A + AG +P L+ LL+ P 
Sbjct: 134 VIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPN 193

Query: 436 GGMVDEALAILA-ILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCA 492
             ++ EAL  L+ I S   E K A+  A A+  L ++  + + + ++ A   L  L +
Sbjct: 194 EQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS 251
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.98
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.97
3nmz_A458 APC variant protein; protein-protein complex, arma 99.97
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
3nmz_A458 APC variant protein; protein-protein complex, arma 99.97
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.97
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.96
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.96
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.96
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.96
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.96
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.96
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.96
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.95
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.95
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.95
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.92
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.92
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.92
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.9
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.9
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.89
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.86
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.83
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.81
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.8
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.79
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.79
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.78
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.72
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.66
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.57
3grl_A 651 General vesicular transport factor P115; vesicle t 99.56
3grl_A 651 General vesicular transport factor P115; vesicle t 99.52
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.49
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.45
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.45
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.42
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.41
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.4
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.39
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.38
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.35
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.35
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.34
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.34
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.34
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.33
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.32
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.31
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.31
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.3
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.3
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.29
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.28
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.27
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.27
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.26
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.25
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.25
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.2
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.18
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.16
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.1
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.09
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.09
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.08
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.07
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.02
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.0
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.98
2ect_A78 Ring finger protein 126; metal binding protein, st 98.97
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.95
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.9
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.85
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.85
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.84
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.84
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.84
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.81
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.81
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.81
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.79
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.77
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.76
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.76
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.74
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.72
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.7
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.68
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.66
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.66
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.65
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.64
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.63
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.63
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.59
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.52
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.51
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.48
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.45
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.44
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.41
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.4
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.35
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.33
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.33
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.3
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.3
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.22
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.21
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.21
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.2
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.18
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.18
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.16
2ea5_A68 Cell growth regulator with ring finger domain prot 98.15
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.12
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.11
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.04
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.0
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.99
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.92
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.9
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.84
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.73
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.72
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.66
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.42
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.42
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.12
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.08
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.05
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.04
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.97
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.85
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.79
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.53
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.51
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.28
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.22
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.63
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.49
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 95.48
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.38
2x1g_F 971 Cadmus; transport protein, developmental protein, 95.01
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.74
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 94.65
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.6
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 94.48
2x1g_F 971 Cadmus; transport protein, developmental protein, 94.39
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 94.35
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.33
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 93.93
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 93.73
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 93.71
2x19_B 963 Importin-13; nuclear transport, protein transport; 93.42
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 93.34
3nw0_A238 Non-structural maintenance of chromosomes element 92.81
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 92.52
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 92.34
2x19_B 963 Importin-13; nuclear transport, protein transport; 92.26
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 91.38
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.68
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 90.47
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 89.92
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 89.54
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 88.65
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.69
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 87.59
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 87.56
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 87.24
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 86.35
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 86.13
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 85.45
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 83.54
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 82.74
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 82.36
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 81.53
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 80.59
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
Probab=99.98  E-value=1.2e-31  Score=274.74  Aligned_cols=267  Identities=20%  Similarity=0.214  Sum_probs=240.4

Q ss_pred             HHHHHHHHHHHHHHHhhChhhHHHHHHhCCHHHHHHhhCC-----------CCHHHHHHHHHHHHhcccCCc-cchhhh-
Q 008465          271 PEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLST-----------PDSRTQEHAVTALLNLSICED-NKGSIV-  337 (564)
Q Consensus       271 ~~~~~~al~~L~~L~~~~~~~r~~i~~~g~i~~Lv~lL~~-----------~~~~i~~~A~~~L~nLs~~~~-~~~~i~-  337 (564)
                      ...+..|++.|.+++. ++++|..+++.|+++.|+.+|.+           .++.+|.+|+++|.||+.+++ +|..|. 
T Consensus        46 ~~~~~~A~~aL~nls~-d~e~R~~i~~~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~~  124 (354)
T 3nmw_A           46 EHQICPAVCVLMKLSF-DEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCS  124 (354)
T ss_dssp             GGTHHHHHHHHHHHHT-SHHHHHHHHHTTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHcC-CHHHHHHHHHcCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            3556789999999997 58999999999999999999952           246799999999999998665 677776 


Q ss_pred             ccCChHHHHHHHhcCCHHHHHHHHHHHHhccCC--cchhhHhhhcCChHHHHHhh-ccCCHHHHHHHHHHHHHhhc-ccC
Q 008465          338 SSGAVPSIVHVLRIGSMEARENAAATLFSLSVI--DENKVTIGASGAIPPLVTLL-SEGTQRGKKDAATALFNLCI-YQG  413 (564)
Q Consensus       338 ~~g~i~~Lv~lL~~~~~e~~~~a~~~L~~Ls~~--~~~~~~i~~~g~i~~Lv~lL-~~~~~~~~~~a~~aL~nL~~-~~~  413 (564)
                      ..|+|+.|+.+|+++++++++.|+++|.+|+..  ++++..+.+.|++++|+++| ++++..+++.|+.+|+||+. .++
T Consensus       125 ~~GaIp~LV~LL~s~~~~v~~~A~~aL~nLs~~~~~~~k~~i~~~G~Ip~Lv~lL~~~~~~~~~~~A~~aL~nLs~~~~~  204 (354)
T 3nmw_A          125 MKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTE  204 (354)
T ss_dssp             CHHHHHHHHHGGGCSCHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTTCHH
T ss_pred             cCCcHHHHHHHHCCCCHHHHHHHHHHHHHHhccCCHHHHHHHHHCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHHccChh
Confidence            456699999999999999999999999999985  46899999999999999975 66789999999999999999 667


Q ss_pred             hhHHHH-HcCChHHHHHhccCCCc----chHHHHHHHHHHhcC----ChhhHHHHHhcCChHHHHHHHhcCChHHHHHHH
Q 008465          414 NKGKAV-RAGVVPTLMHLLTEPGG----GMVDEALAILAILSS----HPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAA  484 (564)
Q Consensus       414 ~~~~i~-~~g~i~~Lv~lL~~~~~----~~~~~al~~L~~L~~----~~~~~~~i~~~g~i~~Lv~lL~~~~~~~k~~A~  484 (564)
                      ++..++ ..|+++.|+.+|.+++.    .+++.|+++|.||+.    .++++..+.+.|+++.|+.+|++++..+++.|+
T Consensus       205 nk~~i~~~~Gai~~Lv~lL~~~~~~~~~~v~~~A~~aL~nLs~~~a~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~A~  284 (354)
T 3nmw_A          205 NKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNAC  284 (354)
T ss_dssp             HHHHHHHSTTHHHHHHHHTTCCCSSSCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTTHHHHHHHHTTCSCHHHHHHHH
T ss_pred             hhHHHHHhcCcHHHHHHHhccCCCcccHHHHHHHHHHHHHHHhhccCCHHHHHHHHHcCCHHHHHHHHcCCChHHHHHHH
Confidence            888888 78999999999987554    489999999999995    889999999999999999999999999999999


Q ss_pred             HHHHHHhcCCHHHHHHHHHcCCHHHHHHhhhcCCHHHHHHHHHHHHHHHhhHHH
Q 008465          485 AVLVHLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQ  538 (564)
Q Consensus       485 ~~L~~L~~~~~~~~~~~~~~g~i~~L~~Ll~~~~~~~k~~A~~lL~~l~~~~~~  538 (564)
                      ++|+||+.+++..+..+.+.|+++.|+.++.++++++++.|.++|.+|....+.
T Consensus       285 ~aL~nLa~~~~~~~~~i~~~G~i~~Lv~LL~s~~~~i~~~A~~aL~nL~~~~~~  338 (354)
T 3nmw_A          285 GTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPA  338 (354)
T ss_dssp             HHHHHHTSSCHHHHHHHHHTTHHHHHHTTTTCSSHHHHHHHHHHHHHHHTTCCG
T ss_pred             HHHHHHhCCCHHHHHHHHHCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHcCCHH
Confidence            999999988999999999999999999999999999999999999999976543
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 564
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-29
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 2e-22
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-21
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-19
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-19
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-16
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-16
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-15
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-20
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-16
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-13
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 8e-17
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-09
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-08
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 3e-08
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-07
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 8e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-15
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 9e-14
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-13
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-11
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-11
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-09
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-08
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-08
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-07
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 8e-07
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  109 bits (274), Expect = 1e-29
 Identities = 58/77 (75%), Positives = 68/77 (88%)

Query: 158 APVIPDDFRCPISLELMKDPVIVSTGQTYERSCIEKWLEAGHRTCPKTQQTLTSTAVTPN 217
           +P  P+ FRCPISLELMKDPVIVSTGQTYERS I+KWL+AGH+TCPK+Q+TL    +TPN
Sbjct: 2   SPEFPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPN 61

Query: 218 YVLRSLIAQWCEANGIE 234
           YVL+SLIA WCE+NGIE
Sbjct: 62  YVLKSLIALWCESNGIE 78
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.92
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.92
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.91
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.91
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.83
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.81
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.77
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.76
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.75
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.45
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.42
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.38
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.05
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.03
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.91
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.84
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.8
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.78
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.77
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.76
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.64
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.6
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.5
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.48
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.43
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.3
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.28
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.22
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.18
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.17
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.08
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.98
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.91
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.86
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.85
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.67
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.64
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.55
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.4
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.06
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.79
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 95.45
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 93.53
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 93.46
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 93.32
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 89.67
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 86.23
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 85.64
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 83.34
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 81.49
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 80.88
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 80.65
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.92  E-value=1.6e-23  Score=222.98  Aligned_cols=283  Identities=18%  Similarity=0.168  Sum_probs=254.4

Q ss_pred             hhhhHHHHHHHHHcc-CCHHHHHHHHHHHHHHHhhChhhHHHHHHhCCHHHHHHhhCCCCHHHHHHHHHHHHhcccCC-c
Q 008465          254 AERTKIEILLCKLTS-GSPEDQRSAAGEIRLLAKRNADNRVAIAEAGAIPLLVGLLSTPDSRTQEHAVTALLNLSICE-D  331 (564)
Q Consensus       254 ~~~~~i~~Lv~~L~s-~~~~~~~~al~~L~~L~~~~~~~r~~i~~~g~i~~Lv~lL~~~~~~i~~~A~~~L~nLs~~~-~  331 (564)
                      .+.|.++.|++.|++ .+.+.|..|++.|.+++..++.....+.+.|+++.|+.+|.+++.+++..|+++|+||+.+. .
T Consensus       116 i~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~  195 (503)
T d1wa5b_         116 IQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTD  195 (503)
T ss_dssp             HHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHH
T ss_pred             HHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHH
Confidence            346789999999985 56789999999999999888888889999999999999999999999999999999998754 5


Q ss_pred             cchhhhccCChHHHHHHHhcCCHHHHHHHHHHHHhccCCcc-hhhHhhhcCChHHHHHhhccCCHHHHHHHHHHHHHhhc
Q 008465          332 NKGSIVSSGAVPSIVHVLRIGSMEARENAAATLFSLSVIDE-NKVTIGASGAIPPLVTLLSEGTQRGKKDAATALFNLCI  410 (564)
Q Consensus       332 ~~~~i~~~g~i~~Lv~lL~~~~~e~~~~a~~~L~~Ls~~~~-~~~~i~~~g~i~~Lv~lL~~~~~~~~~~a~~aL~nL~~  410 (564)
                      .+..+...|+++.++.++.+.+.+++..++++|.+|+.... ........++++.|+.++.+.+..++..++++|.+|+.
T Consensus       196 ~r~~l~~~~~~~~L~~ll~~~~~~~~~~~~~~l~nl~~~~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~  275 (503)
T d1wa5b_         196 YRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD  275 (503)
T ss_dssp             HHHHHHHTTCHHHHHHGGGSCCHHHHHHHHHHHHHHHCCSSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHhhcccccchhhcccCCHHHHHHHHHHHHHHhcCCccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhcc
Confidence            68889999999999999999999999999999999997754 33344456899999999999999999999999999998


Q ss_pred             ccChh-HHHHHcCChHHHHHhccCCCcchHHHHHHHHHHhcCChh-hHHHHHhcCChHHHHHHHhcCChHHHHHHHHHHH
Q 008465          411 YQGNK-GKAVRAGVVPTLMHLLTEPGGGMVDEALAILAILSSHPE-GKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLV  488 (564)
Q Consensus       411 ~~~~~-~~i~~~g~i~~Lv~lL~~~~~~~~~~al~~L~~L~~~~~-~~~~i~~~g~i~~Lv~lL~~~~~~~k~~A~~~L~  488 (564)
                      ..... ..+++.|+++.++.++.+++..+...|+.+|++++...+ ....+.+.|+++.|..++.++++.++..++++|.
T Consensus       276 ~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~nl~~~~~~~~~~~~~~~~l~~l~~ll~~~~~~i~~~~~~~l~  355 (503)
T d1wa5b_         276 GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTIS  355 (503)
T ss_dssp             SCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHH
T ss_pred             CCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHHHHHHHHHHHHhhhccchHHHHHHHhcCCCHHHHHHHHHHHH
Confidence            76654 567899999999999999999999999999999987654 4556778899999999999999999999999999


Q ss_pred             HHhcCCHHHHHHHHHcCCHHHHHHhhhcCCHHHHHHHHHHHHHHHhhH
Q 008465          489 HLCAGDQQYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFI  536 (564)
Q Consensus       489 ~L~~~~~~~~~~~~~~g~i~~L~~Ll~~~~~~~k~~A~~lL~~l~~~~  536 (564)
                      |++.+++.....+.+.|+++.++.++.+++..++..|.++|.++....
T Consensus       356 nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl~~~~  403 (503)
T d1wa5b_         356 NITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGG  403 (503)
T ss_dssp             HHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHHHHHT
T ss_pred             HHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999998643
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure