Citrus Sinensis ID: 008473

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----

METVEKKAAANANDVVIPIADAKDEYLSSRRSQLSTSKSSASPAHARGADLVEETTQLLTSPAANNNNNNKFTDSTGEVNLESYSDEDEDDVHKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGMSAGKEKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKLSVFSNQLEEFAEEEEDGEDGEIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITDGG

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHEEEEEcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHcHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccEEEEccccccEEEEEEEEEEEEEEEEEEccEEEEEcccc

cccHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccccccccHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHcccHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEcHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc

METVEKKAAAnandvvipiadakdeylssrrsqlstskssaspahargaDLVEETTQLltspaannnnnnkftdstgevnlesysdededdvhKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFrhgvkrskeTTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSfqskrffnpiQETIFHQYLIqtlsgpplmeinEQVRseafgmsagkeKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKLSVFSNQLEefaeeeedgedgeifknandksdEELQMYKSIKSEFEAKSAANYIFKNvadtgcdyigkeQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYvmhpfdvgdrciidgvqvtDIFILKIEVCVSLLYRVLFALQLFITDGG

metvekkaaanandvvipiaDAKDEYLSSRRsqlstskssaspahaRGADLVEETTQLLtspaannnnnnkftdstGEVNLesysdededdvhkdkqkrkilkkpyVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLfrhgvkrskettkiLNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSeafgmsagkekylidvrKLKKikrqkisawtmkKLIDVARSSKLSVFSNQLEEFaeeeedgedgeifknandksdEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITDGG

METVEKKAAANANDVVIPIADAKDEYLssrrsqlstskssasPAHARGADLVEETTQLLTSPAAnnnnnnKFTDSTGEVNLESYSDEDEDDVHKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGMSAGKEKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKLSVFSNQLeefaeeeedgedgeIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGivvvviiilwlilMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITDGG

****************************************************************************************************ILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGMSAGKEKYLIDVRKLKKIKRQKISAWTMKKLIDVAR**************************************************KSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFIT***

********************************************************************************************HKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGP*****************************************************************A*EEEDGEDGEIFK*********************AKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFIT***

*********ANANDVVIPIADAKDEY*********************GADLVEETTQLLTSPAANNNNNNKFTDSTGEVNLE****************RKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGMSAGKEKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKLSVFSNQLE**********DGEIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITDGG

*************DVV*PI*********************************************************************EDDVHKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEI*E****************LIDVRK*KKIKRQKISAWTMKKLIDVARSSKLSVFSNQLEEFAEEEEDGEDGEIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITDG*

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		564	2.2.26 [Sep-21-2011]
Q9LYG9		734	Mechanosensitive ion chan	yes	no	0.801	0.615	0.426	1e-108
Q84M97		742	Mechanosensitive ion chan	no	no	0.801	0.609	0.380	3e-93
F4IME2		908	Mechanosensitive ion chan	no	no	0.780	0.484	0.352	3e-78
Q9LH74		881	Mechanosensitive ion chan	no	no	0.792	0.507	0.359	3e-75
Q9LPG3		881	Mechanosensitive ion chan	no	no	0.725	0.464	0.361	3e-74
Q9SYM1		856	Mechanosensitive ion chan	no	no	0.765	0.504	0.344	7e-71
F4IME1		849	Mechanosensitive ion chan	no	no	0.734	0.487	0.346	1e-69
O14050		840	Uncharacterized MscS fami	yes	no	0.427	0.286	0.227	6e-09
O74839		1011	Uncharacterized MscS fami	no	no	0.205	0.114	0.275	7e-06

>sp\|Q9LYG9\|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1	Back alignment and function desciption

 Score =  392 bits (1007), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/490 (42%), Positives = 307/490 (62%), Gaps = 38/490 (7%)

Query: 61  SPAANNNNNNKFTDSTGEVNLESY---SDEDEDDVHKDKQKRKILKK--PYVLIELAAFG 115
           S A+ NN +N+   S   V         DEDE+   K K  R++  K     LIE A F 
Sbjct: 117 SRASPNNKSNRSVGSPAPVTPSKVVVEKDEDEEIYKKVKLNREMRSKISTLALIESAFFV 176

Query: 116 CIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLR 175
            I++ L+ SLT+  L++H  W  ++WKWCV ++VI S  LVT   +  ++FLIE N  LR
Sbjct: 177 VILSALVASLTINVLKHHTFWGLEVWKWCVLVMVIFSGMLVTNWFMRLIVFLIETNFLLR 236

Query: 176 QRFMYYVHGLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAA 235
           ++ +Y+VHGL+  ++VF+WL L L+  I LF H VKRS   TK+L  +TR L S L GA 
Sbjct: 237 RKVLYFVHGLKKSVQVFIWLCLILVAWILLFNHDVKRSPAATKVLKCITRTLISILTGAF 296

Query: 236 LWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGMSAG 295
            W +K+  + +LA +F    FF+ IQ+++FHQY++QTLSG PLME  E+V  E    S G
Sbjct: 297 FWLVKTLLLKILAANFNVNNFFDRIQDSVFHQYVLQTLSGLPLMEEAERVGREP---STG 353

Query: 296 -------------KEKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKLSVFSNQLEEFA 342
                        KEK +ID+ K+ K+KR+K+SAWTM+ L++  R+S LS  S+ L+E A
Sbjct: 354 HLSFATVVKKGTVKEKKVIDMGKVHKMKREKVSAWTMRVLMEAVRTSGLSTISDTLDETA 413

Query: 343 EEEEDGEDGEIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLY 402
                      +    +++D E      I SE EA +AA ++F+NVA    +YI +E L 
Sbjct: 414 -----------YGEGKEQADRE------ITSEMEALAAAYHVFRNVAQPFFNYIEEEDLL 456

Query: 403 RFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRL 462
           RF+I EEV L+   F+GAA+T +I    F +WV+KVY  R+AL+H +  +K A ++LN+L
Sbjct: 457 RFMIKEEVDLVFPLFDGAAETGRITRKAFTEWVVKVYTSRRALAHSLNDTKTAVKQLNKL 516

Query: 463 FTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFD 522
            T I++VV +++WL+L+   TT+ L+F ++QLV  AF+ G+T KN+FESI+F++VMHP+D
Sbjct: 517 VTAILMVVTVVIWLLLLEVATTKVLLFFSTQLVALAFIIGSTCKNLFESIVFVFVMHPYD 576

Query: 523 VGDRCIIDGV 532
           VGDRC++DGV
Sbjct: 577 VGDRCVVDGV 586

Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q84M97\|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=2 SV=1	Back alignment and function description

>sp\|F4IME2\|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2	Back alignment and function description

>sp\|Q9LH74\|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1	Back alignment and function description

>sp\|Q9LPG3\|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana GN=MSL4 PE=3 SV=1	Back alignment and function description

>sp\|Q9SYM1\|MSL6_ARATH Mechanosensitive ion channel protein 6 OS=Arabidopsis thaliana GN=MSL6 PE=1 SV=1	Back alignment and function description

>sp\|F4IME1\|MSL7_ARATH Mechanosensitive ion channel protein 7 OS=Arabidopsis thaliana GN=MSL7 PE=3 SV=1	Back alignment and function description

>sp\|O14050\|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1	Back alignment and function description

>sp\|O74839\|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		564
225444788		772	PREDICTED: uncharacterized protein At5g1	0.849	0.620	0.461	1e-118
297738590		644	unnamed protein product [Vitis vinifera]	0.831	0.728	0.464	1e-117
356558409		878	PREDICTED: uncharacterized protein At5g1	0.861	0.553	0.457	1e-117
449452751		762	PREDICTED: mechanosensitive ion channel	0.838	0.620	0.445	1e-116
224092103		622	predicted protein [Populus trichocarpa]	0.836	0.758	0.421	1e-114
356532770		789	PREDICTED: uncharacterized protein At5g1	0.861	0.615	0.453	1e-114
224068408		684	predicted protein [Populus trichocarpa]	0.879	0.725	0.446	1e-112
225444790		772	PREDICTED: uncharacterized protein At5g1	0.843	0.616	0.449	1e-110
297811331		732	mechanosensitive ion channel domain-cont	0.877	0.676	0.411	1e-109
255546009		753	conserved hypothetical protein [Ricinus	0.835	0.625	0.431	1e-108

>gi\|225444788\|ref\|XP_002278293.1\| PREDICTED: uncharacterized protein At5g12080-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  432 bits (1112), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 331/518 (63%), Gaps = 39/518 (7%)

Query: 31  RSQLSTSKS----SASPAHARGADLVEETTQLLTSPAANNNNNNKFTDSTGEVNLESYSD 86
           ++QL  S S    SASP H+  A    +  +  T+PA              E + + Y  
Sbjct: 123 KTQLLPSNSPIADSASPVHSLTATTPRDNVR--TAPATPRTPL-VLDGEDEEEDDDVYKT 179

Query: 87  EDEDDVHKDKQKRKILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVF 146
            +  ++ K+ ++ + +    + +E  AF CIM  LI SLTV +L + +IW  ++WKW V 
Sbjct: 180 SNSPEIEKNSKRLRFV----LWVEWIAFVCIMGCLIASLTVHRLLHTLIWGLEIWKWSVL 235

Query: 147 LLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRIFLF 206
           +LVI   RLVT+  IN ++F+IERN  LR++ +Y+V+GL+  + VF+WL L LL    L 
Sbjct: 236 VLVIFCGRLVTEWCINIVVFMIERNFLLRKKVLYFVYGLKKSVLVFIWLGLILLAWGLLI 295

Query: 207 RHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFH 266
             GVKRS++ T+ILNYVTR LAS L+GAA+W  K+  V +LA SF   RFF+ IQE+IFH
Sbjct: 296 NRGVKRSRKATRILNYVTRALASCLIGAAIWLAKTLLVKILASSFHVTRFFDRIQESIFH 355

Query: 267 QYLIQTLSGPPLMEINEQV----------RSEAFGMSAGKEKYLIDVRKLKKIKRQKISA 316
           QY++QTLSGPPLM + E V          RS   G    KE+ +IDV KL KIK++K+SA
Sbjct: 356 QYVLQTLSGPPLMAMAEMVGSVNSAQLSFRSTKRGKGGEKEE-VIDVGKLHKIKQEKVSA 414

Query: 317 WTMKKLIDVARSSKLSVFSNQLEEFAEEEEDGEDGEIFKNANDKSDEELQMYKSIKSEFE 376
           WTMK LI V R S L+  SN L++      D + GE             Q  K I +E+E
Sbjct: 415 WTMKGLIQVIRGSGLTTISNALDDSV----DDDGGE-------------QKDKEITNEWE 457

Query: 377 AKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKKWVL 436
           A++AA+ IF NVA     +I +E L RF+  EEV  +L  FEGA++T KI+    KKWV+
Sbjct: 458 ARNAASRIFMNVAKPCTKHIDEEDLLRFMKKEEVDNVLPLFEGASETRKIKRSSLKKWVV 517

Query: 437 KVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVL 496
            VY ERK+L+H +  +K A +ELN++ +G++++VIII+WL+LMGF TT  LVFI+SQL+L
Sbjct: 518 NVYLERKSLAHSLNDTKTAIEELNKIASGVMLIVIIIVWLLLMGFATTNVLVFISSQLLL 577

Query: 497 AAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQV 534
            AFMFGNT K +FE+IIF++VMHPFDVGDRC+IDGVQ+
Sbjct: 578 VAFMFGNTCKTVFEAIIFVFVMHPFDVGDRCVIDGVQM 615

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297738590\|emb\|CBI27835.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356558409\|ref\|XP_003547499.1\| PREDICTED: uncharacterized protein At5g12080-like [Glycine max]	Back alignment and taxonomy information

>gi\|449452751\|ref\|XP_004144122.1\| PREDICTED: mechanosensitive ion channel protein 10-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224092103\|ref\|XP_002309474.1\| predicted protein [Populus trichocarpa] gi\|222855450\|gb\|EEE92997.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356532770\|ref\|XP_003534944.1\| PREDICTED: uncharacterized protein At5g12080-like [Glycine max]	Back alignment and taxonomy information

>gi\|224068408\|ref\|XP_002326113.1\| predicted protein [Populus trichocarpa] gi\|222833306\|gb\|EEE71783.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225444790\|ref\|XP_002278315.1\| PREDICTED: uncharacterized protein At5g12080 [Vitis vinifera] gi\|297738591\|emb\|CBI27836.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297811331\|ref\|XP_002873549.1\| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297319386\|gb\|EFH49808.1\| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|255546009\|ref\|XP_002514064.1\| conserved hypothetical protein [Ricinus communis] gi\|223546520\|gb\|EEF48018.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		564
TAIR\|locus:2143069		734	MSL10 "mechanosensitive channe	0.762	0.585	0.422	2.7e-91
TAIR\|locus:2180811		742	MSL9 "mechanosensitive channel	0.792	0.602	0.370	9.3e-84
TAIR\|locus:2099382		881	MSL5 "mechanosensitive channel	0.437	0.280	0.353	5.4e-73
TAIR\|locus:2024927		881	MSL4 "mechanosensitive channel	0.359	0.230	0.386	8.6e-68
TAIR\|locus:2202965		856	MSL6 "mechanosensitive channel	0.436	0.287	0.342	1.3e-67
TAIR\|locus:2827671		849	AT2G17000 "AT2G17000" [Arabido	0.352	0.234	0.357	4.8e-64
DICTYBASE\|DDB_G0277253		870	DDB_G0277253 "mechanosensitive	0.294	0.190	0.224	3.8e-15
UNIPROTKB\|G4NH50		952	MGG_03937 "Serine/threonine pr	0.693	0.410	0.234	5.9e-10
ASPGD\|ASPL0000069490		944	AN7571 [Emericella nidulans (t	0.312	0.186	0.207	1.9e-07
ASPGD\|ASPL0000007479		943	AN6053 [Emericella nidulans (t	0.166	0.099	0.326	3.5e-07

TAIR\|locus:2143069 MSL10 "mechanosensitive channel of small conductance-like 10" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 910 (325.4 bits), Expect = 2.7e-91, P = 2.7e-91
 Identities = 194/459 (42%), Positives = 284/459 (61%)

Query:    86 DEDEDDVHKDKQKRKILKK--PYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKW 143
             DEDE+   K K  R++  K     LIE A F  I++ L+ SLT+  L++H  W  ++WKW
Sbjct:   145 DEDEEIYKKVKLNREMRSKISTLALIESAFFVVILSALVASLTINVLKHHTFWGLEVWKW 204

Query:   144 CVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFMYYVHGLRIIIRVFVWLSLFLLVRI 203
             CV ++VI S  LVT   +  ++FLIE N  LR++ +Y+VHGL+  ++VF+WL L L+  I
Sbjct:   205 CVLVMVIFSGMLVTNWFMRLIVFLIETNFLLRRKVLYFVHGLKKSVQVFIWLCLILVAWI 264

Query:   204 FLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQET 263
              LF H VKRS   TK+L  +TR L S L GA  W +K+  + +LA +F    FF+ IQ++
Sbjct:   265 LLFNHDVKRSPAATKVLKCITRTLISILTGAFFWLVKTLLLKILAANFNVNNFFDRIQDS 324

Query:   264 IFHQYLIQTLSGPPLMEINEQVRSE------AFG--MSAG--KEKYLIDVRKLKKIKRQK 313
             +FHQY++QTLSG PLME  E+V  E      +F   +  G  KEK +ID+ K+ K+KR+K
Sbjct:   325 VFHQYVLQTLSGLPLMEEAERVGREPSTGHLSFATVVKKGTVKEKKVIDMGKVHKMKREK 384

Query:   314 ISAWTMKKLIDVARSSKLSVFSNQLXXXXXXXXXXXXXXIFKNANDKSDEELQMYKSIKS 373
             +SAWTM+ L++  R+S LS  S+ L               +    +++D E      I S
Sbjct:   385 VSAWTMRVLMEAVRTSGLSTISDTLDETA-----------YGEGKEQADRE------ITS 427

Query:   374 EFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVSLLLNQFEGAAKTEKIQELEFKK 433
             E EA +AA ++F+NVA    +YI +E L RF+I EEV L+   F+GAA+T +I    F +
Sbjct:   428 EMEALAAAYHVFRNVAQPFFNYIEEEDLLRFMIKEEVDLVFPLFDGAAETGRITRKAFTE 487

Query:   434 WVLKVYNERKALSHFIKQSKAATQELNRLFTGXXXXXXXXXXXXXMGFLTTQALVFITSQ 493
             WV+KVY  R+AL+H +  +K A ++LN+L T              +   TT+ L+F ++Q
Sbjct:   488 WVVKVYTSRRALAHSLNDTKTAVKQLNKLVTAILMVVTVVIWLLLLEVATTKVLLFFSTQ 547

Query:   494 LVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGV 532
             LV  AF+ G+T KN+FESI+F++VMHP+DVGDRC++DGV
Sbjct:   548 LVALAFIIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGV 586

GO:0005634 "nucleus" evidence=ISM

GO:0016020 "membrane" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=IDA

GO:0008381 "mechanically-gated ion channel activity" evidence=IDA;IMP

GO:0050982 "detection of mechanical stimulus" evidence=IMP

GO:0006820 "anion transport" evidence=IDA

TAIR\|locus:2180811 MSL9 "mechanosensitive channel of small conductance-like 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2099382 MSL5 "mechanosensitive channel of small conductance-like 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024927 MSL4 "mechanosensitive channel of small conductance-like 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2202965 MSL6 "mechanosensitive channel of small conductance-like 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827671 AT2G17000 "AT2G17000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0277253 DDB_G0277253 "mechanosensitive ion channel domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|G4NH50 MGG_03937 "Serine/threonine protein kinase" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000069490 AN7571 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000007479 AN6053 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016479001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (761 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		564
COG0668		316	COG0668, MscS, Small-conductance mechanosensitive	0.002
pfam00924		202	pfam00924, MS_channel, Mechanosensitive ion channe	0.003

>gnl\|CDD\|223740 COG0668, MscS, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

 Score = 39.9 bits (93), Expect = 0.002
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 431 FKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFI 490
             K +L+     KAL   + +    +  L+ L   +++VV +++ L ++G   T  L  +
Sbjct: 59  LVKLLLRSLLLLKALIRRLARETTLSVFLSNLLRILILVVALLIVLSVLGVQVTSLLAGL 118

Query: 491 TSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDR 526
            +  +       + + N+  + IFL +  PF VGD 
Sbjct: 119 GALGLAIGLALQDLLSNLI-AGIFLLLERPFKVGDW 153

Length = 316

>gnl\|CDD\|201506 pfam00924, MS_channel, Mechanosensitive ion channel	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		564
KOG4629		714	consensus Predicted mechanosensitive ion channel [	100.0
PRK10334		286	mechanosensitive channel MscS; Provisional	99.72
PRK11281		1113	hypothetical protein; Provisional	99.68
PF00924		206	MS_channel: Mechanosensitive ion channel; InterPro	99.65
PRK11465		741	putative mechanosensitive channel protein; Provisi	99.61
PRK10929		1109	putative mechanosensitive channel protein; Provisi	99.6
COG0668		316	MscS Small-conductance mechanosensitive channel [C	99.53
COG3264		835	Small-conductance mechanosensitive channel [Cell e	99.35
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	98.36
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	97.51
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	97.39
cd00052		67	EH Eps15 homology domain; found in proteins implic	97.17
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	97.06
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	96.87
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	96.85
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	96.81
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	96.76
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	96.75
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	96.68
cd00213		88	S-100 S-100: S-100 domain, which represents the la	96.64
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	96.51
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	96.46
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	96.29
PTZ00183		158	centrin; Provisional	96.22
PLN02964		644	phosphatidylserine decarboxylase	96.2
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	96.13
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	96.06
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	96.06
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	96.05
PTZ00184		149	calmodulin; Provisional	95.98
PTZ00184		149	calmodulin; Provisional	95.85
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	95.82
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	95.69
PTZ00183		158	centrin; Provisional	95.67
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	95.57
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	95.05
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	94.95
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	94.76
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	94.12
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	92.21
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	92.03
KOG0038		189	consensus Ca2+-binding kinase interacting protein	91.2
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	90.68
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	90.58
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	89.75
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	89.56
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	89.0
cd00213		88	S-100 S-100: S-100 domain, which represents the la	87.29
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	87.04
KOG0036		463	consensus Predicted mitochondrial carrier protein	86.06
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	85.81
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	84.0
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	83.82
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	83.44
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	82.89
cd00052		67	EH Eps15 homology domain; found in proteins implic	82.84
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	82.24
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	81.8
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	80.95
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	80.9
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	80.74

>KOG4629 consensus Predicted mechanosensitive ion channel [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

Probab=100.00  E-value=8.5e-73  Score=628.50  Aligned_cols=428  Identities=38%  Similarity=0.643  Sum_probs=389.9

Q ss_pred             hhhccchhhHHHHHHHHHHHHHHHHhhcccccccccccchhhHHHHHHHHHHHHHHHHhHHHHHhhhhhccccccchhhH
Q 008473          100 KILKKPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCRLVTKSLINALLFLIERNSSLRQRFM  179 (564)
Q Consensus       100 ~~~~~~~~~~r~~~~v~~~~~Ll~~~~i~~~~~~~i~~~~lw~w~v~~lv~~~g~lva~~~~~~~~fli~~~~~~~kk~~  179 (564)
                      -.. ++..++.|+.++++++.++|++.|........|++..|+|++.+++..||+++..|..++++|+++.|+..+++|+
T Consensus       144 ~~~-~~~~~i~~I~~~~iv~~lv~~l~i~~~~~~~~~~~~~~kw~~~~~v~~~~~lv~~~~~~~vvf~~~~n~~~r~~~l  222 (714)
T KOG4629|consen  144 SLL-SSITVITWILLVLIVSSLVCSLGIHVHRLVTLWSLILWKWLVTLLVRITAVLVSSWFAALVVFLIESNFLRRKKVL  222 (714)
T ss_pred             ccc-ccHHHHHHHHHHHHHHHHHhhhhhheecccceEEEEeeeehhhhHHHHHHHHHHhhHHHHHHHHhhhhHHHHHHHH
Confidence            444 4899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHhHHhHHHHHHHHH-HHHHHHHHHHhcCCCCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhh
Q 008473          180 YYVHGLRIIIRVFVWLS-LFLLVRIFLFRHGVKRSKETTKILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFN  258 (564)
Q Consensus       180 y~v~~L~~~v~~~~W~~-~~l~~~~~l~~~~~~~~~~~~~~l~~v~kvL~~~~v~a~i~l~ekiliq~IA~sFH~~~y~d  258 (564)
                      |+++|+++.++.|.|++ +++++|+.+++..+.+....+ .+..++++ +|+++.+.+|++||+++|++|++||+++|++
T Consensus       223 ~~v~~~~~~vq~~~~l~~lv~law~~l~d~~v~~~~r~~-~l~~~~~~-i~lli~~~~~lv~ti~~kv~as~f~~s~~~~  300 (714)
T KOG4629|consen  223 YFVYGLRKFVQTGIWLGKLVLLAWIFLFDKIVFRKTRAK-FLAFVTML-ITLLITEFMWLVKTILMKVIASSFHRSTYFS  300 (714)
T ss_pred             HHHhhhHHHHHHHHHHhHHHHHHHHHhhhhhhhhhhhhh-hhhhhhhh-hhhhHHHHHhhchhhhhHHHHHHHhHHHHHh
Confidence            99999999999999999 999999999998887665545 77899999 9999999999999999999999999999999


Q ss_pred             hHHHhHHHHHHHHHhcCCCcchhhhhhccccCCC-------CccccccccchHhHHhhhccccchhhHHHHHHhhhcccc
Q 008473          259 PIQETIFHQYLIQTLSGPPLMEINEQVRSEAFGM-------SAGKEKYLIDVRKLKKIKRQKISAWTMKKLIDVARSSKL  331 (564)
Q Consensus       259 RIqesk~~~~~L~~L~~~~~~~~~~~~~~~~~~~-------~~~~ed~~i~~~~l~k~~~~~~sa~~mk~l~~~v~~~~l  331 (564)
                      ||||++|+||+|++|++||+.|   +.||.+.++       .-. ....+++++++++++.+.|||+|+++++.++..++
T Consensus       301 rI~e~~f~q~~l~~Lsg~p~~e---~~gr~s~~~~~~s~~~~r~-~s~~i~~~~l~~~~~~~~sa~~~~~~~~~~~~~~~  376 (714)
T KOG4629|consen  301 RIQESVFTQEVLETLSGPPREE---DVGRESTFRAIFSPGLSRS-GSAKIGMDKLHKIKKKNVSAWNMRRLMTILAAGGL  376 (714)
T ss_pred             hcchhhhhHHHHHHhcCCcccc---cccccccceeeccccccch-hhcccccchhhhhhHhhhcHhhhhHHHHHHhccCc
Confidence            9999999999999999999833   345432111       111 11227889999999999999999999999999999


Q ss_pred             cchhhhhhhhhcccccCccccccccCCCchhHHHhhhhccCCHHHHHHHHHHHHHHhccCCCccccHhHHhhcCCHHHHH
Q 008473          332 SVFSNQLEEFAEEEEDGEDGEIFKNANDKSDEELQMYKSIKSEFEAKSAANYIFKNVADTGCDYIGKEQLYRFLIAEEVS  411 (564)
Q Consensus       332 st~~~~~~~~~~v~~e~tg~~v~~~~~~~s~v~~al~~~i~se~eAkalAr~IF~s~~~~g~~~I~~eDl~~fl~~eeA~  411 (564)
                      ++++........  .+..                  ..++.|+++|+++|++||+++++||..++++||+.+|+++|+|+
T Consensus       377 t~l~~~~~~s~~--~~~~------------------~~~i~s~~~a~~aA~~iF~nv~~p~~~~i~ld~~~~f~~~E~a~  436 (714)
T KOG4629|consen  377 TTLSPGFQLSTS--KDSS------------------IIEIRSEKEAKIAARKIFKNVAKPGVILIDLDDLLRFMGDEEAE  436 (714)
T ss_pred             ccCCcccccccc--ccch------------------hhhhhhhhhHHHHHHHHHhccCCCCccchhhhhhhhcCCHHHHH
Confidence            988876543210  0000                  25789999999999999999999999999999999999999999


Q ss_pred             HHHHhccccCCCCcccHHHHHHHHHHHHHHhhhhhhhhhchhHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHH
Q 008473          412 LLLNQFEGAAKTEKIQELEFKKWVLKVYNERKALSHFIKQSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFIT  491 (564)
Q Consensus       412 ~aF~lFD~d~~nG~IS~~El~~~v~~i~~ERk~L~~SL~d~~t~i~~L~~il~~iv~iI~iii~L~ilgv~~t~lla~~g  491 (564)
                      .+|++|+.. ..+.||++++++|++++|+||++|+++|+|+++++++||+++++++.++++++++..+|++++++++.++
T Consensus       437 ~~~slfe~~-~~~~Itrs~~~~~iv~~~~ERk~L~~tL~d~~taV~kL~~il~~Iv~vv~~~i~lil~~i~~~~~l~~~~  515 (714)
T KOG4629|consen  437 RAFSLFEGA-SDENITRSSFKEWIVNIYRERKALARTLNDTKTAVNKLDRILNFIVAVVLLVIWLILLGINTSKLLLVIS  515 (714)
T ss_pred             HHHHhhhhh-cccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccceeeeeeec
Confidence            999999997 4444999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhhHHHHHhHhhhhhhcCCcCCCcEEEECCccccccccccEEEEEeeeEEEEEecCCcccc
Q 008473          492 SQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFITD  562 (564)
Q Consensus       492 s~~lalsF~f~~t~~n~~~siIFIfv~hPFdVGDrV~I~g~~~~~~~~~~~VeeI~Ll~Tvf~~~dG~v~~  562 (564)
                      +++++++|+|+++++++++|+||+|+.|||||||||.|||+++       +|++|||++|+|.++||+++.
T Consensus       516 sq~v~l~fif~~~~k~~~esiIFlfv~HPyDvGDRv~VDg~~~-------vVeemnLlsTvF~~~dg~kI~  579 (714)
T KOG4629|consen  516 SQLVGLAFIFGNIVKELLESIIFLFVMHPYDVGDRVVVDGVNL-------VVEEMNLLSTVFLRVDGRKIF  579 (714)
T ss_pred             ccceeeeeehhhHHHHHHHHHhheeecCCCCCCCeEEEeceEE-------EEEEeccceEEEEEECCeEEE
Confidence            9999999999999999999999999999999999999999999       999999999999999998763

>PRK10334 mechanosensitive channel MscS; Provisional	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF00924 MS_channel: Mechanosensitive ion channel; InterPro: IPR006685 Mechanosensitive (MS) channels provide protection against hypo-osmotic shock, responding both to stretching of the cell membrane and to membrane depolarisation	Back alignment and domain information

>PRK11465 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>COG0668 MscS Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		564
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-05

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 61.0 bits (147), Expect = 6e-10
 Identities = 66/469 (14%), Positives = 132/469 (28%), Gaps = 135/469 (28%)

Query: 44  AHARGADLVEETTQLLTSPAANNNNNNKFTDSTGEVNLESYSDEDEDDVHKDKQKRKILK 103
            +    + V E  Q L      N  +     S  ++ + S          + + +R +  
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSI---------QAELRRLLKS 240

Query: 104 KPYVLIELAAFGCIMALLICSLTVKQLQNHVIWDFKLWKWCVFLLVIVSCR-LVT---KS 159
           KPY             LL+       L N  + + K W    F L   SC+ L+T   K 
Sbjct: 241 KPYE----------NCLLV-------LLN--VQNAKAWN--AFNL---SCKILLTTRFKQ 276

Query: 160 LINALLFLIERNSSLRQRFMYYVH--GLRIIIRVFVWLSLFLLVRIFLFRHGVKRSKETT 217
           + + L      + SL    M         +       L  +L  R            E  
Sbjct: 277 VTDFLSAATTTHISLDHHSMTLTPDEVKSL-------LLKYLDCRPQDLPR------EVL 323

Query: 218 KILNYVTRVLASSLVGAALWCLKSFSVLLLAVSFQSKRFFNPIQETIFHQYLIQTLSGPP 277
                       S++  ++                 +          +       L+   
Sbjct: 324 TTNP-----RRLSIIAESI-----------------RDGLATWDN--WKHVNCDKLTTII 359

Query: 278 LMEINEQVRSEAFGMSAGKEKYL---I---DVRKLKKIKRQKISA-WTMKKLIDVARSSK 330
              +N    +E       ++ +    +          I    +S  W      DV     
Sbjct: 360 ESSLNVLEPAEY------RKMFDRLSVFPPSA----HIPTILLSLIWFDVIKSDV----- 404

Query: 331 LSVFSNQLEEFAEEEEDGEDG-----EIFKNANDKSDEELQMYKSI-----------KSE 374
             V  N+L +++  E+  ++       I+     K + E  +++SI             +
Sbjct: 405 -MVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDD 463

Query: 375 FEAKSAANYIFKNVAD--TGCDYIGKEQL-------YRFLIA--EEVSLLLNQFEGAAKT 423
                   Y + ++       ++  +  L       +RFL       S   N       T
Sbjct: 464 LIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNT 523

Query: 424 EKIQELEF-KKWVLK---VYNER-KALSHFIKQSKAATQELNRLFTGIV 467
             +Q+L+F K ++      Y     A+  F+ +       +   +T ++
Sbjct: 524 --LQQLKFYKPYICDNDPKYERLVNAILDFLPK--IEENLICSKYTDLL 568

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		564
3udc_A		285	Small-conductance mechanosensitive channel, C-TER	99.73
2vv5_A		286	MSCS, small-conductance mechanosensitive channel;	99.73
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.76
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	97.65
3li6_A		66	Calcium-binding protein; calcium signaling protein	97.58
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	97.56
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	97.5
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	97.47
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	97.44
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	97.39
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	97.38
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	97.35
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	97.35
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	97.35
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	97.34
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	97.32
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	97.29
1c07_A		95	Protein (epidermal growth factor receptor pathway	97.29
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	97.28
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	97.28
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	97.26
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	97.25
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	97.25
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	97.23
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	97.23
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	97.21
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	97.21
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	97.2
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	97.19
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	97.18
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	97.18
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	97.15
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	97.13
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	97.13
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	97.12
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	97.1
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	97.1
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	97.09
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	97.09
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	97.09
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	97.08
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	97.07
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	97.06
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	97.06
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	97.05
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	97.04
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	97.03
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	97.03
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	97.03
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	97.03
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	97.03
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	97.0
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	97.0
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	97.0
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	97.0
3fwb_A		161	Cell division control protein 31; gene gating, com	97.0
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	97.0
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	96.99
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	96.99
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	96.98
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	96.98
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	96.98
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	96.97
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	96.97
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	96.97
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	96.97
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	96.97
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	96.97
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	96.96
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	96.95
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	96.94
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	96.92
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	96.92
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	96.92
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	96.91
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	96.91
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	96.91
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	96.91
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	96.9
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	96.9
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	96.89
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	96.89
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	96.89
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	96.89
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	96.88
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	96.88
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	96.87
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	96.86
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	96.86
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	96.86
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	96.86
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	96.86
2jq6_A		139	EH domain-containing protein 1; metal binding prot	96.86
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	96.85
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	96.85
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	96.85
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	96.84
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	96.84
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	96.83
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	96.83
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	96.83
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	96.83
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	96.82
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	96.82
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	96.81
3fwb_A		161	Cell division control protein 31; gene gating, com	96.81
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	96.81
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	96.8
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	96.79
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	96.79
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	96.79
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	96.79
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	96.79
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	96.78
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	96.78
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	96.78
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	96.78
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	96.77
1y1x_A		191	Leishmania major homolog of programmed cell death	96.76
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	96.76
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	96.75
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	96.75
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	96.73
2hps_A		186	Coelenterazine-binding protein with bound coelent;	96.72
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	96.71
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	96.71
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	96.71
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	96.71
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	96.71
2jnf_A		158	Troponin C; stretch activated muscle contraction,	96.7
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	96.69
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	96.68
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	96.67
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	96.66
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	96.66
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	96.66
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	96.66
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	96.65
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	96.65
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	96.65
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	96.65
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	96.65
1y1x_A		191	Leishmania major homolog of programmed cell death	96.64
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	96.63
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	96.63
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	96.62
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	96.62
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	96.62
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	96.62
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	96.61
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	96.61
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	96.6
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	96.59
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	96.58
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	96.58
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	96.58
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	96.57
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	96.56
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	96.56
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	96.55
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	96.54
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	96.54
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	96.53
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	96.53
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	96.53
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	96.52
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	96.52
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	96.5
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	96.49
2jnf_A		158	Troponin C; stretch activated muscle contraction,	96.48
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	96.46
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	96.46
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	96.45
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	96.44
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	96.43
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	96.42
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	96.42
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	96.4
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	96.39
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	96.37
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	96.37
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	96.37
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	96.36
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	96.35
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	96.33
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	96.33
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	96.33
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	96.29
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	96.28
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	96.26
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	96.25
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	96.22
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	96.21
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	96.21
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	96.18
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	96.15
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	96.13
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	96.12
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	96.12
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	96.12
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	96.1
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	96.09
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	96.08
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	96.07
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	96.07
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	96.07
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	96.06
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	96.06
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	96.01
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	95.98
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	95.98
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	95.97
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	95.95
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	95.94
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	95.94
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	95.93
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	95.91
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	95.89
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	95.86
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	95.83
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	95.77
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	95.77
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	95.72
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	95.69
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	95.63
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	95.62
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	95.57
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	95.5
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	95.5
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	95.5
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	95.46
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	95.45
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	95.44
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	95.42
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	95.21
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	95.12
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	95.1
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	95.07
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	95.06
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	95.04
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	94.93
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	94.87
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	94.75
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	94.15
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	93.52
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	93.45
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	93.07
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	92.81
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	92.4
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	91.75
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	91.64
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	91.61
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	91.48
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	91.38
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	91.24
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	91.04
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	90.84
1c07_A		95	Protein (epidermal growth factor receptor pathway	90.84
2hps_A		186	Coelenterazine-binding protein with bound coelent;	90.82
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	90.72
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	90.61
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	90.57
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	90.46
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	90.42
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	90.4
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	90.38
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	90.35
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	90.35
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	89.95
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	89.9
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	89.88
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	89.87
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	89.65
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	89.6
3li6_A		66	Calcium-binding protein; calcium signaling protein	89.39
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	89.26
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	89.2
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	89.11
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	88.89
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	88.64
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	88.4
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	88.0
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	87.96
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	87.89
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	87.61
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	87.23
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	87.18
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	87.01
1nub_A		229	Basement membrane protein BM-40; extracellular mod	86.97
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	86.9
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	86.7
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	86.64
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	86.42
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	86.28
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	85.82
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	85.51
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	85.48
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	85.36
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	85.23
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	83.81
2jq6_A		139	EH domain-containing protein 1; metal binding prot	83.42
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	82.36
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	81.75
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	81.09
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	80.74
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	80.68
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	80.41

>3udc_A Small-conductance mechanosensitive channel, C-TER peptide from small-conductance...; membrane protein; 3.35A {Thermoanaerobacter tengcongensis} PDB: 3t9n_A*	Back alignment and structure

Probab=99.73  E-value=1.8e-17  Score=168.87  Aligned_cols=103  Identities=17%  Similarity=0.120  Sum_probs=96.4

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHhhhhHHHHHhHhhhhhhcCCcCCCcEEEEC
Q 008473          451 QSKAATQELNRLFTGIVVVVIIILWLILMGFLTTQALVFITSQLVLAAFMFGNTVKNIFESIIFLYVMHPFDVGDRCIID  530 (564)
Q Consensus       451 d~~t~i~~L~~il~~iv~iI~iii~L~ilgv~~t~lla~~gs~~lalsF~f~~t~~n~~~siIFIfv~hPFdVGDrV~I~  530 (564)
                      ..+++...+.+++.+++++++++++|..+|++++++++++|..++++||++|++++|+++|++ |++.|||+|||+|+++
T Consensus        60 ~~~tl~~~~~~~~~~~i~~~~~~~~l~~~g~~~~~l~a~~g~~g~aig~a~q~~l~n~~~Gi~-i~~~~pf~vGD~I~i~  138 (285)
T 3udc_A           60 KIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFF-IIFEDQFSVGDYVTIN  138 (285)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHH-HHHTTSCCTTCEEEET
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhhCCccCCCEEEEC
Confidence            345788889999999999999999999999999999999999999999999999999999975 9999999999999999


Q ss_pred             CccccccccccEEEEEeeeEEEEEecCCccc
Q 008473          531 GVQVTDIFILKIEVCVSLLYRVLFALQLFIT  561 (564)
Q Consensus       531 g~~~~~~~~~~~VeeI~Ll~Tvf~~~dG~v~  561 (564)
                      |..|       +|++|++++|+++++||+.+
T Consensus       139 ~~~G-------~V~~I~l~~T~i~t~d~~~v  162 (285)
T 3udc_A          139 GISG-------TVEEIGLRVTKIRGFSDGLH  162 (285)
T ss_dssp             TEEE-------EEEEECSSEEEEEETTTEEE
T ss_pred             CEEE-------EEEEeeeeEEEEecCCCCEE
Confidence            9998       89999999999999999753

PyMOL of 3udc

>2vv5_A MSCS, small-conductance mechanosensitive channel; ION transport, transmembrane, inner membrane, membrane struc membrane protein, membrane; 3.45A {Escherichia coli} SCOP: b.38.1.3 d.58.43.1 f.34.1.1 PDB: 2oau_A	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		564
d2vv5a1		67	Mechanosensitive channel protein MscS (YggB), midd	99.18
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	98.03
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	97.73
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	97.71
d2vv5a3		86	Mechanosensitive channel protein MscS (YggB), tran	97.68
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	97.66
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	97.59
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	97.55
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	97.55
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	97.52
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	97.45
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	97.44
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	97.43
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	97.4
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	97.39
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	97.39
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.38
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.36
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	97.35
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	97.35
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	97.32
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	97.32
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	97.28
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	97.28
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	97.27
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	97.27
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	97.26
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	97.25
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	97.25
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	97.23
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	97.18
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	97.18
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	97.17
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	97.16
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	97.14
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	97.11
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	97.09
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	97.08
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.05
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	96.98
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	96.93
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	96.81
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	96.8
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	96.78
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	96.77
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	96.75
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	96.74
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	96.73
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	96.73
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	96.69
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	96.68
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	96.67
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	96.66
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	96.65
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	96.65
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	96.61
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	96.58
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	96.53
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	96.52
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	96.4
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	96.39
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	96.38
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	96.33
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	96.28
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	96.27
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	96.26
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	96.19
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	96.19
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	96.16
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	96.15
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	96.0
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	95.98
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	95.98
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	95.94
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	95.87
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	95.8
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	95.8
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	95.79
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	95.75
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	95.73
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	95.7
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	95.65
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	95.6
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	95.54
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	95.54
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	95.51
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	95.5
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	95.44
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	95.41
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	95.37
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	95.35
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	95.26
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	95.22
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	95.07
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	94.95
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	94.95
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	94.8
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	94.79
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	94.75
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	94.68
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	94.39
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	94.39
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	94.35
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	94.34
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	94.27
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	94.1
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	94.04
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	93.96
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	93.88
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	93.79
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	93.71
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	93.67
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	93.54
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.53
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	93.47
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.31
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	93.15
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	92.95
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	92.83
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	92.82
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	91.78
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	91.74
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	91.66
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	91.6
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	91.53
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	91.27
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	91.22
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	91.13
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	90.94
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	90.72
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	90.59
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	90.31
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	89.57
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	87.95
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	87.81
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	87.66
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	87.56
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	87.37
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	83.32
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	82.86
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	82.65
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	80.98

>d2vv5a1 b.38.1.3 (A:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Mechanosensitive channel protein MscS (YggB), middle domain
domain: Mechanosensitive channel protein MscS (YggB), middle domain
species: Escherichia coli [TaxId: 562]

Probab=99.18  E-value=9e-12  Score=98.99  Aligned_cols=51  Identities=18%  Similarity=0.328  Sum_probs=47.5

Q ss_pred             hhHHHHHhHhhhhhhcCCcCCCcEEEECCccccccccccEEEEEeeeEEEEEecCCccc
Q 008473          503 NTVKNIFESIIFLYVMHPFDVGDRCIIDGVQVTDIFILKIEVCVSLLYRVLFALQLFIT  561 (564)
Q Consensus       503 ~t~~n~~~siIFIfv~hPFdVGDrV~I~g~~~~~~~~~~~VeeI~Ll~Tvf~~~dG~v~  561 (564)
                      ++++|+++|++ +++.+||++||+|+|+|..|       .|++|++++|++++.||+.+
T Consensus         1 GtlsN~~sGi~-i~~~~pf~vGD~I~i~~~~G-------~V~~I~l~~T~l~~~dg~~i   51 (67)
T d2vv5a1           1 GSLSNLAAGVL-LVMFRPFRAGEYVDLGGVAG-------TVLSVQIFSTTMRTADGKII   51 (67)
T ss_dssp             HHHHHHHHHHH-HHTTCSSCTTCEEESSSCEE-------EEEEECSSEEEEECTTSCEE
T ss_pred             CcHHHHHHHhh-heeeCCccCCCEEEECCEEE-------EEEEEeceEEEEEccCCCEE
Confidence            47899999995 99999999999999999998       89999999999999999764

PyMOL of d2vv5a1

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vv5a3 f.34.1.1 (A:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure