Citrus Sinensis ID: 008477
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SJ85 | 578 | BTB/POZ domain-containing | yes | no | 0.781 | 0.762 | 0.702 | 0.0 | |
| Q5XIU1 | 478 | Ankyrin repeat and BTB/PO | yes | no | 0.595 | 0.702 | 0.314 | 7e-41 | |
| Q99LJ2 | 478 | Ankyrin repeat and BTB/PO | yes | no | 0.595 | 0.702 | 0.314 | 2e-40 | |
| Q969K4 | 478 | Ankyrin repeat and BTB/PO | yes | no | 0.595 | 0.702 | 0.303 | 3e-38 | |
| Q10225 | 523 | BTB/POZ domain-containing | yes | no | 0.244 | 0.263 | 0.319 | 1e-14 | |
| P40560 | 513 | Ankyrin repeat-containing | yes | no | 0.248 | 0.272 | 0.271 | 8e-12 | |
| D3ZZC3 | 634 | Kelch-like protein 22 OS= | no | no | 0.140 | 0.124 | 0.35 | 3e-06 | |
| Q53GT1 | 634 | Kelch-like protein 22 OS= | no | no | 0.140 | 0.124 | 0.35 | 3e-06 | |
| D2HEW7 | 634 | Kelch-like protein 22 OS= | no | no | 0.140 | 0.124 | 0.35 | 4e-06 | |
| Q8IWZ3 | 2542 | Ankyrin repeat and KH dom | no | no | 0.113 | 0.025 | 0.430 | 7e-06 |
| >sp|Q9SJ85|Y2474_ARATH BTB/POZ domain-containing protein At2g04740 OS=Arabidopsis thaliana GN=At2g04740 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 682 bits (1761), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 333/474 (70%), Positives = 386/474 (81%), Gaps = 33/474 (6%)
Query: 23 FSSSVPLKKVPNGDVFEASRAGDVDRLRYILESGVNVNARDQWDSVALYYACLAGHLDAA 82
+ SVPLKKVPNGD+FEASRAGDVDRLRY++E+GVNVNARD+WDSVALYYACLAGH+D+A
Sbjct: 26 YKPSVPLKKVPNGDIFEASRAGDVDRLRYLVETGVNVNARDRWDSVALYYACLAGHIDSA 85
Query: 83 RMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAYEARPPPLGPLQAALRDTFLGCGAN 142
R+LLE+GAICSEHTFDGDRCHYA+LNL++RKLLKA+EARPPPL PLQA+LRDTFLGC N
Sbjct: 86 RLLLENGAICSEHTFDGDRCHYASLNLRIRKLLKAFEARPPPLAPLQASLRDTFLGCCHN 145
Query: 143 RQFLEEAEVVLGISGVTSNGASNSDSFPPDVVFYVQGRPIEAHRVILSARSVFFRRKFET 202
R +L++ E L +S S S S+ FPPDV+FYVQGRPIEAHRVILSARS FF++KFE
Sbjct: 146 RDYLQQEEANLDVSDTLSEFGS-SNYFPPDVMFYVQGRPIEAHRVILSARSPFFKQKFEN 204
Query: 203 DWRYRNEIRFSREKLSYPALYGLIHFFYSDRLEIAVDDMEDLVKICKVCKCESLQRIIEK 262
+W+ R E+RFS+EKLSYPAL LIHFFYSDRLEI+VDDMEDLV+ICKVCKCESLQ+IIEK
Sbjct: 205 EWKDRREVRFSKEKLSYPALCSLIHFFYSDRLEISVDDMEDLVRICKVCKCESLQKIIEK 264
Query: 263 ELIHQKYAEYKALRDVDNSQKRFILQGSALPEEDRLPAALSRILQISLARSNMDHNIDNG 322
ELIHQ+YAEYK RD+DNS KRFILQG +LPEEDRLPA+L RIL++SLA+S + ID
Sbjct: 265 ELIHQRYAEYKTHRDLDNSMKRFILQGISLPEEDRLPASLHRILRVSLAKSFVGDVID-- 322
Query: 323 ICKLSSSVEAMHISDHVDDLADVCVRVDKKIFRCHQVVLASRSEYFKARLSRMKDFYEGK 382
SSV + D V+ LADVCVRVDK+ F CHQV+LASRSEYF+ARLSR+ DF+EGK
Sbjct: 323 -----SSVGDTRVGDSVESLADVCVRVDKRNFYCHQVILASRSEYFRARLSRVNDFHEGK 377
Query: 383 EGLPGDILPCIEEHDLSKETFEKMIEYMYTDGLKDIDPDQVCCNSVTWLVALGSNLPNFV 442
GLPGD LP +EEHDLS E FEKMIEYMYTDGLK+I+P+
Sbjct: 378 NGLPGDTLPFLEEHDLSAEAFEKMIEYMYTDGLKEINPN--------------------- 416
Query: 443 PFDEQAEEMFDAASRYLLFPLKRAVADVLLLHLEMVSPAELCHWLILSDMYAAI 496
QAEE+FD ASRYLLFPLKRAVAD LL HLE +PAELC WL+LSDMY +
Sbjct: 417 ----QAEEIFDVASRYLLFPLKRAVADALLPHLETATPAELCQWLVLSDMYGVL 466
|
May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q53GT1|KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens GN=KLHL22 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | ||||||
| 225446991 | 575 | PREDICTED: BTB/POZ domain-containing pro | 0.833 | 0.817 | 0.759 | 0.0 | |
| 255583036 | 587 | protein binding protein, putative [Ricin | 0.822 | 0.790 | 0.757 | 0.0 | |
| 224131766 | 587 | predicted protein [Populus trichocarpa] | 0.836 | 0.804 | 0.756 | 0.0 | |
| 449441674 | 577 | PREDICTED: BTB/POZ domain-containing pro | 0.829 | 0.811 | 0.716 | 0.0 | |
| 42568941 | 578 | ankyrin repeat-containing protein [Arabi | 0.781 | 0.762 | 0.702 | 0.0 | |
| 297831554 | 581 | ankyrin repeat family protein [Arabidops | 0.783 | 0.760 | 0.693 | 0.0 | |
| 356577448 | 606 | PREDICTED: BTB/POZ domain-containing pro | 0.815 | 0.759 | 0.684 | 0.0 | |
| 413944399 | 580 | hypothetical protein ZEAMMB73_515710 [Ze | 0.796 | 0.774 | 0.583 | 1e-149 | |
| 357118056 | 587 | PREDICTED: BTB/POZ domain-containing pro | 0.792 | 0.761 | 0.577 | 1e-149 | |
| 297739140 | 318 | unnamed protein product [Vitis vinifera] | 0.553 | 0.981 | 0.821 | 1e-148 |
| >gi|225446991|ref|XP_002268472.1| PREDICTED: BTB/POZ domain-containing protein At2g04740-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 767 bits (1981), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 378/498 (75%), Positives = 418/498 (83%), Gaps = 28/498 (5%)
Query: 1 MPSNRQS-TIDAELDEIDLDASDFSSSVPLKKVPNGDVFEASRAGDVDRLRYILESGVNV 59
M + R S TID +LD IDL+ DF++S+P+KKVP GDVFEASRAGDVDRLRY+LESGVNV
Sbjct: 1 MSTPRPSWTIDPDLDTIDLEPEDFAASLPIKKVPAGDVFEASRAGDVDRLRYLLESGVNV 60
Query: 60 NARDQWDSVALYYACLAGHLDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAYE 119
NARDQWDSVALYYACLAGHLDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKA+E
Sbjct: 61 NARDQWDSVALYYACLAGHLDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAFE 120
Query: 120 ARPPPLGPLQAALRDTFLGCGANRQFLEEAEVVLGIS-GVTSNGASNSDSFPPDVVFYVQ 178
ARPPPLGPLQ ALR+TFLGC ANR + EE E S G++SNG N D FPPDV FYVQ
Sbjct: 121 ARPPPLGPLQGALRETFLGCAANRIYSEELEGQFQNSAGLSSNGGLNRDHFPPDVAFYVQ 180
Query: 179 GRPIEAHRVILSARSVFFRRKFETDWRYRNEIRFSREKLSYPALYGLIHFFYSDRLEIAV 238
GRPIEAHR+ILSARS FF+RKFE+DW+ R E+RFSREKLSYPALY LIHFFYSDRL+IAV
Sbjct: 181 GRPIEAHRIILSARSPFFKRKFESDWKDRTEVRFSREKLSYPALYSLIHFFYSDRLDIAV 240
Query: 239 DDMEDLVKICKVCKCESLQRIIEKELIHQKYAEYKALRDVDNSQKRFILQGSALPEEDRL 298
DDMEDLV+ICKVCKC++LQR++EKELIHQKYAEYKALRDVDNSQKRFILQG +LPEEDRL
Sbjct: 241 DDMEDLVRICKVCKCDALQRVLEKELIHQKYAEYKALRDVDNSQKRFILQGLSLPEEDRL 300
Query: 299 PAALSRILQISLARSNMDHNIDNGICKLSSSVEAMHISDHVDDLADVCVRVDKKIFRCHQ 358
PAAL RILQISLA+SN +HN++NG+ KL S V AM + DDLADVC++VDKK+FRCHQ
Sbjct: 301 PAALHRILQISLAKSNQEHNLENGVSKLVSCVGAMKMGGS-DDLADVCIKVDKKVFRCHQ 359
Query: 359 VVLASRSEYFKARLSRMKDFYEGKEGLPGDILPCIEEHDLSKETFEKMIEYMYTDGLKDI 418
VVLA+RSEYFKARLSRMKDF EG GLP LPC+EEHDLS E FEKMIEYMYTDGLKD+
Sbjct: 360 VVLAARSEYFKARLSRMKDFLEGINGLPNYTLPCLEEHDLSMEAFEKMIEYMYTDGLKDM 419
Query: 419 DPDQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYLLFPLKRAVADVLLLHLEMV 478
DPD QAEE+FDAASRYLLFPLKRAVAD L+ HLE V
Sbjct: 420 DPD-------------------------QAEELFDAASRYLLFPLKRAVADALMPHLETV 454
Query: 479 SPAELCHWLILSDMYAAI 496
PAELCHWLILSDMY +
Sbjct: 455 PPAELCHWLILSDMYGVL 472
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255583036|ref|XP_002532286.1| protein binding protein, putative [Ricinus communis] gi|223528020|gb|EEF30101.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224131766|ref|XP_002321173.1| predicted protein [Populus trichocarpa] gi|222861946|gb|EEE99488.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449441674|ref|XP_004138607.1| PREDICTED: BTB/POZ domain-containing protein At2g04740-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|42568941|ref|NP_178551.2| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|334351259|sp|Q9SJ85.2|Y2474_ARATH RecName: Full=BTB/POZ domain-containing protein At2g04740 gi|330250765|gb|AEC05859.1| ankyrin repeat-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297831554|ref|XP_002883659.1| ankyrin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297329499|gb|EFH59918.1| ankyrin repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356577448|ref|XP_003556837.1| PREDICTED: BTB/POZ domain-containing protein At2g04740-like, partial [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|413944399|gb|AFW77048.1| hypothetical protein ZEAMMB73_515710 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|357118056|ref|XP_003560775.1| PREDICTED: BTB/POZ domain-containing protein At2g04740-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|297739140|emb|CBI28791.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | ||||||
| TAIR|locus:2049168 | 578 | AT2G04740 [Arabidopsis thalian | 0.721 | 0.704 | 0.727 | 2.3e-183 | |
| UNIPROTKB|E2QTQ1 | 478 | ABTB1 "Uncharacterized protein | 0.148 | 0.175 | 0.517 | 1.6e-36 | |
| UNIPROTKB|Q969K4 | 478 | ABTB1 "Ankyrin repeat and BTB/ | 0.148 | 0.175 | 0.517 | 2.5e-36 | |
| UNIPROTKB|F1N9Z2 | 477 | ABTB1 "Uncharacterized protein | 0.148 | 0.176 | 0.541 | 1.2e-34 | |
| UNIPROTKB|A4FV83 | 470 | ABTB1 "ABTB1 protein" [Bos tau | 0.147 | 0.176 | 0.511 | 2.9e-34 | |
| MGI|MGI:1933148 | 478 | Abtb1 "ankyrin repeat and BTB | 0.148 | 0.175 | 0.529 | 5.9e-34 | |
| RGD|1359363 | 478 | Abtb1 "ankyrin repeat and BTB | 0.148 | 0.175 | 0.529 | 7.5e-34 | |
| UNIPROTKB|I3LER2 | 478 | ABTB1 "Uncharacterized protein | 0.148 | 0.175 | 0.505 | 6.3e-33 | |
| UNIPROTKB|G4NKT9 | 644 | MGG_03027 "BTB/POZ domain-cont | 0.164 | 0.144 | 0.436 | 4.6e-14 | |
| UNIPROTKB|Q2KF72 | 794 | MGCH7_ch7g814 "Putative unchar | 0.164 | 0.117 | 0.436 | 8.9e-14 |
| TAIR|locus:2049168 AT2G04740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1601 (568.6 bits), Expect = 2.3e-183, Sum P(2) = 2.3e-183
Identities = 302/415 (72%), Positives = 358/415 (86%)
Query: 8 TIDAELDEIDLDASDFSSSVPLKKVPNGDVFEASRAGDVDRLRYILESGVNVNARDQWDS 67
T++++L+++DLD D+ SVPLKKVPNGD+FEASRAGDVDRLRY++E+GVNVNARD+WDS
Sbjct: 11 TLESDLEDLDLDLQDYKPSVPLKKVPNGDIFEASRAGDVDRLRYLVETGVNVNARDRWDS 70
Query: 68 VALYYACLAGHLDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAYEARPPPLGP 127
VALYYACLAGH+D+AR+LLE+GAICSEHTFDGDRCHYA+LNL++RKLLKA+EARPPPL P
Sbjct: 71 VALYYACLAGHIDSARLLLENGAICSEHTFDGDRCHYASLNLRIRKLLKAFEARPPPLAP 130
Query: 128 LQAALRDTFLGCGANRQFLEEAEVVLGISGVTSNGASNSDSFPPDVVFYVQGRPIEAHRV 187
LQA+LRDTFLGC NR +L++ E L +S S S S+ FPPDV+FYVQGRPIEAHRV
Sbjct: 131 LQASLRDTFLGCCHNRDYLQQEEANLDVSDTLSEFGS-SNYFPPDVMFYVQGRPIEAHRV 189
Query: 188 ILSARSVFFRRKFETDWRYRNEIRFSREKLSYPALYGLIHFFYSDRLEIAVDDMEDLVKI 247
ILSARS FF++KFE +W+ R E+RFS+EKLSYPAL LIHFFYSDRLEI+VDDMEDLV+I
Sbjct: 190 ILSARSPFFKQKFENEWKDRREVRFSKEKLSYPALCSLIHFFYSDRLEISVDDMEDLVRI 249
Query: 248 CKVCKCESLQRIIEKELIHQKYAEYKALRDVDNSQKRFILQGSALPEEDRLPAALSRILQ 307
CKVCKCESLQ+IIEKELIHQ+YAEYK RD+DNS KRFILQG +LPEEDRLPA+L RIL+
Sbjct: 250 CKVCKCESLQKIIEKELIHQRYAEYKTHRDLDNSMKRFILQGISLPEEDRLPASLHRILR 309
Query: 308 ISLARSNMDHNIDNGICKLSSSVEAMHISDHVDDLADVCVRVDKKIFRCHQVVLASRSEY 367
+SLA+S + ID SSV + D V+ LADVCVRVDK+ F CHQV+LASRSEY
Sbjct: 310 VSLAKSFVGDVID-------SSVGDTRVGDSVESLADVCVRVDKRNFYCHQVILASRSEY 362
Query: 368 FKARLSRMKDFYEGKEGLPGDILPCIEEHDLSKETFEKMIEYMYTDGLKDIDPDQ 422
F+ARLSR+ DF+EGK GLPGD LP +EEHDLS E FEKMIEYMYTDGLK+I+P+Q
Sbjct: 363 FRARLSRVNDFHEGKNGLPGDTLPFLEEHDLSAEAFEKMIEYMYTDGLKEINPNQ 417
|
|
| UNIPROTKB|E2QTQ1 ABTB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q969K4 ABTB1 "Ankyrin repeat and BTB/POZ domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9Z2 ABTB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4FV83 ABTB1 "ABTB1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1933148 Abtb1 "ankyrin repeat and BTB (POZ) domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359363 Abtb1 "ankyrin repeat and BTB (POZ) domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LER2 ABTB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NKT9 MGG_03027 "BTB/POZ domain-containing protein 3" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KF72 MGCH7_ch7g814 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9SJ85 | Y2474_ARATH | No assigned EC number | 0.7025 | 0.7819 | 0.7629 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 564 | |||
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 2e-12 | |
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 4e-12 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 6e-11 | |
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 2e-09 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 3e-09 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 6e-09 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 1e-07 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-07 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-06 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 1e-05 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 1e-04 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-04 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 0.002 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 0.002 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.002 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 0.003 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 0.004 |
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
Score = 63.5 bits (155), Expect = 2e-12
Identities = 22/96 (22%), Positives = 52/96 (54%)
Query: 172 DVVFYVQGRPIEAHRVILSARSVFFRRKFETDWRYRNEIRFSREKLSYPALYGLIHFFYS 231
DV V G+ AH+ +L+A S +F+ F +D++ ++ + +S L++F Y+
Sbjct: 1 DVTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYLDDVSPEDFRALLNFLYT 60
Query: 232 DRLEIAVDDMEDLVKICKVCKCESLQRIIEKELIHQ 267
+L++ +++E+L+++ + L + E+ L+
Sbjct: 61 GKLDLPEENVEELLELADYLQIPGLVELCEEFLLKL 96
|
Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 99.97 | |
| KOG4350 | 620 | consensus Uncharacterized conserved protein, conta | 99.88 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 99.88 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.87 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.87 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 99.87 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.84 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.82 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 99.79 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.79 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 99.78 | |
| KOG2838 | 401 | consensus Uncharacterized conserved protein, conta | 99.75 | |
| KOG4591 | 280 | consensus Uncharacterized conserved protein, conta | 99.73 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.73 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.71 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.7 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.68 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.66 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.65 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.64 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.64 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.64 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.64 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.63 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.63 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.62 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.62 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.62 | |
| KOG4350 | 620 | consensus Uncharacterized conserved protein, conta | 99.62 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.61 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.6 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.59 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.59 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.59 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 99.59 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.58 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.57 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.57 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.57 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.57 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.56 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.56 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.56 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.55 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.55 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.53 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.53 | |
| KOG2075 | 521 | consensus Topoisomerase TOP1-interacting protein B | 99.53 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.53 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.53 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.53 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.52 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.51 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.49 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.49 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.48 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.48 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.48 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.47 | |
| KOG4591 | 280 | consensus Uncharacterized conserved protein, conta | 99.45 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.44 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.44 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.44 | |
| KOG4682 | 488 | consensus Uncharacterized conserved protein, conta | 99.43 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.43 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.41 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.4 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.4 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.39 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.39 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.38 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.37 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.37 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.37 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.37 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.36 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 99.36 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.32 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.32 | |
| KOG2075 | 521 | consensus Topoisomerase TOP1-interacting protein B | 99.31 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.31 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.29 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.27 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.26 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.23 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.19 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.19 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.16 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.16 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.16 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.15 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.13 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.13 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.1 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.09 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 99.09 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.08 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.06 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.06 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.0 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.97 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.95 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.9 | |
| KOG4682 | 488 | consensus Uncharacterized conserved protein, conta | 98.88 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.88 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.85 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.84 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 98.77 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.7 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.66 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.64 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.56 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 98.53 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.38 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.32 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.27 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.19 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.17 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.1 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.09 | |
| KOG2716 | 230 | consensus Polymerase delta-interacting protein PDI | 98.08 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.04 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 97.91 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.9 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 97.87 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 97.71 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 97.7 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.63 | |
| KOG2838 | 401 | consensus Uncharacterized conserved protein, conta | 97.59 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.58 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.25 | |
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 97.15 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 97.05 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 96.95 | |
| KOG3473 | 112 | consensus RNA polymerase II transcription elongati | 96.81 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 96.79 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 96.59 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.5 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.47 | |
| PF11822 | 317 | DUF3342: Domain of unknown function (DUF3342); Int | 96.45 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 96.2 | |
| smart00512 | 104 | Skp1 Found in Skp1 protein family. Family of Skp1 | 96.03 | |
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 95.68 | |
| KOG1724 | 162 | consensus SCF ubiquitin ligase, Skp1 component [Po | 95.65 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 94.97 | |
| KOG2714 | 465 | consensus SETA binding protein SB1 and related pro | 94.94 | |
| KOG2716 | 230 | consensus Polymerase delta-interacting protein PDI | 94.73 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 94.72 | |
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 94.71 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 94.69 | |
| COG5201 | 158 | SKP1 SCF ubiquitin ligase, SKP1 component [Posttra | 94.65 | |
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 94.44 | |
| KOG3473 | 112 | consensus RNA polymerase II transcription elongati | 92.66 | |
| PF01466 | 78 | Skp1: Skp1 family, dimerisation domain; InterPro: | 92.16 | |
| KOG2714 | 465 | consensus SETA binding protein SB1 and related pro | 91.05 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 90.87 | |
| smart00512 | 104 | Skp1 Found in Skp1 protein family. Family of Skp1 | 90.01 | |
| PF07707 | 103 | BACK: BTB And C-terminal Kelch; InterPro: IPR01170 | 88.3 | |
| PF11822 | 317 | DUF3342: Domain of unknown function (DUF3342); Int | 87.54 | |
| KOG2715 | 210 | consensus Uncharacterized conserved protein, conta | 87.43 | |
| KOG1665 | 302 | consensus AFH1-interacting protein FIP2, contains | 85.52 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 85.48 |
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-36 Score=308.20 Aligned_cols=318 Identities=20% Similarity=0.260 Sum_probs=216.4
Q ss_pred CCCCCeEEEecCeeechhhHhhcccChhHHHhccccccc------------cccceEEcCCCCHHHHHHHhhhHccCCc-
Q 008477 168 SFPPDVVFYVQGRPIEAHRVILSARSVFFRRKFETDWRY------------RNEIRFSREKLSYPALYGLIHFFYSDRL- 234 (564)
Q Consensus 168 ~~~~Dv~~~v~~~~~~~Hk~iL~a~S~~f~~l~~~~~~e------------~~~~~i~l~~v~~~~~~~lL~ylYtg~~- 234 (564)
..++||+|.||+..|++||.||++||++|+++|....+. .....+.++++++..|+.+|+||||+..
T Consensus 556 ds~hDVtf~vg~~~F~aHKfIl~~rs~flrkL~l~~~~~s~~~dIY~~~~~~~~~~~~ve~i~p~mfe~lL~~iYtdt~~ 635 (1267)
T KOG0783|consen 556 DSFHDVTFYVGTSMFHAHKFILCARSSFLRKLLLQKKKSSVSNDIYIEEITQSHSTIRVEDIPPLMFEILLHYIYTDTLL 635 (1267)
T ss_pred cccceEEEEecCeecccceEEEEeccHHHHHHHHhhccccccceeeeecccccCceeeeccCCHHHHHHHHHHHhccccc
Confidence 568999999999999999999999999999999743322 1233455889999999999999999964
Q ss_pred -cCCcccHHHHHHHHhHhcHHHHHHHHHHHHHHHHHHHHcCcHHHHHHHHHHHhhcCCCCCCCccchhHHHHHHHHhhhc
Q 008477 235 -EIAVDDMEDLVKICKVCKCESLQRIIEKELIHQKYAEYKALRDVDNSQKRFILQGSALPEEDRLPAALSRILQISLARS 313 (564)
Q Consensus 235 -~i~~~~~~~ll~~a~~c~~~~L~~~l~~~l~~~~~a~~~~~~~L~~~~~~~i~~~~~v~~~~~l~~~l~~~~~~~~~~~ 313 (564)
+...++++..-. . .. -.-+.+.-..|-.+...++.++..+|......+.- +.++ ..+.....
T Consensus 636 ~P~heDdidci~f-s-~~-k~N~~qrtrtCeMl~~~lekf~l~el~~~~~s~~~------~~~~-~n~ia~~~------- 698 (1267)
T KOG0783|consen 636 SPWHEDDIDCIRF-S-PL-KENLSQRTRTCEMLANLLEKFHLAELLPFSVSRQP------LLSL-TNDIAQLY------- 698 (1267)
T ss_pred CCccccchhhhhc-c-cc-ccChhhcccHHHHHHHHHhhhhHHhhhhhhhhccc------hhhc-ccHHHHHh-------
Confidence 323343321100 0 00 11111112234445555566665555544333321 1111 11111111
Q ss_pred cCCCCcccccccccchhhhhcccccCCCCccEEEEe-CCeEEecchhhhhcccHHHHHHhcCCccccccCCCCCCCCCCc
Q 008477 314 NMDHNIDNGICKLSSSVEAMHISDHVDDLADVCVRV-DKKIFRCHQVVLASRSEYFKARLSRMKDFYEGKEGLPGDILPC 392 (564)
Q Consensus 314 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~Dv~~~~-~~~~~~~Hk~iL~arS~~F~~~~~~~~~~~e~~~~~~~~~~~~ 392 (564)
.+...+...+..-|+++.+ ||+.++||||+|+||++||..||.. .|.|+.. -.
T Consensus 699 -----------------~N~l~lsdh~e~~d~~i~~KDGkvl~aHkc~L~aRlEYF~smf~~--~w~E~sS-------~t 752 (1267)
T KOG0783|consen 699 -----------------NNFLVLSDHEETMDTVIKLKDGKVLKAHKCFLSARLEYFSSMFQF--VWMESSS-------IT 752 (1267)
T ss_pred -----------------cCeeEecCCccceeEEEEecCCcCcccceeEeeeHHHHHHHHHHH--HHhhhcc-------ce
Confidence 1112223335667888877 7778999999999999999999998 8988743 35
Q ss_pred EEcCCCCHHHHHHHhHhhcc-CCCCCCCCcccccCccchhhhcCCCCCCCCCchHHHHHHHHHhcccChhhHHHHHHHHH
Q 008477 393 IEEHDLSKETFEKMIEYMYT-DGLKDIDPDQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYLLFPLKRAVADVL 471 (564)
Q Consensus 393 i~l~~v~~~~~~~~l~~iYt-~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~A~~~~l~~L~~~c~~~l 471 (564)
+....+..+.|..+|+|+|+ ++. .+..+ .-..+++++++.+||+|.+.+||.+||..|
T Consensus 753 ~~~~p~~~e~m~ivLdylYs~d~~-~~~k~--------------------~~~~dF~~~il~iaDqlli~~Lk~Ice~~l 811 (1267)
T KOG0783|consen 753 VNLSPLTVEHMSIVLDYLYSDDKV-ELFKD--------------------LKESDFMFEILSIADQLLILELKSICEQSL 811 (1267)
T ss_pred eecCcchHHHHHHHHHHHHccchH-HHHhc--------------------cchhhhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence 55556679999999999995 444 44433 112448999999999999999999999999
Q ss_pred HhhccccChHHHHHHHHHHHhhcch----hhcchh--hHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC
Q 008477 472 LLHLEMVSPAELCHWLILSDMYAAI----VCSSLS--ILLVFLFSIFYGVLKQICLTLGKLLINLWVVDHIFLRLLSPTS 545 (564)
Q Consensus 472 ~~~l~~~~~~n~~~~l~~A~~~~~~----~c~~l~--~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 545 (564)
.+.| +..||..++++|.+|+|+ .|.+|+ |+..+++.+-.+.+..-...-+.+.+++++. ......
T Consensus 812 l~kl---~lk~~~~llefaamY~ak~L~~~C~dfic~N~~~~Learsi~~~dg~~LK~l~~~yrkm~~------vfD~Rv 882 (1267)
T KOG0783|consen 812 LRKL---NLKTLPTLLEFAAMYHAKELYSRCIDFICHNIEFFLEARSISEWDGFHLKKLAQRYRKMLS------VFDQRV 882 (1267)
T ss_pred HhHh---cccchHHHHHHHHHhhHHHHHHHHHHHHHHhHHHHHHhccHhhhcchHHHHHHHHHHHHhh------hcccee
Confidence 9888 999999999999999988 888887 8888888777666553333344444554443 223556
Q ss_pred CCCC--cccchhhhh
Q 008477 546 QNPS--SKFKHRYAI 558 (564)
Q Consensus 546 ~~~~--~~~~~~~~~ 558 (564)
..|+ ++..+|+.|
T Consensus 883 itP~ea~~d~~~L~i 897 (1267)
T KOG0783|consen 883 ITPSEASKDANRLLI 897 (1267)
T ss_pred ecccccccccceEEe
Confidence 6777 555566554
|
|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00512 Skp1 Found in Skp1 protein family | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] | Back alignment and domain information |
|---|
| >PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00512 Skp1 Found in Skp1 protein family | Back alignment and domain information |
|---|
| >PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) | Back alignment and domain information |
|---|
| >PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 564 | ||||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 3e-06 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 3e-06 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 3e-06 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-06 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 6e-06 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 8e-06 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 1e-05 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 1e-05 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 1e-05 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-05 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-05 | ||
| 3hqi_A | 312 | Structures Of Spop-Substrate Complexes: Insights In | 2e-05 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 2e-05 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 3e-05 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-05 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-05 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-05 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 8e-05 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 9e-05 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 1e-04 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-04 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 1e-04 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 1e-04 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-04 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 2e-04 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-04 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-04 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 2e-04 | ||
| 4eoz_A | 145 | Crystal Structure Of The Spop Btb Domain Complexed | 3e-04 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 3e-04 | ||
| 2nn2_A | 133 | Crystal Structure Of The Btb Domain From The LrfZBT | 3e-04 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 3e-04 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 3e-04 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 3e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 3e-04 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 4e-04 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 4e-04 | ||
| 2if5_A | 120 | Structure Of The Poz Domain Of Human Lrf, A Master | 5e-04 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 7e-04 |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
|
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
Score = 78.0 bits (193), Expect = 3e-17
Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 43/162 (26%)
Query: 341 DLADVCVRVDKKIFRCHQVVLASRSEYFKARL-SRMKDFYEGKEGLPGDILPCIEEHDLS 399
D C+ V + F+ H+ +LA+RS F A M+ E K+ +E +D+
Sbjct: 24 RFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEME---ESKKN-------RVEINDVE 73
Query: 400 KETFEKMIEYMYTDGLKDIDPDQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYL 459
E F++M+ ++YT ++ D+ A+++ AA +Y
Sbjct: 74 PEVFKEMMCFIYTGKAPNL--------------------------DKMADDLLAAADKYA 107
Query: 460 LFPLKRAVADVLLLHLEMVSPAELCHWLILSDMYAAIVCSSL 501
L LK D L +L + + AE+ LIL+D+++ L
Sbjct: 108 LERLKVMCEDALCSNLSVENAAEI---LILADLHS---ADQL 143
|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.92 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.92 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.9 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.89 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.89 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.87 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.87 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.86 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.86 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.86 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.86 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.86 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.86 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.85 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.85 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.84 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.82 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.82 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.82 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.81 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.8 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.79 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.79 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.79 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.78 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.78 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.78 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.77 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.77 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.77 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.77 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.77 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.77 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.77 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.76 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.76 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.75 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.74 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.74 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.74 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.73 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.73 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.72 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.72 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.72 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.71 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.71 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.71 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.71 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.71 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.71 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.71 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.71 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.71 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.71 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.7 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.7 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.7 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.7 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.7 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.7 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.7 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.69 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.69 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.69 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.69 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.69 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.69 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.69 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.69 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.69 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.69 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.69 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.69 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.68 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.68 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.68 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.68 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.68 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.68 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.68 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.67 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.67 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.67 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.67 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.67 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.67 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.66 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.66 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.66 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.66 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.66 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.66 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.66 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.65 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.65 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.65 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.65 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.65 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.65 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.65 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.65 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.65 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.64 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.64 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.64 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.64 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.64 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.64 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.63 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.63 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.63 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.63 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.63 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.63 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.63 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.63 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.62 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.62 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.62 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.62 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.62 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.62 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.61 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.61 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.6 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.6 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.6 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.59 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.59 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.58 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.58 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.58 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.58 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.57 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.57 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.57 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.57 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.55 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.55 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.54 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.54 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.54 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.53 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.52 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.51 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.5 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.5 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.49 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.46 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.37 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 99.33 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.27 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.23 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.17 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 99.05 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 98.98 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 98.85 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 98.83 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 98.69 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 98.33 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 98.25 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 98.17 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 98.17 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 97.97 | |
| 1vcb_B | 112 | Protein (elongin C); tumor suppressor, cancer, ubi | 97.71 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 97.6 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 97.54 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 97.52 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 97.12 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 97.0 | |
| 1vcb_B | 112 | Protein (elongin C); tumor suppressor, cancer, ubi | 96.64 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 96.31 | |
| 2eqx_A | 105 | Kelch repeat and BTB domain-containing protein 4; | 94.61 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 94.48 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 94.33 | |
| 2eqx_A | 105 | Kelch repeat and BTB domain-containing protein 4; | 93.76 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 93.39 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 93.35 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 92.23 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 90.0 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 87.96 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 82.88 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 81.55 |
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
Probab=99.92 E-value=4.4e-25 Score=216.26 Aligned_cols=188 Identities=15% Similarity=0.175 Sum_probs=143.6
Q ss_pred chhhhhcccccCCCCccEEEEeCCeEEecchhhhhcccHHHHHHhcCCccccccCCCCCCCCCCcEEcCCCCHHHHHHHh
Q 008477 328 SSVEAMHISDHVDDLADVCVRVDKKIFRCHQVVLASRSEYFKARLSRMKDFYEGKEGLPGDILPCIEEHDLSKETFEKMI 407 (564)
Q Consensus 328 ~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~Hk~iL~arS~~F~~~~~~~~~~~e~~~~~~~~~~~~i~l~~v~~~~~~~~l 407 (564)
..++.+..++.++.+|||+|.++|+.|+|||+||+++|+||++||.+ +|.++ ++....|.++++++++|+.++
T Consensus 17 ~l~~~l~~l~~~~~~~Dv~l~v~~~~f~~Hr~vLaa~S~yF~~mf~~--~~~~~-----e~~~~~i~l~~v~~~~f~~ll 89 (256)
T 3hve_A 17 RLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLNY--NPPKD-----DGSTYKIELEGISVMVMREIL 89 (256)
T ss_dssp HHHHHHHTCCC--CCCCEEEEETTEEEEECHHHHHTTCHHHHHTC------------------CEEECSSCCHHHHHHHH
T ss_pred HHHHHHHHHHhcCCCcceEEEECCEEEechHHHHHHcCHHHHHHhCC--CCCcc-----cCCCCeEEeCCCCHHHHHHHH
Confidence 34667788899999999999999999999999999999999999997 55421 234479999999999999999
Q ss_pred HhhccCCCCCCCCcccccCccchhhhcCCCCCCCCCchHHHHHHHHHhcccChhhHHHHHHHHHHhhccccChHHHHHHH
Q 008477 408 EYMYTDGLKDIDPDQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYLLFPLKRAVADVLLLHLEMVSPAELCHWL 487 (564)
Q Consensus 408 ~~iYt~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~A~~~~l~~L~~~c~~~l~~~l~~~~~~n~~~~l 487 (564)
+|+|||.+ .++.+ ++.+++.+|++|+++.|+..|+++|.+.+ +++||+.++
T Consensus 90 ~~~Yt~~~-~i~~~-------------------------~v~~ll~~A~~l~i~~l~~~c~~~L~~~l---~~~n~~~i~ 140 (256)
T 3hve_A 90 DYIFSGQI-RLNED-------------------------TIQDVVQAADLLLLTDLKTLCCEFLEGCI---AAENCIGIR 140 (256)
T ss_dssp HHHHHSCC-CCC-C-------------------------CHHHHHHHHHHHTCHHHHHHHHHHHHHTC---CSSTTHHHH
T ss_pred hhccCCCC-cccHh-------------------------HHHHHHHHHHHHChHHHHHHHHHHHHhhC---CHhhHHHHH
Confidence 99999999 78888 89999999999999999999999999998 999999999
Q ss_pred HHHHhhcchhhcchh-hHHHHHHHhhHHHHHHH-H----HHHHHHHHH-----HHHHHHHHHHhcCCCCCCCCcccch
Q 008477 488 ILSDMYAAIVCSSLS-ILLVFLFSIFYGVLKQI-C----LTLGKLLIN-----LWVVDHIFLRLLSPTSQNPSSKFKH 554 (564)
Q Consensus 488 ~~A~~~~~~~c~~l~-~~~~~~~~~~~~~l~~~-~----~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~ 554 (564)
.+|+.|+ |..+. .+..++..++.+..... . ...+.++++ ..-+..+|..+..|-.++|..|.++
T Consensus 141 ~~A~~~~---~~~L~~~~~~~i~~~f~~v~~~~~f~~L~~~~l~~lL~~d~L~v~~E~~v~~av~~W~~~~~~~R~~~ 215 (256)
T 3hve_A 141 DFALHYC---LHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKVH 215 (256)
T ss_dssp HHHHHTT---CHHHHHHHHHHHHHHHHHHTTCHHHHSSCHHHHHHHHHCC-------CTTHHHHTTTCCC--CCSTTT
T ss_pred HHHHHcC---cHHHHHHHHHHHHHHHHHHhCCcchhcCCHHHHHHHHccCCCCCCCHHHHHHHHHHHHHcCHHHHHHH
Confidence 9999999 77776 66667777766554311 1 223333332 2235578889999999999877654
|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 564 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-04 | |
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 7e-10 | |
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 1e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-07 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 1e-05 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-07 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.001 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.003 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-07 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-04 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-04 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 5e-07 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 7e-07 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-05 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.003 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 5e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-04 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 6e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 8e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.002 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.001 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.002 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.002 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.004 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.003 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 63.8 bits (154), Expect = 2e-11
Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 3/86 (3%)
Query: 40 ASRAGDVDRLRYILESGVNVNARDQWDSVALYYACLAGHLDAARMLLESGAICSEHTFDG 99
AS G + ++ +L+ G + N + L+ A AGH + A+ LL++ A + D
Sbjct: 7 ASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD 66
Query: 100 DRC-HYAAL--NLKVRKLLKAYEARP 122
H AA + + KLL A P
Sbjct: 67 QTPLHCAARIGHTNMVKLLLENNANP 92
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.86 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.86 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.77 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.71 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.7 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.7 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.65 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.65 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.64 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.64 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.62 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.61 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.6 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.6 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.59 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.57 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.57 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.56 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.56 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.55 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.53 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.52 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.51 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.45 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.45 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.42 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.42 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.39 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.38 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.38 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.35 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.35 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.34 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.33 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.32 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.05 | |
| d2c9wc1 | 96 | Elongin C {Human (Homo sapiens) [TaxId: 9606]} | 97.69 | |
| d1hv2a_ | 99 | Elongin C {Baker's yeast (Saccharomyces cerevisiae | 97.21 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 96.41 | |
| d2c9wc1 | 96 | Elongin C {Human (Homo sapiens) [TaxId: 9606]} | 96.34 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 95.96 | |
| d1hv2a_ | 99 | Elongin C {Baker's yeast (Saccharomyces cerevisiae | 95.65 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 95.45 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 94.31 | |
| d1fs1b1 | 55 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 93.18 | |
| d1fs1b2 | 61 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 93.01 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 92.56 | |
| d1fs1b2 | 61 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 92.11 | |
| d1nexa2 | 72 | Centromere DNA-binding protein complex Cbf3 subuni | 91.85 | |
| d1nexa2 | 72 | Centromere DNA-binding protein complex Cbf3 subuni | 91.3 | |
| d1nexa1 | 70 | Centromere DNA-binding protein complex Cbf3 subuni | 91.29 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 87.97 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=2.8e-22 Score=170.60 Aligned_cols=110 Identities=17% Similarity=0.262 Sum_probs=98.4
Q ss_pred hhhhhcccccCCCCccEEEEeCCeEEecchhhhhcccHHHHHHhcCCccccccCCCCCCCCCCcEEcCCCCHHHHHHHhH
Q 008477 329 SVEAMHISDHVDDLADVCVRVDKKIFRCHQVVLASRSEYFKARLSRMKDFYEGKEGLPGDILPCIEEHDLSKETFEKMIE 408 (564)
Q Consensus 329 ~~~~~~~~~~~~~~~Dv~~~~~~~~~~~Hk~iL~arS~~F~~~~~~~~~~~e~~~~~~~~~~~~i~l~~v~~~~~~~~l~ 408 (564)
.+..++.++.++.+|||++.++|++|+|||+||+++|+||++||.+ +|.|+. ...+.++++++++|+.+|+
T Consensus 12 ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~--~~~e~~-------~~~~~~~~v~~~~f~~ll~ 82 (122)
T d1r29a_ 12 VLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTD--QLKRNL-------SVINLDPEINPEGFNILLD 82 (122)
T ss_dssp HHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTS--TTTTTC-------SEEECCTTSCHHHHHHHHH
T ss_pred HHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhcc--chhhhc-------ceeeeecccCHHHHHHHHh
Confidence 4566777888999999999999999999999999999999999987 565543 3566678999999999999
Q ss_pred hhccCCCCCCCCcccccCccchhhhcCCCCCCCCCchHHHHHHHHHhcccChhhHHHHHHHHHHh
Q 008477 409 YMYTDGLKDIDPDQVCCNSVTWLVALGSNLPNFVPFDEQAEEMFDAASRYLLFPLKRAVADVLLL 473 (564)
Q Consensus 409 ~iYt~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~A~~~~l~~L~~~c~~~l~~ 473 (564)
|+|||++ .++.+ ++.+++.+|++|+++.|++.|+++|..
T Consensus 83 ~~Ytg~~-~i~~~-------------------------~v~~ll~~A~~l~i~~L~~~C~~~L~~ 121 (122)
T d1r29a_ 83 FMYTSRL-NLREG-------------------------NIMAVMATAMYLQMEHVVDTCRKFIKA 121 (122)
T ss_dssp HHHHSCC-CCCTT-------------------------THHHHHHHHHHTTCHHHHHHHHHHHHT
T ss_pred hhcCCee-cCchh-------------------------hHHHHHHHHHHHCcHHHHHHHHHHHHh
Confidence 9999999 78888 999999999999999999999999864
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|