Citrus Sinensis ID: 008479
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | 2.2.26 [Sep-21-2011] | |||||||
| P44659 | 215 | Uncharacterized protein H | yes | no | 0.322 | 0.846 | 0.265 | 1e-13 | |
| Q8FTH8 | 739 | Thiamine biosynthesis mul | yes | no | 0.319 | 0.243 | 0.267 | 5e-11 | |
| O94266 | 551 | Putative hydroxymethylpyr | yes | no | 0.329 | 0.337 | 0.236 | 4e-09 | |
| Q9UUE0 | 274 | UPF0655 protein C17G9.12c | no | no | 0.464 | 0.956 | 0.233 | 5e-09 | |
| Q8NQH1 | 763 | Thiamine biosynthesis mul | yes | no | 0.365 | 0.269 | 0.262 | 2e-08 | |
| P25616 | 317 | UPF0655 protein YCR015C O | yes | no | 0.375 | 0.668 | 0.265 | 4e-06 | |
| Q49Z42 | 229 | Putative thiaminase-2 OS= | yes | no | 0.331 | 0.816 | 0.233 | 2e-05 | |
| Q2YUL0 | 229 | Putative thiaminase-2 OS= | yes | no | 0.319 | 0.786 | 0.248 | 2e-05 | |
| Q6GEY1 | 229 | Putative thiaminase-2 OS= | yes | no | 0.326 | 0.803 | 0.241 | 2e-05 | |
| Q7A0C8 | 229 | Putative thiaminase-2 OS= | yes | no | 0.326 | 0.803 | 0.241 | 4e-05 |
| >sp|P44659|Y358_HAEIN Uncharacterized protein HI_0358 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0358 PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 79.0 bits (193), Expect = 1e-13, Method: Compositional matrix adjust.
Identities = 56/211 (26%), Positives = 101/211 (47%), Gaps = 29/211 (13%)
Query: 36 FTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVLEEL 95
F LA G L F+HY+ QD+ +L +S+A+ L A + + + + + +E+
Sbjct: 21 FVQQLAKGTLPKACFQHYLKQDYLYLFHYSRAFALGVFKAKNFAEMETPRKTLEILCQEI 80
Query: 96 KMHDSFVKEWGTDLAKMATV--NSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVA 153
++H ++ +EWG ++ T ++A + YT +LL G LA +
Sbjct: 81 QLHLNYCREWGISEQEIFTTQESAACIAYTRYLLDCGMT--------GSLAELY------ 126
Query: 154 AYTLGAMSPCMRLYA----FLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDL 209
A++PC YA ++ + + L N+PY WID Y+SE FQ +A + D
Sbjct: 127 ----AAVTPCALGYAQVARYITQHYPRL-----PNNPYQTWIDTYASEEFQQAAQETVDF 177
Query: 210 LDKLSVSLTGEELDIIEKLYHQAMKLEVEFF 240
L L L +L I++++ A ++E+ F+
Sbjct: 178 LTALCKPLNPSQLAEIQQIFTTATRMEIAFW 208
|
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (taxid: 71421) |
| >sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O94266|THI22_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.18c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UUE0|YNZC_SCHPO UPF0655 protein C17G9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.12c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8NQH1|THIED_CORGL Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=theD PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P25616|YCQ5_YEAST UPF0655 protein YCR015C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR015C PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q49Z42|TENA_STAS1 Putative thiaminase-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tenA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q2YUL0|TENA_STAAB Putative thiaminase-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tenA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6GEY1|TENA_STAAR Putative thiaminase-2 OS=Staphylococcus aureus (strain MRSA252) GN=tenA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7A0C8|TENA_STAAW Putative thiaminase-2 OS=Staphylococcus aureus (strain MW2) GN=tenA PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | ||||||
| 225466287 | 566 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.996 | 0.793 | 0.0 | |
| 296088278 | 657 | unnamed protein product [Vitis vinifera] | 1.0 | 0.858 | 0.793 | 0.0 | |
| 118486577 | 618 | unknown [Populus trichocarpa] | 0.992 | 0.906 | 0.767 | 0.0 | |
| 356576723 | 607 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.907 | 0.782 | 0.0 | |
| 356535194 | 604 | PREDICTED: uncharacterized protein LOC10 | 0.998 | 0.932 | 0.767 | 0.0 | |
| 224125750 | 577 | predicted protein [Populus trichocarpa] | 0.975 | 0.953 | 0.782 | 0.0 | |
| 224145849 | 541 | predicted protein [Populus trichocarpa] | 0.929 | 0.968 | 0.759 | 0.0 | |
| 297805028 | 617 | hypothetical protein ARALYDRAFT_915614 [ | 0.984 | 0.899 | 0.709 | 0.0 | |
| 145358529 | 617 | heme oxygenase-like, multi-helical prote | 0.978 | 0.894 | 0.712 | 0.0 | |
| 110737432 | 629 | hypothetical protein [Arabidopsis thalia | 0.978 | 0.877 | 0.712 | 0.0 |
| >gi|225466287|ref|XP_002270291.1| PREDICTED: uncharacterized protein LOC100266835 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 947 bits (2447), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 449/566 (79%), Positives = 506/566 (89%), Gaps = 2/566 (0%)
Query: 1 MAAIPPKSPSP--EEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDF 58
MAAIP S + EEG+ARR WIKF++ES+FAMY+PF VCLASGNLKL++FRH+IAQD
Sbjct: 1 MAAIPKPSITTVDNEEGIARRFWIKFRKESIFAMYTPFVVCLASGNLKLDSFRHFIAQDV 60
Query: 59 HFLKAFSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSA 118
HFL+AF+QAYELAEECADDDDAKL I +LRK VLEELKMHDSFVKEWG DL+K +++NSA
Sbjct: 61 HFLRAFAQAYELAEECADDDDAKLGICQLRKSVLEELKMHDSFVKEWGFDLSKESSLNSA 120
Query: 119 TVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALL 178
TVKY +FLLATASGK+EGVKGPGKLATPFEKTKVAAYTLGAM+PCMRLYAFLGKE ALL
Sbjct: 121 TVKYRDFLLATASGKIEGVKGPGKLATPFEKTKVAAYTLGAMTPCMRLYAFLGKELQALL 180
Query: 179 NANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVE 238
+ +E HPY KWIDNYSSE FQ SALQ EDLLDKLSVSLTGEELDIIEKLY+QAMKLE+E
Sbjct: 181 HPSESTHPYKKWIDNYSSEGFQGSALQTEDLLDKLSVSLTGEELDIIEKLYYQAMKLEIE 240
Query: 239 FFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQ 298
FFCAQ L Q T+VPL KGH+PA DRL+IFSDFDLTCT+VDSSAILAEIAI+TAPK DQNQ
Sbjct: 241 FFCAQLLDQYTIVPLTKGHDPAADRLVIFSDFDLTCTVVDSSAILAEIAIITAPKFDQNQ 300
Query: 299 PENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFE 358
PENQ+ RMSS +LRNTWG+LSKQYTEEYEQCIE+ +PSEKVE F+YE L KALEQLS FE
Sbjct: 301 PENQIIRMSSADLRNTWGVLSKQYTEEYEQCIENILPSEKVEEFDYEGLCKALEQLSDFE 360
Query: 359 KRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCG 418
KRANSRVIESGVLKG+NL+DIK+AGERL LQDGC +FFQ +VKNE+L A+VH+LSYCWCG
Sbjct: 361 KRANSRVIESGVLKGLNLDDIKRAGERLILQDGCASFFQNIVKNESLIADVHILSYCWCG 420
Query: 419 DLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKN 478
DLIR++FSS GL+ LNVHANEF+FKESIS GEI++ VESPIDK++AF N LE DRKN
Sbjct: 421 DLIRSAFSSGGLHVLNVHANEFAFKESISNGEIVKNVESPIDKLKAFLNILENCSNDRKN 480
Query: 479 LSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSS 538
L+VYIGDSVGDLLCLL AD+GIVIGSSSSL+RVGSQFGV+F+PL+ LVKKQKEY EGSS
Sbjct: 481 LTVYIGDSVGDLLCLLNADVGIVIGSSSSLKRVGSQFGVSFVPLFRFLVKKQKEYVEGSS 540
Query: 539 SNWKEKSGILYTVSSWAEVHAFILGW 564
S WK SG LYTVSSWAE+HAFILGW
Sbjct: 541 SRWKGLSGTLYTVSSWAEIHAFILGW 566
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296088278|emb|CBI36504.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118486577|gb|ABK95127.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356576723|ref|XP_003556479.1| PREDICTED: uncharacterized protein LOC100813450 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535194|ref|XP_003536133.1| PREDICTED: uncharacterized protein LOC100788250 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224125750|ref|XP_002319666.1| predicted protein [Populus trichocarpa] gi|222858042|gb|EEE95589.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224145849|ref|XP_002325785.1| predicted protein [Populus trichocarpa] gi|222862660|gb|EEF00167.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297805028|ref|XP_002870398.1| hypothetical protein ARALYDRAFT_915614 [Arabidopsis lyrata subsp. lyrata] gi|297316234|gb|EFH46657.1| hypothetical protein ARALYDRAFT_915614 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|145358529|ref|NP_198287.3| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana] gi|332006501|gb|AED93884.1| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110737432|dbj|BAF00660.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 564 | ||||||
| TAIR|locus:2145816 | 617 | AT5G32470 "AT5G32470" [Arabido | 0.985 | 0.901 | 0.696 | 3.1e-209 | |
| UNIPROTKB|G4MTS1 | 304 | MGG_04762 "Uncharacterized pro | 0.413 | 0.766 | 0.256 | 8.5e-10 | |
| TIGR_CMR|BA_0725 | 231 | BA_0725 "transcriptional activ | 0.331 | 0.809 | 0.229 | 1.1e-09 | |
| POMBASE|SPBC17G9.12c | 274 | SPBC17G9.12c "hydrolase (predi | 0.460 | 0.948 | 0.257 | 1.2e-07 | |
| UNIPROTKB|Q5HW25 | 221 | CJE0491 "TenA/Thi-4 family pro | 0.338 | 0.864 | 0.231 | 1.5e-07 | |
| TIGR_CMR|CJE_0491 | 221 | CJE_0491 "TenA/Thi-4 family pr | 0.338 | 0.864 | 0.231 | 1.5e-07 | |
| ASPGD|ASPL0000004890 | 510 | AN10762 [Emericella nidulans ( | 0.349 | 0.386 | 0.216 | 7.9e-06 | |
| SGD|S000000608 | 317 | YCR015C "Putative protein of u | 0.402 | 0.716 | 0.267 | 1.9e-05 | |
| CGD|CAL0004824 | 288 | orf19.6732 [Candida albicans ( | 0.324 | 0.635 | 0.252 | 2.6e-05 | |
| POMBASE|SPBP8B7.18c | 551 | SPBP8B7.18c "TENA/THI family p | 0.173 | 0.177 | 0.26 | 7.9e-05 |
| TAIR|locus:2145816 AT5G32470 "AT5G32470" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2023 (717.2 bits), Expect = 3.1e-209, P = 3.1e-209
Identities = 394/566 (69%), Positives = 468/566 (82%)
Query: 3 AIPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLK 62
+IPP S EE L +LWIKF RE +F++YSPF VCLA+GNLK++TFR YIAQD HFLK
Sbjct: 57 SIPPTS----EEALPGKLWIKFNRECLFSIYSPFAVCLAAGNLKIDTFRQYIAQDVHFLK 112
Query: 63 AFSQXXXXXXXXXXXXXXKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKY 122
AF+ KL+IS+LRK V+EELKMHDSFV++W D+ K +VNSAT++Y
Sbjct: 113 AFAHAYELAADCADDDDDKLAISDLRKSVMEELKMHDSFVQDWDLDINKEVSVNSATLRY 172
Query: 123 TEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANE 182
TEFLLATASGKVEG K PG L TPFEKTKVAAYTLGA++PCMRLYAFLGKEF +LL+ ++
Sbjct: 173 TEFLLATASGKVEGCKAPGMLDTPFEKTKVAAYTLGAVTPCMRLYAFLGKEFGSLLDLSD 232
Query: 183 GNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCA 242
NHPY KWIDNYSS++FQASA Q EDLL+KLSVS+TGEELDIIEKLY QAMKLEVEFF A
Sbjct: 233 VNHPYKKWIDNYSSDAFQASAKQTEDLLEKLSVSMTGEELDIIEKLYQQAMKLEVEFFHA 292
Query: 243 QPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQ 302
QPLAQPT+VPL+K H+ D L+IFSDFDLTCT+VDSSAILAEIAIVTAPK +Q++ Q
Sbjct: 293 QPLAQPTIVPLLKNHSK--DDLVIFSDFDLTCTVVDSSAILAEIAIVTAPKDEQSRSGQQ 350
Query: 303 LGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRAN 362
+ RM S +L+NTW LLSKQYTE YE+CIES + +K + F+YE L KALEQLS FEK AN
Sbjct: 351 IHRMLSSDLKNTWNLLSKQYTEHYEECIESILNKKKADKFDYEGLCKALEQLSDFEKEAN 410
Query: 363 SRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIR 422
+RVIESGVLKG+NLEDIK+AGERL LQDGC FQK++K ENLNA +HVLSYCWCGDLIR
Sbjct: 411 NRVIESGVLKGLNLEDIKRAGERLILQDGCINVFQKILKTENLNAELHVLSYCWCGDLIR 470
Query: 423 ASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLE--KYGTDRKN-L 479
A+FS+ G++A+ VHANEF+F+ESISTGEI KVESPI+K Q F + L+ K ++K+ L
Sbjct: 471 AAFSAGGVDAVEVHANEFTFEESISTGEIERKVESPINKAQQFKSILQNRKNENNKKSFL 530
Query: 480 SVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSS 539
SVYIGDSVGDLLCLLEADIGIV+ SSSSLRRVGS FGV+F+PL+ G+V+KQK++TE SSS
Sbjct: 531 SVYIGDSVGDLLCLLEADIGIVVSSSSSLRRVGSHFGVSFVPLFSGIVQKQKQHTEESSS 590
Query: 540 N-WKEKSGILYTVSSWAEVHAFILGW 564
+ WK SG LYTVSSWAE+H+F LGW
Sbjct: 591 SAWKGLSGTLYTVSSWAEIHSFALGW 616
|
|
| UNIPROTKB|G4MTS1 MGG_04762 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0725 BA_0725 "transcriptional activator TenA, putative" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC17G9.12c SPBC17G9.12c "hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5HW25 CJE0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0491 CJE_0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000004890 AN10762 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000608 YCR015C "Putative protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004824 orf19.6732 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP8B7.18c SPBP8B7.18c "TENA/THI family protein" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.3.3 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.3.3.11 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 564 | |||
| COG0819 | 218 | COG0819, TenA, Putative transcription activator [T | 2e-37 | |
| PTZ00347 | 504 | PTZ00347, PTZ00347, phosphomethylpyrimidine kinase | 1e-24 | |
| pfam03070 | 210 | pfam03070, TENA_THI-4, TENA/THI-4/PQQC family | 8e-21 | |
| PRK14713 | 530 | PRK14713, PRK14713, multifunctional hydroxymethylp | 3e-20 | |
| TIGR04306 | 208 | TIGR04306, salvage_TenA, thiaminase II | 1e-19 | |
| PRK09517 | 755 | PRK09517, PRK09517, multifunctional thiamine-phosp | 4e-15 | |
| TIGR00338 | 219 | TIGR00338, serB, phosphoserine phosphatase SerB | 3e-05 | |
| COG0560 | 212 | COG0560, SerB, Phosphoserine phosphatase [Amino ac | 4e-05 | |
| pfam12710 | 122 | pfam12710, HAD, haloacid dehalogenase-like hydrola | 5e-04 |
| >gnl|CDD|223889 COG0819, TenA, Putative transcription activator [Transcription] | Back alignment and domain information |
|---|
Score = 137 bits (347), Expect = 2e-37
Identities = 65/210 (30%), Positives = 104/210 (49%), Gaps = 24/210 (11%)
Query: 35 PFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADD-DDAKLSISELRKGVLE 93
PF LA G L E F+ Y+ QD+ +L F++A L A D + + ++ V
Sbjct: 22 PFVQELADGTLPREKFQFYLVQDYLYLVNFARALALLASKAPDLELMEELAKIIQFLVEG 81
Query: 94 ELKMHDSFVKEWGTDLAKMATV--NSATVKYTEFLLATA-SGKVEGVKGPGKLATPFEKT 150
E+++H+ +E G L ++ + A YT +LL TA SG
Sbjct: 82 EMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDTAYSGSF---------------- 125
Query: 151 KVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLL 210
A L A+ PC+ YA +GK A A+ N PY +WID Y+SE FQ + + E LL
Sbjct: 126 ---AELLAALLPCLWGYAEIGKRLKAKPRASP-NPPYQEWIDTYASEEFQEAVEELEALL 181
Query: 211 DKLSVSLTGEELDIIEKLYHQAMKLEVEFF 240
D L+ + + EEL+ +++++ A + E+ F+
Sbjct: 182 DSLAENSSEEELEKLKQIFLTASRFELAFW 211
|
Length = 218 |
| >gnl|CDD|240375 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217351 pfam03070, TENA_THI-4, TENA/THI-4/PQQC family | Back alignment and domain information |
|---|
| >gnl|CDD|237797 PRK14713, PRK14713, multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213919 TIGR04306, salvage_TenA, thiaminase II | Back alignment and domain information |
|---|
| >gnl|CDD|169939 PRK09517, PRK09517, multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| COG0819 | 218 | TenA Putative transcription activator [Transcripti | 100.0 | |
| PRK14713 | 530 | multifunctional hydroxymethylpyrimidine phosphokin | 100.0 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 100.0 | |
| PTZ00347 | 504 | phosphomethylpyrimidine kinase; Provisional | 100.0 | |
| PF03070 | 210 | TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR0 | 100.0 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 99.96 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 99.93 | |
| KOG2598 | 523 | consensus Phosphomethylpyrimidine kinase [Coenzyme | 99.92 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.92 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.9 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.89 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.88 | |
| PF05822 | 246 | UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter | 99.88 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 99.87 | |
| KOG3128 | 298 | consensus Uncharacterized conserved protein [Funct | 99.87 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.84 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 99.83 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 99.83 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.82 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.82 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.81 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.76 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.76 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 99.74 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 99.74 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.73 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.61 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 99.59 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 99.4 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.16 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.07 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.0 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.97 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 98.96 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 98.96 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.96 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 98.92 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.88 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.87 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.87 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.85 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.82 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.81 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 98.78 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.77 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.76 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.74 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.74 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 98.72 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 98.72 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 98.67 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 98.67 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.67 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 98.65 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 98.61 | |
| PRK05157 | 246 | pyrroloquinoline quinone biosynthesis protein PqqC | 98.6 | |
| PLN02940 | 382 | riboflavin kinase | 98.6 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 98.59 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.57 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 98.53 | |
| TIGR02111 | 239 | PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C. | 98.53 | |
| COG5424 | 242 | Pyrroloquinoline quinone (Coenzyme PQQ) biosynthes | 98.52 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 98.48 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 98.47 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 98.44 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 98.44 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 98.44 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 98.42 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 98.39 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 98.38 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 98.37 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 98.37 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.36 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 98.36 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.35 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 98.3 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 98.24 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.23 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.23 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 98.21 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.2 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 98.16 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.16 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.15 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 98.1 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 98.07 | |
| PLN02811 | 220 | hydrolase | 98.07 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 98.06 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 98.05 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 98.04 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.02 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 97.99 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 97.98 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.98 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 97.97 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.95 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.92 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 97.91 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 97.9 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 97.89 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.88 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.85 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.79 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 97.76 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 97.74 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 97.73 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 97.73 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.71 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 97.71 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 97.66 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 97.62 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.61 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 97.6 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.54 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 97.53 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 97.52 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.52 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.49 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.48 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 97.48 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.45 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 97.45 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 97.38 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 97.34 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 97.3 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 97.29 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 97.27 | |
| PLN02887 | 580 | hydrolase family protein | 97.26 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 97.26 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 97.22 | |
| PRK06769 | 173 | hypothetical protein; Validated | 97.17 | |
| CHL00168 | 238 | pbsA heme oxygenase; Provisional | 97.16 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.16 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.15 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 97.13 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.11 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.1 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 97.05 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.04 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 97.01 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 96.95 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 96.94 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 96.89 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 96.84 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 96.82 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 96.82 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.78 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 96.78 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 96.75 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 96.75 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 96.74 | |
| cd00232 | 203 | HemeO Heme oxygenase catalyzes the rate limiting s | 96.65 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 96.55 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 96.52 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 96.48 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 96.37 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 96.07 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 96.01 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 95.99 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 95.94 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 95.82 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 95.7 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 95.51 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 95.38 | |
| PF12981 | 231 | DUF3865: Domain of Unknown Function with PDB struc | 95.24 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 95.1 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 94.86 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 94.83 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 94.79 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 94.64 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 94.42 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 94.41 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 94.33 | |
| PLN02423 | 245 | phosphomannomutase | 94.23 | |
| PF01126 | 205 | Heme_oxygenase: Heme oxygenase; InterPro: IPR01605 | 93.59 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 92.98 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 92.7 | |
| COG5398 | 238 | Heme oxygenase [Inorganic ion transport and metabo | 92.24 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 92.11 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 91.7 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 91.68 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 91.49 | |
| PLN02580 | 384 | trehalose-phosphatase | 91.42 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 91.14 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 90.96 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 89.5 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 89.08 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 87.72 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 86.8 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 85.75 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 84.14 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 83.85 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 82.91 | |
| PF09949 | 100 | DUF2183: Uncharacterized conserved protein (DUF218 | 82.75 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 80.96 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 80.05 |
| >COG0819 TenA Putative transcription activator [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-47 Score=366.63 Aligned_cols=210 Identities=30% Similarity=0.466 Sum_probs=195.5
Q ss_pred chHHHHHHHHhHHhHHHhhcChHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHH-
Q 008479 14 EGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGVL- 92 (564)
Q Consensus 14 ~~~~~~lw~~~~~~~~~~~~hpFv~~la~GtL~~~~f~~Yl~QD~~YL~~~~r~~~~~~~~a~~~~~~~~l~~~~~~i~- 92 (564)
+.|++.||+..++.|...++||||++|++||||+++|++||+|||+||.+|+|+++++++|+++.+.+..+...+..+.
T Consensus 1 ~~f~~~L~~~~~~~W~~~~~H~FV~~L~~GtL~~~~F~~YL~QDy~YL~~~~ra~~~~~~ka~~~~~~~~~~~~~~~~~~ 80 (218)
T COG0819 1 MMFSEELIRAAQPIWQKYIEHPFVQELADGTLPREKFQFYLVQDYLYLVNFARALALLASKAPDLELMEELAKIIQFLVE 80 (218)
T ss_pred CchHHHHHHHhHHHHHHHcCCHHHHHHHcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHH
Confidence 4689999999999999999999999999999999999999999999999999999999999999999888888877766
Q ss_pred HHHHHHHHHHHHhCCCcc--cccCCChhHHHHHHHHHHHhc-CCCCCCCCCCCCCCchhhhhhHHHHHHHHHHHHHHHHH
Q 008479 93 EELKMHDSFVKEWGTDLA--KMATVNSATVKYTEFLLATAS-GKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAF 169 (564)
Q Consensus 93 ~E~~~h~~~~~~~gi~~~--~~~~~~pa~~~Y~~~l~~~a~-~~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~~~Y~~ 169 (564)
.|+.+|+++++++||+.+ ...+++|+|.+||+||++++. |+ ++++++||+||+|+|++
T Consensus 81 ~E~~~h~~~~~~lgis~~~~~~~~~~~~~~aYt~ym~~~~~~g~-------------------~~~~~aAl~PC~~~Y~e 141 (218)
T COG0819 81 GEMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDTAYSGS-------------------FAELLAALLPCLWGYAE 141 (218)
T ss_pred HHHHHHHHHHHHhCCCHHHHHhcCCCchHHHHHHHHHHHHhcCC-------------------HHHHHHHHHHHHHHHHH
Confidence 599999999999999974 257899999999999999996 54 36899999999999999
Q ss_pred HHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 008479 170 LGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQ 243 (564)
Q Consensus 170 i~~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~F~~~~~lE~~Fw~~a 243 (564)
||+++..... ..++++|++||++|+|++|.+.|.+++++||+++...+++++++|.++|.+++++|.+||+++
T Consensus 142 ig~~~~~~~~-~~~~~~Y~~Wi~~Y~s~ef~~~v~~~~~~ld~~~~~~~~~~~~~l~~iF~~ss~~E~~Fwd~a 214 (218)
T COG0819 142 IGKRLKAKPR-ASPNPPYQEWIDTYASEEFQEAVEELEALLDSLAENSSEEELEKLKQIFLTASRFELAFWDMA 214 (218)
T ss_pred HHHHHHhccc-cCCCCcHHHHHHHcCCHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999988653 347899999999999999999999999999999999999999999999999999999999998
|
|
| >PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00347 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF03070 TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR004305 Proteins containing this domain are found in all the three major phyla of life: archaebacteria, eubacteria, and eukaryotes | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >KOG3128 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >PRK05157 pyrroloquinoline quinone biosynthesis protein PqqC; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02111 PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C | Back alignment and domain information |
|---|
| >COG5424 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >CHL00168 pbsA heme oxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >cd00232 HemeO Heme oxygenase catalyzes the rate limiting step in the degradation of heme to bilirubin, it is essential for recycling of iron from heme | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PF12981 DUF3865: Domain of Unknown Function with PDB structure (DUF3865); InterPro: IPR024477 This entry represents a family of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF01126 Heme_oxygenase: Heme oxygenase; InterPro: IPR016053 Haem oxygenase (1 | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG5398 Heme oxygenase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 564 | ||||
| 2rd3_A | 223 | Crystal Structure Of Tena Homologue (Hp1287) From H | 4e-09 | ||
| 3ibx_A | 221 | Crystal Structure Of F47y Variant Of Tena (Hp1287) | 9e-09 | ||
| 2gm7_A | 221 | Tena HomologTHI-4 Thiaminase From Pyrobaculum Aerop | 2e-06 | ||
| 3mvu_A | 226 | Crystal Structure Of A Tena Family Transcription Re | 8e-06 | ||
| 1yaf_A | 263 | Structure Of Tena From Bacillus Subtilis Length = 2 | 6e-05 | ||
| 2qcx_A | 263 | Crystal Structure Of Bacillus Subtilis Tena Y112f M | 9e-05 | ||
| 1tyh_A | 248 | Crystal Structure Of Transcriptional Activator Tena | 2e-04 | ||
| 1to9_A | 260 | Crystal Structure Of Thi-4 Protein From Bacillus Su | 3e-04 | ||
| 1to9_B | 260 | Crystal Structure Of Thi-4 Protein From Bacillus Su | 3e-04 |
| >pdb|2RD3|A Chain A, Crystal Structure Of Tena Homologue (Hp1287) From Helicobacter Pylori Length = 223 | Back alignment and structure |
|
| >pdb|3IBX|A Chain A, Crystal Structure Of F47y Variant Of Tena (Hp1287) From Helicobacter Pylori Length = 221 | Back alignment and structure |
| >pdb|2GM7|A Chain A, Tena HomologTHI-4 Thiaminase From Pyrobaculum Aerophilum Length = 221 | Back alignment and structure |
| >pdb|3MVU|A Chain A, Crystal Structure Of A Tena Family Transcription Regulator (Tm1040_3656) From Silicibacter Sp. Tm1040 At 1.80 A Resolu Length = 226 | Back alignment and structure |
| >pdb|1YAF|A Chain A, Structure Of Tena From Bacillus Subtilis Length = 263 | Back alignment and structure |
| >pdb|2QCX|A Chain A, Crystal Structure Of Bacillus Subtilis Tena Y112f Mutant Complexed With Formyl Aminomethyl Pyrimidine Length = 263 | Back alignment and structure |
| >pdb|1TYH|A Chain A, Crystal Structure Of Transcriptional Activator Tena From Bacillus Subtilis Length = 248 | Back alignment and structure |
| >pdb|1TO9|A Chain A, Crystal Structure Of Thi-4 Protein From Bacillus Subtilis Length = 260 | Back alignment and structure |
| >pdb|1TO9|B Chain B, Crystal Structure Of Thi-4 Protein From Bacillus Subtilis Length = 260 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A Length = 258 | Back alignment and structure |
|---|
Score = 150 bits (379), Expect = 7e-42
Identities = 39/239 (16%), Positives = 82/239 (34%), Gaps = 29/239 (12%)
Query: 4 IPPKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKA 63
KS P + L +LW +V + + + +A+G L + + QD ++
Sbjct: 38 TTLKSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFR 97
Query: 64 FSQAYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYT 123
Y A CA D+ + K E ++++ + W A + Y
Sbjct: 98 GRDDYATAATCAQDETLREFFKAKAKSYDE---YNETYHQTWHLREASGLIPGTDIKDYA 154
Query: 124 EFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEG 183
++ A + + Y M PC L+ ++ L
Sbjct: 155 DYEAYVA------------------GSLASPYMCVVMLPCEYLWPWIANF---LDGYTPT 193
Query: 184 NHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCA 242
N Y WI+ A + ++L++ + ++ ++++ AM E++ F +
Sbjct: 194 NSLYRFWIEWNGGTPNGAYQM--GNMLEQYRDKIDEDKA---VEIFNTAMNYELKVFTS 247
|
| >3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A Length = 221 | Back alignment and structure |
|---|
| >2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A Length = 263 | Back alignment and structure |
|---|
| >1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 Length = 220 | Back alignment and structure |
|---|
| >2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* Length = 221 | Back alignment and structure |
|---|
| >2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* Length = 221 | Back alignment and structure |
|---|
| >3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} Length = 248 | Back alignment and structure |
|---|
| >1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 Length = 226 | Back alignment and structure |
|---|
| >2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} Length = 214 | Back alignment and structure |
|---|
| >3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Length = 226 | Back alignment and structure |
|---|
| >1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A Length = 225 | Back alignment and structure |
|---|
| >3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Length = 550 | Back alignment and structure |
|---|
| >1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 Length = 190 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4 Length = 231 | Back alignment and structure |
|---|
| >2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297 | Back alignment and structure |
|---|
| >3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV} Length = 262 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| 3no6_A | 248 | Transcriptional activator TENA; structural genomic | 100.0 | |
| 3mvu_A | 226 | TENA family transcriptional regulator; TENA/THI-4/ | 100.0 | |
| 3ibx_A | 221 | TENA, HP1287, putative thiaminase II; vitamin B1, | 100.0 | |
| 4fn6_A | 229 | Thiaminase-2, thiaminase II; alpha-helix, vitamin | 100.0 | |
| 2qcx_A | 263 | Transcriptional activator TENA; UP-DOWN bundle, hy | 100.0 | |
| 1z72_A | 225 | Transcriptional regulator, putative; structu genom | 100.0 | |
| 1rtw_A | 220 | Transcriptional activator, putative; PF1337, TENA, | 100.0 | |
| 2f2g_A | 221 | SEED maturation protein PM36 homolog; TENA_THI-4 d | 100.0 | |
| 2gm8_A | 221 | TENA homolog/THI-4 thiaminase; transcription, tran | 100.0 | |
| 1udd_A | 226 | Transcriptional regulator; helix-bundle, lipid bin | 100.0 | |
| 3rm5_A | 550 | Hydroxymethylpyrimidine/phosphomethylpyrimidine K | 100.0 | |
| 2qzc_A | 214 | Transcriptional activator TENA-1; heme oxygenase-l | 100.0 | |
| 2a2m_A | 258 | Hypothetical protein BT3146; putative TENA family | 100.0 | |
| 1wwm_A | 190 | Hypothetical protein TT2028; TENA/THI-4 family, pu | 100.0 | |
| 3oql_A | 262 | TENA homolog; transcriptional activator, structura | 100.0 | |
| 1rcw_A | 231 | CT610, CADD; iron, DI-iron, redox enzyme, metallo | 99.96 | |
| 3dde_A | 239 | TENA/THI-4 protein, domain of unknown function WI | 99.92 | |
| 3hlx_A | 258 | Pyrroloquinoline-quinone synthase; PQQC, PQQ biosy | 99.91 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.87 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.86 | |
| 3bjd_A | 332 | Putative 3-oxoacyl-(acyl-carrier-protein) synthas; | 99.81 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.76 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.75 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 99.73 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.72 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.65 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.6 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.56 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.56 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.44 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 99.42 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.32 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.3 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.16 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.14 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.14 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.14 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.12 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.09 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.07 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.06 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.06 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.05 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.04 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.03 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.03 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.03 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.02 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.01 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 98.99 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.96 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.96 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.96 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.94 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.93 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 98.93 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.92 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.92 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.9 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.9 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.89 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.89 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.88 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.88 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.88 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.86 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.85 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 98.84 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.83 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 98.82 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.82 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 98.81 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 98.79 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.78 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.77 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.77 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.77 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.76 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.75 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.74 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.73 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 98.71 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 98.71 | |
| 3b5o_A | 244 | CADD-like protein of unknown function; structural | 98.7 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 98.69 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 98.68 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 98.67 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.67 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 98.65 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 98.58 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.58 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 97.98 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.49 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 98.46 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.46 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.45 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 98.44 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.42 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.41 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.39 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.38 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 98.36 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 98.36 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 98.32 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 98.32 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.29 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.27 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 98.25 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 98.25 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.25 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.23 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.2 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.19 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 98.19 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.18 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 98.18 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.14 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 98.14 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 98.13 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 98.12 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 98.08 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 98.07 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.06 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 98.03 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.02 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.01 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 98.0 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.99 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.96 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 97.95 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.91 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.89 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 97.88 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 97.84 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 97.82 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 97.66 | |
| 2q32_A | 264 | Heme oxygenase 2, HO-2; structural genomics medica | 97.57 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.51 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 97.48 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 97.48 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 97.48 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.46 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 97.43 | |
| 1wov_A | 250 | Heme oxygenase 2; HOMO dimer, oxidoreductase; HET: | 97.36 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 97.35 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 97.32 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.31 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.13 | |
| 1j02_A | 267 | Heme oxygenase 1; alpha helix, O2-analog bound for | 97.11 | |
| 1we1_A | 240 | Heme oxygenase 1; oxidoreductase; HET: HEM; 2.50A | 97.1 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.05 | |
| 1n45_A | 233 | Heme oxygenase 1, HO-1; alpha helices, heme-bindin | 97.03 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 96.96 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 96.95 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 96.94 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 96.93 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 96.86 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 96.83 | |
| 1wzd_A | 215 | Heme oxygenase; electron-transfer, artificial meta | 96.81 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 96.78 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 96.77 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.65 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 96.61 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 96.53 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.43 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.28 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 95.95 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 95.82 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 95.11 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 95.02 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 94.61 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 94.33 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 93.87 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 92.22 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 92.02 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 87.12 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 86.98 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 86.47 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 86.25 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 84.55 |
| >3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} SCOP: a.132.1.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=6.7e-48 Score=383.46 Aligned_cols=220 Identities=20% Similarity=0.241 Sum_probs=201.2
Q ss_pred CcchHHHHHHHHhHHhHHHhhcChHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHH
Q 008479 12 EEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSISELRKGV 91 (564)
Q Consensus 12 ~~~~~~~~lw~~~~~~~~~~~~hpFv~~la~GtL~~~~f~~Yl~QD~~YL~~~~r~~~~~~~~a~~~~~~~~l~~~~~~i 91 (564)
..++|+++||++..+.|..+++||||++|++||||.++|++||+||++||.+|+|+++++++|+++.+++..+...+..+
T Consensus 18 ~~~~ft~~L~~~~~~~w~~~~~HPFv~~L~~GtL~~e~F~~YL~QD~~YL~~far~~a~a~aka~~~~~~~~~~~~~~~~ 97 (248)
T 3no6_A 18 QGMTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKFLVEQIEFM 97 (248)
T ss_dssp TTBCHHHHHHHHHHHHHHHHHHSHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHGGGCSCHHHHHHHHHHHHHH
T ss_pred CCccHHHHHHHhCHHHHHHHHCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHH
Confidence 45789999999999999999999999999999999999999999999999999999999999999999999999998887
Q ss_pred H-HHHHHHHHHHHHhCCCcc---cccCCChhHHHHHHHHHHHhcC-CCCCCCCCCCCCCchhhhhhHHHHHHHHHHHHHH
Q 008479 92 L-EELKMHDSFVKEWGTDLA---KMATVNSATVKYTEFLLATASG-KVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRL 166 (564)
Q Consensus 92 ~-~E~~~h~~~~~~~gi~~~---~~~~~~pa~~~Y~~~l~~~a~~-~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~~~ 166 (564)
. +|+++|++++++|||+.+ ...+++|+|++||+||++++.. +. ++++++||+||+|+
T Consensus 98 ~~~E~~lh~~~~~~~gi~~~~~~~~~~~~p~~~aYt~~ll~~a~~~g~------------------~~~~laAl~PC~w~ 159 (248)
T 3no6_A 98 LEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFNAFAREN------------------AAFTIAAMAPCPYV 159 (248)
T ss_dssp HTCCCHHHHHHHHHTTSCHHHHCCSCCCCHHHHHHHHHHHHHHHHCSS------------------THHHHHHHTHHHHH
T ss_pred HHHHHHHHHHHHHHcCCCHHHHhhhcCCCHHHHHHHHHHHHHHhcCCC------------------HHHHHHHHHHHHHH
Confidence 5 699999999999999976 3468899999999999999953 32 36899999999999
Q ss_pred HHHHHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHHHHhhccCCCC
Q 008479 167 YAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLA 246 (564)
Q Consensus 167 Y~~i~~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~F~~~~~lE~~Fw~~a~~~ 246 (564)
|++||+++..... ..++++|++||++|+ ++|.+.|.+++++||++++.++++++++|+++|+++|++|++|||++ ++
T Consensus 160 Y~eig~~l~~~~~-~~~~~~Y~~WI~~Y~-~ef~~~v~~~~~~ld~~~~~~s~~~~~~l~~~F~~a~~lE~~Fwd~a-y~ 236 (248)
T 3no6_A 160 YAVIGKRAMEDPK-LNKESVTSKWFQFYS-TEMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFNMA-YI 236 (248)
T ss_dssp HHHHHHHHHHCTT-CCTTSTTHHHHHHHH-HHTHHHHHHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHHH-HH
T ss_pred HHHHHHHHHhcCC-CCCCchHHHHHHHHH-HHHHHHHHHHHHHHHHHhhhCCHHHHHHHHHHHHHHHHHHHHHHHHH-hh
Confidence 9999999987542 225789999999999 99999999999999999999999999999999999999999999999 77
Q ss_pred CCccccc
Q 008479 247 QPTVVPL 253 (564)
Q Consensus 247 ~~~~~p~ 253 (564)
+.+ ||+
T Consensus 237 ~e~-W~~ 242 (248)
T 3no6_A 237 NEK-WEY 242 (248)
T ss_dssp TCC-CCC
T ss_pred hcc-CCC
Confidence 665 554
|
| >3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} SCOP: a.132.1.0 | Back alignment and structure |
|---|
| >3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A | Back alignment and structure |
|---|
| >4fn6_A Thiaminase-2, thiaminase II; alpha-helix, vitamin B1, BI-functional enzyme, C of thiamine INTO HMP and THZ; HET: CME; 2.69A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A | Back alignment and structure |
|---|
| >1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A | Back alignment and structure |
|---|
| >1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* | Back alignment and structure |
|---|
| >2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* | Back alignment and structure |
|---|
| >1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A | Back alignment and structure |
|---|
| >1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4 | Back alignment and structure |
|---|
| >3dde_A TENA/THI-4 protein, domain of unknown function WI oxygenase-like fold; structural genomics, joint center for structural genomics; HET: MSE PGE; 2.30A {Shewanella denitrificans OS217} | Back alignment and structure |
|---|
| >3hlx_A Pyrroloquinoline-quinone synthase; PQQC, PQQ biosynthesis, oxidase, complex, all helical, oxido; HET: PQQ; 1.30A {Klebsiella pneumoniae subsp} SCOP: a.132.1.4 PDB: 3hml_A* 1otv_A 3hnh_A* 1otw_A* | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3bjd_A Putative 3-oxoacyl-(acyl-carrier-protein) synthas; structural genomics, APC5632, 3-oxoacyl-(acyl-carrier-protei synthase, PSI-2; HET: MSE; 1.85A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3b5o_A CADD-like protein of unknown function; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; HET: MSE; 1.35A {Nostoc punctiforme} PDB: 3b5p_A* | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2q32_A Heme oxygenase 2, HO-2; structural genomics medical relevance, structural genomics community request, protein structure in PSI; HET: OXN; 2.40A {Homo sapiens} PDB: 2qpp_A* 2rgz_A* | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1wov_A Heme oxygenase 2; HOMO dimer, oxidoreductase; HET: HEM; 1.75A {Synechocystis SP} SCOP: a.132.1.1 PDB: 1wow_A* 1wox_A* | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1j02_A Heme oxygenase 1; alpha helix, O2-analog bound form, oxidoreductase; HET: HEM; 1.70A {Rattus norvegicus} SCOP: a.132.1.1 PDB: 1irm_C 1dve_A* 1ix3_A* 1ivj_A* 1ix4_A* 1j2c_A* 1ubb_A* 1ulx_A* 1vgi_A* 2dy5_A* 2e7e_A* 2zvu_A* 1dvg_A* 3i9t_A* 3i9u_A* | Back alignment and structure |
|---|
| >1we1_A Heme oxygenase 1; oxidoreductase; HET: HEM; 2.50A {Synechocystis SP} SCOP: a.132.1.1 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1n45_A Heme oxygenase 1, HO-1; alpha helices, heme-binding site, oxidoreductase; HET: HEM; 1.50A {Homo sapiens} SCOP: a.132.1.1 PDB: 1n3u_A* 1ozr_A* 1ozw_A* 1s13_A* 1s8c_A* 1t5p_A* 1twn_A* 1twr_A* 3czy_A* 3hok_A* 3k4f_A* 3tgm_A* 1xjz_A* 1xk3_A* 1xk2_A* 1ozl_A* 1oyk_A* 1oze_A* 1oyl_A* 1xk0_A* ... | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wzd_A Heme oxygenase; electron-transfer, artificial metalloprotein; HET: YOK; 1.35A {Corynebacterium diphtheriae} SCOP: a.132.1.1 PDB: 1iw1_A* 1v8x_A* 1iw0_A* 1wzf_A* 1wzg_A* 2z68_A* 3i8r_A* 3moo_A* 1wnw_A* 1wnx_A* 1wnv_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 564 | ||||
| d2a2ma1 | 231 | a.132.1.3 (A:10-240) Hypothetical protein BT3146 { | 1e-41 | |
| d2f2ga1 | 215 | a.132.1.3 (A:5-219) Seed maturation protein-relate | 2e-35 | |
| d2gm8a1 | 211 | a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon | 1e-34 | |
| d1wwma1 | 180 | a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 | 2e-34 | |
| d1udda_ | 215 | a.132.1.3 (A:) Hypothetical transcriptional regula | 4e-33 | |
| d1rtwa_ | 206 | a.132.1.3 (A:) Putative transcriptional activator | 4e-33 | |
| d1to9a_ | 225 | a.132.1.3 (A:) Transcriptional activator TenA {Bac | 4e-32 | |
| d1z72a1 | 217 | a.132.1.3 (A:4-220) Putative transcriptional regul | 2e-31 | |
| d1rcwa_ | 213 | a.132.1.4 (A:) Hypothetical protein CT610 {Chlamyd | 3e-12 | |
| d2bdua1 | 291 | c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III | 2e-10 | |
| d1otva_ | 254 | a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, P | 6e-05 |
| >d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 231 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme oxygenase-like superfamily: Heme oxygenase-like family: TENA/THI-4 domain: Hypothetical protein BT3146 species: Bacteroides thetaiotaomicron [TaxId: 818]
Score = 147 bits (373), Expect = 1e-41
Identities = 39/239 (16%), Positives = 83/239 (34%), Gaps = 29/239 (12%)
Query: 7 KSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQ 66
KS P + L +LW +V + + + +A+G L + + QD ++
Sbjct: 20 KSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFRGRD 79
Query: 67 AYELAEECADDDDAKLSISELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFL 126
Y A CA D+ + K + ++++ + W A + Y ++
Sbjct: 80 DYATAATCAQDETLREFFKAKAK---SYDEYNETYHQTWHLREASGLIPGTDIKDYADYE 136
Query: 127 LATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHP 186
A + + Y M PC L+ ++ L N
Sbjct: 137 AYVAG------------------SLASPYMCVVMLPCEYLWPWIANF---LDGYTPTNSL 175
Query: 187 YTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPL 245
Y WI+ A Q ++L++ + ++ ++++ AM E++ F + +
Sbjct: 176 YRFWIEWN--GGTPNGAYQMGNMLEQYRDKIDEDKA---VEIFNTAMNYELKVFTSSTI 229
|
| >d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 215 | Back information, alignment and structure |
|---|
| >d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 211 | Back information, alignment and structure |
|---|
| >d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} Length = 215 | Back information, alignment and structure |
|---|
| >d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 206 | Back information, alignment and structure |
|---|
| >d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} Length = 225 | Back information, alignment and structure |
|---|
| >d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} Length = 217 | Back information, alignment and structure |
|---|
| >d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} Length = 213 | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 | Back information, alignment and structure |
|---|
| >d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]} Length = 254 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 564 | |||
| d2a2ma1 | 231 | Hypothetical protein BT3146 {Bacteroides thetaiota | 100.0 | |
| d1to9a_ | 225 | Transcriptional activator TenA {Bacillus subtilis | 100.0 | |
| d1rtwa_ | 206 | Putative transcriptional activator PF1337 {Archaeo | 100.0 | |
| d1udda_ | 215 | Hypothetical transcriptional regulator PH1161 {Pyr | 100.0 | |
| d2f2ga1 | 215 | Seed maturation protein-related At3g16990 {Thale c | 100.0 | |
| d2gm8a1 | 211 | TenA homolog PAE0170 {Archaeon Pyrobaculum aerophi | 100.0 | |
| d1z72a1 | 217 | Putative transcriptional regulator SP0716 (SPr0628 | 100.0 | |
| d1wwma1 | 180 | Hypothetical protein TTHA0169 (TT2028) {Thermus th | 100.0 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 99.95 | |
| d1rcwa_ | 213 | Hypothetical protein CT610 {Chlamydia trachomatis | 99.91 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.89 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.87 | |
| d1otva_ | 254 | Coenzyme PQQ synthesis protein C, PqqC {Klebsiella | 99.77 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.7 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.4 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.92 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.9 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.89 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.88 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 98.88 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.87 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 98.72 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.7 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 98.66 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.58 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 98.57 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 98.54 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 98.53 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 98.47 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 98.46 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.44 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 98.43 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 98.41 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 98.37 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 98.37 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 98.3 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 98.27 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 98.18 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 98.14 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.13 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.94 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 97.93 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 97.79 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.76 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 97.72 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.65 | |
| d1n45a_ | 214 | Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [Tax | 97.61 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.61 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.59 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 97.57 | |
| d1wzda1 | 207 | Heme oxygenase HmuO {Corynebacterium diphtheriae [ | 97.52 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 97.47 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.46 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 97.44 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.35 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.16 | |
| d1wova1 | 249 | Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxI | 97.12 | |
| d1we1a_ | 222 | Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: | 97.11 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 96.83 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.31 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 96.28 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 95.56 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 93.4 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 90.24 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 84.9 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 82.2 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 81.7 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 80.38 |
| >d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme oxygenase-like superfamily: Heme oxygenase-like family: TENA/THI-4 domain: Hypothetical protein BT3146 species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=100.00 E-value=1.2e-43 Score=347.36 Aligned_cols=208 Identities=18% Similarity=0.290 Sum_probs=187.6
Q ss_pred CCCCCCCcchHHHHHHHHhHHhHHHhhcChHHHHhhcCCCCHHHHHHHHHhhHHHHHHHHHHHHHHHhcCCCHHHHHHHH
Q 008479 6 PKSPSPEEEGLARRLWIKFKRESVFAMYSPFTVCLASGNLKLETFRHYIAQDFHFLKAFSQAYELAEECADDDDAKLSIS 85 (564)
Q Consensus 6 ~~~~~~~~~~~~~~lw~~~~~~~~~~~~hpFv~~la~GtL~~~~f~~Yl~QD~~YL~~~~r~~~~~~~~a~~~~~~~~l~ 85 (564)
..+..+++.+|+.+||++..+.|.++++||||++|++||||.++|++||+||++||.+|+|+++++++++++.+.+.++.
T Consensus 19 ~~~~~~~~~~~~~~L~~~~~~i~~~~~~h~Fv~~l~~GtL~~e~F~~YL~QDy~YL~~~~r~~a~~~aka~~~~~~~~~~ 98 (231)
T d2a2ma1 19 LKSDVPAADSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLMVQDGYYCFRGRDDYATAATCAQDETLREFFK 98 (231)
T ss_dssp CCCSCCCTTSHHHHHHHHTHHHHHHHHTSHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSHHHHHHHH
T ss_pred CCCCCCCCchHHHHHHHHHHHHHHHHHCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHH
Confidence 35677889999999999999999999999999999999999999999999999999999999999999999988777665
Q ss_pred HHHHHHHHHHHHHHHHHHHhCCCcccccCCChhHHHHHHHHHHHhc-CCCCCCCCCCCCCCchhhhhhHHHHHHHHHHHH
Q 008479 86 ELRKGVLEELKMHDSFVKEWGTDLAKMATVNSATVKYTEFLLATAS-GKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCM 164 (564)
Q Consensus 86 ~~~~~i~~E~~~h~~~~~~~gi~~~~~~~~~pa~~~Y~~~l~~~a~-~~~~~~~~~~~~~~~~~~~~~~a~~l~Al~pC~ 164 (564)
.. +..|+++|+.+++.+|++..+..+++|+|++|++||++++. |+. +++++||+||+
T Consensus 99 ~~---~~~e~~l~~~~~~~~gi~~~~~~~~~p~t~aY~~~l~~~a~~~~~-------------------~~~laallpC~ 156 (231)
T d2a2ma1 99 AK---AKSYDEYNETYHQTWHLREASGLIPGTDIKDYADYEAYVAGSLAS-------------------PYMCVVMLPCE 156 (231)
T ss_dssp HH---HHHHHHHHHHHHHTSCBCCGGGBCCCHHHHHHHHHHHHHHHHSCT-------------------HHHHHHHHHHH
T ss_pred HH---HHHHHHHHHHHHHHcCCChhhcCCCChHHHHHHHHHHHHHhcCCH-------------------HHHHHHHHHHH
Confidence 54 34588999999999999887778899999999999999996 553 68999999999
Q ss_pred HHHHHHHHHHHhhccCCCCcccccccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 008479 165 RLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQ 243 (564)
Q Consensus 165 ~~Y~~i~~~~~~~~~~~~~~~~y~~Wi~~y~s~~f~~~v~~l~~~ld~~~~~~~~~~~~~~~~~F~~~~~lE~~Fw~~a 243 (564)
|+|.+||+++.... .++++|++||++| ++|.+.|.+++++||+++...+ .++++++|.++|++|++||++|
T Consensus 157 w~Y~~ig~~l~~~~---~~~~~y~~WI~~y--~~f~~~v~~~~~~ld~~~~~~~---~e~~~~iF~~~~~lE~~Fwd~A 227 (231)
T d2a2ma1 157 YLWPWIANFLDGYT---PTNSLYRFWIEWN--GGTPNGAYQMGNMLEQYRDKID---EDKAVEIFNTAMNYELKVFTSS 227 (231)
T ss_dssp HHHHHHHHHHGGGS---CTTSTTHHHHHHH--CSCCHHHHHHHHHHHTTGGGSC---HHHHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHhcC---CCCCchHHHHHhC--hhHHHHHHHHHHHHHHHhcccC---HHHHHHHHHHHHHHHHHHHHHh
Confidence 99999999997642 4789999999999 4599999999999999986554 4578999999999999999999
|
| >d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1n45a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wzda1 a.132.1.1 (A:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1we1a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|