Citrus Sinensis ID: 008523

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSAPNTPIKGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYTSNRIT
ccccccccEEEcccccccccccEEEcccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHcccccEEEccccEEEEccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEEcccHHHHHHHHccccccHHHHcccccccEEEEEcccccccccccccccccEEEEEccccEEEEEcccccccHHHHHHHHHHHHcccccEEEccccccccccccEEEEEEEcccccccccccccccccccccEEEcccccccccccEEEEcccccccccHHHHHHHHcccEEEEEEEcccccEEcccccccccccccccccccccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHcccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHccccccccc
ccccccccccccccccccccccEEEccccccccccccccccccccHccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccccccccccccHHHHcccccEEEEcccHHHHHHHHHHHccccEEcccccEEEcccccccEcHHHEEEEccHHHHccccEccccccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHcEcccHHHHHccccccEEEEEEccccccccccccccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEcEEEEEcccccEEEEEccccccHHHHHcccccEEEEcccEEEccccEEEcccEEEEEcccccccccHHHHHccccccEEEcccEccccccEcccccccccccEEEEEHHHccccccccEEccEEEEEEEEcccccccccEEEEcHHHHHHHHHHcEEEEccccEccccccEEEEcHHHcHHHccccHHHHHHHHHHHHHHHccEEEEEEccEccccccccEHHHHEHHHHHcccccccc
maangngefsfgkgtaRKGLAKIQTAASQKkqsaichddstppvkaQTIDELHSlqkkrsapntpikgtqgsfsplsdEARQKQQLQSISASLASltretgpkvvrgdparkaetpkfaadpgdhfsftptisvsdsslkfthvlynlspaeLYEQAIKYEQgsfiassgalatlsgaktgrsprdkrvvkdettehelwwgkmknhdvQVFVndqflnwdpqnrvKVRIVSARAYHSLFMhnmcirptpeelenfgtpdftiynagqfpcnrythymtsstsIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMpkrqilslhsgcnmgkdgDVALFFglsgtgkttlstdhnryligddehcwgdngvsnieggcyakcidlsrekepdIWNAIKFGAVLEnvvfdehtrevdysdksvtentraaypieyipnakipcvgphpknVILLACdafgvlppvsklnLAQTMYHFISGYTALvagtedgikeptatfsacFGAAFIMLHPTKYAAMLAEKMQKHGatgwlvntgwsggrcVLKMVNLYADILGIhytsnrit
maangngefsfgkgtaRKGLAKIQTAASqkkqsaichddstppVKAQTIDELHslqkkrsapntpiKGTQGSFSPLSDEARQKQQLQSISAslasltretgpkvvrgdparkaetpkfaadpgdhFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALatlsgaktgrsprdkrvvkdettehelwwgkmknHDVQVFVNdqflnwdpqnrVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDehtrevdysdksvtentRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADIlgihytsnrit
MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSAPNTPIKGTQGSFSPLSDEARqkqqlqsisaslaslTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIassgalatlsgaKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVAlffglsgtgkttlstDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYTSNRIT
*******************************************************************************************************************************FTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGAL***********************EHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYT*****
*************GT***********************DSTPPVKAQTID********************************************************************************TISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYT**************ATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYTSNR**
********FSFGKGTARKG*********************TPPVKAQTIDELHSLQKKRSAPNTPIKGTQG****************SISASLASLTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLS*******************EHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYTSNRIT
*********************K*************CHDDSTPPVKAQT*D***S*QKKR**********************************ASLTRET*PKVVR**********************TPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHY******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSAPNTPIKGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLYADILGIHYTSNRIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query563 2.2.26 [Sep-21-2011]
Q9T074671 Phosphoenolpyruvate carbo yes no 0.944 0.792 0.810 0.0
P42066670 Phosphoenolpyruvate carbo N/A no 0.936 0.786 0.787 0.0
Q9SLZ0666 Phosphoenolpyruvate carbo N/A no 0.923 0.780 0.782 0.0
P49292624 Phosphoenolpyruvate carbo N/A no 0.859 0.775 0.755 0.0
Q9XFA2626 Phosphoenolpyruvate carbo N/A no 0.866 0.779 0.756 0.0
Q75JD5562 Phosphoenolpyruvate carbo yes no 0.774 0.775 0.578 1e-159
Q7RVS9561 Phosphoenolpyruvate carbo N/A no 0.726 0.729 0.611 1e-155
Q6FRR0544 Phosphoenolpyruvate carbo yes no 0.737 0.762 0.586 1e-153
Q2S008530 Phosphoenolpyruvate carbo yes no 0.701 0.745 0.611 1e-152
O43112543 Phosphoenolpyruvate carbo yes no 0.735 0.762 0.580 1e-152
>sp|Q9T074|PCKA_ARATH Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1 Back     alignment and function desciption
 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/566 (81%), Positives = 489/566 (86%), Gaps = 34/566 (6%)

Query: 2   AANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSA 61
           A NG+G FSF KG     + KI T A+ K+ S +CHDDS P V A TIDELHSLQKKRSA
Sbjct: 8   ATNGDGGFSFPKGPV---MPKITTGAA-KRGSGVCHDDSGPTVNATTIDELHSLQKKRSA 63

Query: 62  PNTPI-KGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARK----AETP 116
           P TPI +    +F+ +S+E RQK QLQSISASLASLTRE+GPKVVRGDPA K    + TP
Sbjct: 64  PTTPINQNAAAAFAAVSEEERQKIQLQSISASLASLTRESGPKVVRGDPAEKKTDGSTTP 123

Query: 117 KFAADPGDHFS-FTP-TISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALAT 174
            +A   G H S F+P T +VSDSSLKFTHVLYNLSPAELYEQAIKYE+GSFI S+GALAT
Sbjct: 124 AYAH--GQHHSIFSPATGAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSNGALAT 181

Query: 175 LSGAKTGRSPRDKRVVKDETTEHELWWGK------MKNHDV---------------QVFV 213
           LSGAKTGR+PRDKRVV+D TTE ELWWGK      M  H                 +VFV
Sbjct: 182 LSGAKTGRAPRDKRVVRDATTEDELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLEKVFV 241

Query: 214 NDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNR 273
           NDQ+LNWDP+NR+KVRIVSARAYHSLFMHNMCIRPT EELE+FGTPDFTIYNAGQFPCNR
Sbjct: 242 NDQYLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTQEELESFGTPDFTIYNAGQFPCNR 301

Query: 274 YTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKD 333
           YTHYMTSSTS+DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKR+ILSLHSGCNMGKD
Sbjct: 302 YTHYMTSSTSVDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCNMGKD 361

Query: 334 GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDI 393
           GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCW + GVSNIEGGCYAKC+DLSREKEPDI
Sbjct: 362 GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREKEPDI 421

Query: 394 WNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILL 453
           WNAIKFG VLENVVFDEHTREVDYSDKSVTENTRAAYPIE+IPNAKIPCVGPHP NVILL
Sbjct: 422 WNAIKFGTVLENVVFDEHTREVDYSDKSVTENTRAAYPIEFIPNAKIPCVGPHPTNVILL 481

Query: 454 ACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTK 513
           ACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTK
Sbjct: 482 ACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTK 541

Query: 514 YAAMLAEKMQKHGATGWLVNTGWSGG 539
           YAAMLAEKM+  GATGWLVNTGWSGG
Sbjct: 542 YAAMLAEKMKSQGATGWLVNTGWSGG 567

Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 9
>sp|P42066|PCKA_CUCSA Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1 Back     alignment and function description
>sp|Q9SLZ0|PCKA_MAIZE Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P49292|PCKA1_UROPA Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9XFA2|PCKA2_UROPA Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1 Back     alignment and function description
>sp|Q75JD5|PCKA_DICDI Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyostelium discoideum GN=pckA PE=1 SV=1 Back     alignment and function description
>sp|Q7RVS9|PCKA_NEUCR Phosphoenolpyruvate carboxykinase [ATP] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pck-1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FRR0|PCKA_CANGA Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PCK1 PE=3 SV=1 Back     alignment and function description
>sp|Q2S008|PCKA2_SALRD Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pckA2 PE=3 SV=1 Back     alignment and function description
>sp|O43112|PCKA_KLULA Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PCK1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
356496541660 PREDICTED: phosphoenolpyruvate carboxyki 0.948 0.809 0.842 0.0
356531401661 PREDICTED: phosphoenolpyruvate carboxyki 0.950 0.809 0.839 0.0
13785471658 phosphoenolpyruvate carboxykinase [Flave 0.946 0.810 0.832 0.0
13785469662 phosphoenolpyruvate carboxykinase [Flave 0.946 0.805 0.826 0.0
13785467662 phosphoenolpyruvate carboxykinase [Flave 0.937 0.797 0.824 0.0
224067088 666 predicted protein [Populus trichocarpa] 0.937 0.792 0.822 0.0
350538279662 phosphoenolpyruvate carboxykinase [Solan 0.941 0.800 0.816 0.0
224097184 664 predicted protein [Populus trichocarpa] 0.939 0.796 0.812 0.0
255537864661 Phosphoenolpyruvate carboxykinase [ATP], 0.923 0.786 0.830 0.0
413956284659 hypothetical protein ZEAMMB73_030639 [Ze 0.927 0.792 0.818 0.0
>gi|356496541|ref|XP_003517125.1| PREDICTED: phosphoenolpyruvate carboxykinase [ATP]-like [Glycine max] Back     alignment and taxonomy information
 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/560 (84%), Positives = 494/560 (88%), Gaps = 26/560 (4%)

Query: 1   MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRS 60
           MA+NGNG  + G G+AR GLAKIQT   QKK   ICHDDS P VKAQTIDELHSLQKK+S
Sbjct: 1   MASNGNGSVANGNGSARNGLAKIQT---QKKHDGICHDDSGPTVKAQTIDELHSLQKKKS 57

Query: 61  APNTPIKGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAA 120
           AP TP+ G Q  F+ L++E R KQQLQSISASLASLTRETGPK+V+GDPARK++T K   
Sbjct: 58  APTTPVTGFQAPFATLTEEERHKQQLQSISASLASLTRETGPKLVKGDPARKSDTQKVTH 117

Query: 121 DPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKT 180
               H   TPTI VSDSSLKFTHVLYNLSPAELYEQAIKYE+GSFI S+GALATLSGAKT
Sbjct: 118 V--HHHVSTPTIVVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKT 175

Query: 181 GRSPRDKRVVKDETTEHELWWGK------MKNHDV---------------QVFVNDQFLN 219
           GRSPRDKRVVKD+ TE+ELWWGK      M  H                 +VFVNDQFLN
Sbjct: 176 GRSPRDKRVVKDDLTENELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLN 235

Query: 220 WDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMT 279
           WD +NR+KVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMT
Sbjct: 236 WDTENRIKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMT 295

Query: 280 SSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALF 339
           SSTSIDLNLARREMVILGTQYAGEMKKGLF VMHYLMPKRQILSLHSGCNMGKDGDVALF
Sbjct: 296 SSTSIDLNLARREMVILGTQYAGEMKKGLFGVMHYLMPKRQILSLHSGCNMGKDGDVALF 355

Query: 340 FGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKF 399
           FGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI+F
Sbjct: 356 FGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIRF 415

Query: 400 GAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFG 459
           G VLENVVFDEH REVDYSDKSVTENTRAAYPIEYIPNAK+PCVGPHPKNVILLACDAFG
Sbjct: 416 GTVLENVVFDEHDREVDYSDKSVTENTRAAYPIEYIPNAKLPCVGPHPKNVILLACDAFG 475

Query: 460 VLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLA 519
           VLPPVSKLNLAQTMYHFISGYTALVAGTE+GIKEP ATFSACFGAAFIMLHPTKYAAMLA
Sbjct: 476 VLPPVSKLNLAQTMYHFISGYTALVAGTEEGIKEPQATFSACFGAAFIMLHPTKYAAMLA 535

Query: 520 EKMQKHGATGWLVNTGWSGG 539
           EKMQKHGATGWLVNTGWS G
Sbjct: 536 EKMQKHGATGWLVNTGWSAG 555

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class: N/A

Phylum: Streptophyta

Superkingdom:

>gi|356531401|ref|XP_003534266.1| PREDICTED: phosphoenolpyruvate carboxykinase [ATP]-like [Glycine max] Back     alignment and taxonomy information
>gi|13785471|dbj|BAB43909.1| phosphoenolpyruvate carboxykinase [Flaveria pringlei] Back     alignment and taxonomy information
>gi|13785469|dbj|BAB43908.1| phosphoenolpyruvate carboxykinase [Flaveria trinervia] Back     alignment and taxonomy information
>gi|13785467|dbj|BAB43907.1| phosphoenolpyruvate carboxykinase [Flaveria trinervia] Back     alignment and taxonomy information
>gi|224067088|ref|XP_002302349.1| predicted protein [Populus trichocarpa] gi|222844075|gb|EEE81622.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|350538279|ref|NP_001234079.1| phosphoenolpyruvate carboxykinase [Solanum lycopersicum] gi|16950587|gb|AAG01894.2| phosphoenolpyruvate carboxykinase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|224097184|ref|XP_002310867.1| predicted protein [Populus trichocarpa] gi|222853770|gb|EEE91317.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537864|ref|XP_002509997.1| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis] gi|223550698|gb|EEF52184.1| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis] Back     alignment and taxonomy information
>gi|413956284|gb|AFW88933.1| hypothetical protein ZEAMMB73_030639 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
TAIR|locus:2137594671 PCK1 "phosphoenolpyruvate carb 0.586 0.491 0.9 6.5e-223
TAIR|locus:504954890670 PCK2 "phosphoenolpyruvate carb 0.586 0.492 0.875 5e-214
DICTYBASE|DDB_G0271678562 pckA "phosphoenolpyruvate carb 0.593 0.594 0.633 2.3e-133
CGD|CAL0006389553 PCK1 [Candida albicans (taxid: 0.611 0.622 0.618 4.8e-131
UNIPROTKB|Q5AAH5553 PCK1 "Putative uncharacterized 0.611 0.622 0.618 4.8e-131
ASPGD|ASPL0000045947600 acuF [Emericella nidulans (tax 0.609 0.571 0.589 2.1e-126
SGD|S000001805549 PCK1 "Phosphoenolpyruvate carb 0.621 0.637 0.584 2.1e-124
TIGR_CMR|BA_5019528 BA_5019 "phosphoenolpyruvate c 0.600 0.640 0.494 1.4e-93
UNIPROTKB|P22259540 pck [Escherichia coli K-12 (ta 0.632 0.659 0.469 1.5e-89
TIGR_CMR|CPS_4595536 CPS_4595 "phosphoenolpyruvate 0.623 0.654 0.473 1.9e-89
TAIR|locus:2137594 PCK1 "phosphoenolpyruvate carboxykinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1623 (576.4 bits), Expect = 6.5e-223, Sum P(2) = 6.5e-223
 Identities = 297/330 (90%), Positives = 308/330 (93%)

Query:   210 QVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQF 269
             +VFVNDQ+LNWDP+NR+KVRIVSARAYHSLFMHNMCIRPT EELE+FGTPDFTIYNAGQF
Sbjct:   238 KVFVNDQYLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTQEELESFGTPDFTIYNAGQF 297

Query:   270 PCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCN 329
             PCNRYTHYMTSSTS+DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKR+ILSLHSGCN
Sbjct:   298 PCNRYTHYMTSSTSVDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCN 357

Query:   330 MGKDGDVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREK 389
             MGKDGDVA               DHNRYLIGDDEHCW + GVSNIEGGCYAKC+DLSREK
Sbjct:   358 MGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREK 417

Query:   390 EPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKN 449
             EPDIWNAIKFG VLENVVFDEHTREVDYSDKSVTENTRAAYPIE+IPNAKIPCVGPHP N
Sbjct:   418 EPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVTENTRAAYPIEFIPNAKIPCVGPHPTN 477

Query:   450 VILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIML 509
             VILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIML
Sbjct:   478 VILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIML 537

Query:   510 HPTKYAAMLAEKMQKHGATGWLVNTGWSGG 539
             HPTKYAAMLAEKM+  GATGWLVNTGWSGG
Sbjct:   538 HPTKYAAMLAEKMKSQGATGWLVNTGWSGG 567
GO:0004611 "phosphoenolpyruvate carboxykinase activity" evidence=IEA
GO:0004612 "phosphoenolpyruvate carboxykinase (ATP) activity" evidence=IEA;ISS;IMP
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006094 "gluconeogenesis" evidence=IEA;ISS
GO:0017076 "purine nucleotide binding" evidence=IEA
GO:0005730 "nucleolus" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0016036 "cellular response to phosphate starvation" evidence=IEP
GO:0016020 "membrane" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009817 "defense response to fungus, incompatible interaction" evidence=IDA
TAIR|locus:504954890 PCK2 "phosphoenolpyruvate carboxykinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271678 pckA "phosphoenolpyruvate carboxykinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0006389 PCK1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AAH5 PCK1 "Putative uncharacterized protein PCK1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000045947 acuF [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000001805 PCK1 "Phosphoenolpyruvate carboxykinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5019 BA_5019 "phosphoenolpyruvate carboxykinase (ATP)" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P22259 pck [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4595 CPS_4595 "phosphoenolpyruvate carboxykinase (ATP)" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XFA2PCKA2_UROPA4, ., 1, ., 1, ., 4, 90.75660.86670.7795N/Ano
Q9T074PCKA_ARATH4, ., 1, ., 1, ., 4, 90.81090.94490.7928yesno
Q72VT0PCKA_LEPIC4, ., 1, ., 1, ., 4, 90.50560.74060.7867yesno
P42066PCKA_CUCSA4, ., 1, ., 1, ., 4, 90.78770.93600.7865N/Ano
Q8R943PCKA_THETN4, ., 1, ., 1, ., 4, 90.50230.72460.7831yesno
O43112PCKA_KLULA4, ., 1, ., 1, ., 4, 90.58070.73530.7624yesno
Q9K7Q7PCKA_BACHD4, ., 1, ., 1, ., 4, 90.50350.69980.7476yesno
Q2S008PCKA2_SALRD4, ., 1, ., 1, ., 4, 90.61110.70150.7452yesno
Q753M0PCKA_ASHGO4, ., 1, ., 1, ., 4, 90.57730.71750.7467yesno
Q75JD5PCKA_DICDI4, ., 1, ., 1, ., 4, 90.57800.77440.7758yesno
P49292PCKA1_UROPA4, ., 1, ., 1, ., 4, 90.75520.85960.7756N/Ano
Q8F9E4PCKA_LEPIN4, ., 1, ., 1, ., 4, 90.50560.74060.7867yesno
Q96UL8PCKA_EMENI4, ., 1, ., 1, ., 4, 90.58670.72640.6816yesno
Q9SLZ0PCKA_MAIZE4, ., 1, ., 1, ., 4, 90.78210.92360.7807N/Ano
Q6FRR0PCKA_CANGA4, ., 1, ., 1, ., 4, 90.58650.73710.7628yesno
P10963PCKA_YEAST4, ., 1, ., 1, ., 4, 90.57200.73170.7504yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.490.991
3rd Layer4.1.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
PLN02597555 PLN02597, PLN02597, phosphoenolpyruvate carboxykin 0.0
cd00484508 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykin 0.0
PTZ00311561 PTZ00311, PTZ00311, phosphoenolpyruvate carboxykin 0.0
pfam01293467 pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxyk 0.0
PRK09344526 PRK09344, PRK09344, phosphoenolpyruvate carboxykin 0.0
COG1866529 COG1866, PckA, Phosphoenolpyruvate carboxykinase ( 0.0
TIGR00224532 TIGR00224, pckA, phosphoenolpyruvate carboxykinase 0.0
cd01919515 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase 1e-144
cd00820107 cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxyki 9e-12
>gnl|CDD|178207 PLN02597, PLN02597, phosphoenolpyruvate carboxykinase [ATP] Back     alignment and domain information 
 Score =  913 bits (2362), Expect = 0.0
 Identities = 394/460 (85%), Positives = 405/460 (88%), Gaps = 29/460 (6%)

Query: 102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYE 161
           PKVVRGDPARK E P             PTI VSDS LKFTHVLYNLSPAELYEQAIKYE
Sbjct: 1   PKVVRGDPARKKEPP--------KSVVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYE 52

Query: 162 QGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK------MKNHDV------ 209
           +GSFI S+GALATLSGAKTGRSP+DKRVV+DETTE ELWWGK      M           
Sbjct: 53  KGSFITSTGALATLSGAKTGRSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRER 112

Query: 210 ---------QVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPD 260
                    +VFVNDQFLNWDP+NR+KVRIVSARAYHSLFMHNMCIRPTPEELE+FGTPD
Sbjct: 113 AVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPD 172

Query: 261 FTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ 320
           FTIYNAGQFPCNRYTHYMTSSTSIDLNL R+EMVILGTQYAGEMKKGLFS+MHYLMP R 
Sbjct: 173 FTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG 232

Query: 321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYA 380
           ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTD NRYLIGDDEHCW DNGVSNIEGGCYA
Sbjct: 233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYA 292

Query: 381 KCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKI 440
           KCIDLS EKEPDIWNAIKFG VLENVVFDEHTREVDYSDKSVTENTRA+YPIEYIPNAKI
Sbjct: 293 KCIDLSEEKEPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKI 352

Query: 441 PCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSA 500
           PCVGPHPKNVILLACDAFGVLPPVSKL LAQTMYHFISGYTALVAGTEDGIKEPTATFSA
Sbjct: 353 PCVGPHPKNVILLACDAFGVLPPVSKLTLAQTMYHFISGYTALVAGTEDGIKEPTATFSA 412

Query: 501 CFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGR 540
           CFGAAFIMLHPTKYAAMLAEKMQKHGAT WLVNTGWSGG 
Sbjct: 413 CFGAAFIMLHPTKYAAMLAEKMQKHGATAWLVNTGWSGGS 452

Length = 555
>gnl|CDD|238270 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>gnl|CDD|185549 PTZ00311, PTZ00311, phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>gnl|CDD|216417 pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxykinase Back     alignment and domain information
>gnl|CDD|236471 PRK09344, PRK09344, phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>gnl|CDD|224779 COG1866, PckA, Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161774 TIGR00224, pckA, phosphoenolpyruvate carboxykinase (ATP) Back     alignment and domain information
>gnl|CDD|238900 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>gnl|CDD|238418 cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 563
PLN02597555 phosphoenolpyruvate carboxykinase [ATP] 100.0
cd00484508 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK 100.0
PTZ00311561 phosphoenolpyruvate carboxykinase; Provisional 100.0
COG1866529 PckA Phosphoenolpyruvate carboxykinase (ATP) [Ener 100.0
TIGR00224532 pckA phosphoenolpyruvate carboxykinase (ATP). Invo 100.0
PF01293466 PEPCK_ATP: Phosphoenolpyruvate carboxykinase The P 100.0
PRK09344526 phosphoenolpyruvate carboxykinase; Provisional 100.0
cd01919515 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a 100.0
cd00819579 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK 99.96
PRK04210601 phosphoenolpyruvate carboxykinase; Provisional 99.96
PF00821586 PEPCK: Phosphoenolpyruvate carboxykinase; InterPro 99.94
COG1274608 PckA Phosphoenolpyruvate carboxykinase (GTP) [Ener 99.87
KOG3749640 consensus Phosphoenolpyruvate carboxykinase [Energ 99.23
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.66
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 97.54
PF07475171 Hpr_kinase_C: HPr Serine kinase C-terminal domain; 97.1
TIGR00679304 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene 96.78
COG1493308 HprK Serine kinase of the HPr protein, regulates c 96.58
PRK05428308 HPr kinase/phosphorylase; Provisional 96.34
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 95.2
PRK06217183 hypothetical protein; Validated 95.0
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.47
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 94.41
PF1355562 AAA_29: P-loop containing region of AAA domain 94.31
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.99
PRK07261171 topology modulation protein; Provisional 93.92
smart00382148 AAA ATPases associated with a variety of cellular 93.84
COG4148352 ModC ABC-type molybdate transport system, ATPase c 93.68
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.62
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.61
COG1117253 PstB ABC-type phosphate transport system, ATPase c 93.58
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.57
PRK08118167 topology modulation protein; Reviewed 93.41
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.36
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 93.25
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 93.04
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 93.03
COG4136213 ABC-type uncharacterized transport system, ATPase 93.02
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 92.99
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 92.9
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.9
PRK09825176 idnK D-gluconate kinase; Provisional 92.82
PRK00300205 gmk guanylate kinase; Provisional 92.76
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 92.76
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 92.76
COG4181228 Predicted ABC-type transport system involved in ly 92.69
TIGR00235207 udk uridine kinase. Model contains a number of lon 92.69
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 92.63
PRK05541176 adenylylsulfate kinase; Provisional 92.52
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.52
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 92.47
PRK08233182 hypothetical protein; Provisional 92.44
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.32
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 92.23
COG3842352 PotA ABC-type spermidine/putrescine transport syst 92.21
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.1
PRK00131175 aroK shikimate kinase; Reviewed 91.89
PRK00889175 adenylylsulfate kinase; Provisional 91.84
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.77
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 91.69
COG4525259 TauB ABC-type taurine transport system, ATPase com 91.67
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 91.65
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 91.37
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 91.36
PF00005137 ABC_tran: ABC transporter This structure is on hol 91.31
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 91.25
PRK05480209 uridine/cytidine kinase; Provisional 91.23
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 91.22
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.17
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 91.07
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 90.97
COG4619223 ABC-type uncharacterized transport system, ATPase 90.96
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 90.96
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 90.95
PRK06762166 hypothetical protein; Provisional 90.89
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 90.87
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 90.87
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 90.78
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 90.77
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 90.71
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 90.67
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 90.67
cd03269210 ABC_putative_ATPase This subfamily is involved in 90.65
COG4988559 CydD ABC-type transport system involved in cytochr 90.65
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 90.61
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 90.6
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 90.59
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 90.57
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 90.54
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 90.49
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 90.45
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 90.39
PRK03846198 adenylylsulfate kinase; Provisional 90.39
PF00004132 AAA: ATPase family associated with various cellula 90.38
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 90.34
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 90.34
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 90.29
KOG4238 627 consensus Bifunctional ATP sulfurylase/adenosine 5 90.27
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 90.22
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 90.2
COG3638258 ABC-type phosphate/phosphonate transport system, A 90.18
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.11
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 90.11
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.09
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 90.09
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 90.07
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 90.04
PRK14527191 adenylate kinase; Provisional 90.02
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 90.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 90.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 89.99
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 89.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 89.95
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 89.92
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 89.91
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 89.88
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 89.88
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 89.86
PRK10790592 putative multidrug transporter membrane\ATP-bindin 89.81
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 89.8
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 89.77
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 89.73
PF13479213 AAA_24: AAA domain 89.7
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 89.7
cd03246173 ABCC_Protease_Secretion This family represents the 89.68
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 89.68
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 89.67
COG1341398 Predicted GTPase or GTP-binding protein [General f 89.66
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 89.63
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 89.62
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 89.6
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 89.49
PRK10908222 cell division protein FtsE; Provisional 89.48
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 89.47
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 89.46
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 89.44
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 89.43
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 89.42
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 89.32
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 89.3
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 89.23
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 89.22
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 89.16
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 89.15
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 89.12
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 89.1
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 89.09
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 89.09
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 89.09
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 89.06
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 89.04
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 89.04
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 89.03
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 89.01
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 88.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 88.95
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 88.94
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 88.93
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 88.91
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 88.88
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 88.84
PRK14738206 gmk guanylate kinase; Provisional 88.81
cd03215182 ABC_Carb_Monos_II This family represents domain II 88.8
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 88.79
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 88.78
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 88.76
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 88.73
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 88.7
PRK14241258 phosphate transporter ATP-binding protein; Provisi 88.67
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 88.66
PRK06547172 hypothetical protein; Provisional 88.58
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 88.58
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 88.54
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 88.53
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 88.53
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 88.5
PRK14242253 phosphate transporter ATP-binding protein; Provisi 88.49
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 88.48
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 88.47
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 88.45
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 88.43
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 88.43
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 88.43
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 88.38
TIGR02237209 recomb_radB DNA repair and recombination protein R 88.35
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 88.33
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 88.31
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 88.31
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 88.26
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 88.26
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 88.22
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 88.21
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 88.21
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 88.2
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 88.18
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 88.16
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 88.15
PRK14239252 phosphate transporter ATP-binding protein; Provisi 88.14
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 88.14
PTZ00301210 uridine kinase; Provisional 88.13
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 88.12
PRK09183259 transposase/IS protein; Provisional 88.08
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 88.07
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 88.02
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 88.02
PRK00698205 tmk thymidylate kinase; Validated 88.01
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 87.98
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 87.96
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 87.96
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 87.96
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 87.95
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 87.94
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 87.91
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 87.91
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 87.9
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 87.9
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 87.89
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 87.88
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 87.87
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 87.85
PRK14240250 phosphate transporter ATP-binding protein; Provisi 87.77
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 87.72
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 87.71
PRK03839180 putative kinase; Provisional 87.7
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 87.67
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 87.66
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 87.62
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 87.61
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 87.61
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 87.6
CHL00181287 cbbX CbbX; Provisional 87.56
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 87.52
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 87.51
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 87.5
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 87.5
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 87.49
PRK14530215 adenylate kinase; Provisional 87.47
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 87.45
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 87.42
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 87.42
PRK06696223 uridine kinase; Validated 87.41
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 87.39
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 87.37
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 87.37
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 87.34
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 87.34
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 87.33
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 87.31
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 87.31
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 87.3
PRK10619257 histidine/lysine/arginine/ornithine transporter su 87.29
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 87.25
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 87.24
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 87.23
PRK09984262 phosphonate/organophosphate ester transporter subu 87.21
cd03234226 ABCG_White The White subfamily represents ABC tran 87.2
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 87.19
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 87.17
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 87.14
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 87.07
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 87.06
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 87.06
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 87.04
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 87.03
PRK14238271 phosphate transporter ATP-binding protein; Provisi 87.03
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 87.02
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 87.02
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 87.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 86.99
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 86.97
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 86.97
PRK11545163 gntK gluconate kinase 1; Provisional 86.97
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 86.95
PRK10253265 iron-enterobactin transporter ATP-binding protein; 86.94
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 86.94
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 86.94
PRK14531183 adenylate kinase; Provisional 86.91
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 86.9
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 86.87
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 86.84
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 86.83
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 86.78
PRK09580248 sufC cysteine desulfurase ATPase component; Review 86.75
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 86.74
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 86.72
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 86.71
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 86.71
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 86.69
PRK14235267 phosphate transporter ATP-binding protein; Provisi 86.69
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 86.68
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 86.63
COG1127263 Ttg2A ABC-type transport system involved in resist 86.58
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 86.55
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 86.54
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 86.54
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.47
PRK08533230 flagellar accessory protein FlaH; Reviewed 86.47
PRK14243264 phosphate transporter ATP-binding protein; Provisi 86.44
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 86.42
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 86.37
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 86.34
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 86.24
PRK11153343 metN DL-methionine transporter ATP-binding subunit 86.23
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 86.22
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 86.2
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 86.16
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 86.12
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 86.11
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 86.1
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 86.08
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 86.08
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 86.08
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 86.04
PRK09473330 oppD oligopeptide transporter ATP-binding componen 86.03
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 86.01
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 86.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 85.95
cd01394218 radB RadB. The archaeal protein radB shares simila 85.94
COG4618580 ArpD ABC-type protease/lipase transport system, AT 85.88
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 85.88
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 85.87
PRK03695248 vitamin B12-transporter ATPase; Provisional 85.83
COG4161242 ArtP ABC-type arginine transport system, ATPase co 85.82
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 85.8
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 85.77
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 85.76
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 85.75
PRK14236272 phosphate transporter ATP-binding protein; Provisi 85.73
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 85.72
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 85.7
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 85.66
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 85.63
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 85.63
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 85.62
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 85.61
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 85.61
PRK13975196 thymidylate kinase; Provisional 85.58
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 85.45
PRK14737186 gmk guanylate kinase; Provisional 85.44
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 85.35
PRK05057172 aroK shikimate kinase I; Reviewed 85.23
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 85.23
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 85.19
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 85.16
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 85.14
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 85.13
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 85.08
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 85.04
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 85.03
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 85.03
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 85.02
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 85.01
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 84.99
PRK02496184 adk adenylate kinase; Provisional 84.98
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 84.98
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 84.94
PRK14532188 adenylate kinase; Provisional 84.93
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 84.87
PRK09361225 radB DNA repair and recombination protein RadB; Pr 84.79
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 84.78
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 84.77
cd03299235 ABC_ModC_like Archeal protein closely related to M 84.76
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 84.75
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 84.73
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 84.7
PRK08356195 hypothetical protein; Provisional 84.68
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 84.6
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 84.59
cd01393226 recA_like RecA is a bacterial enzyme which has rol 84.54
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 84.5
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 84.42
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 84.37
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 84.36
PRK06893229 DNA replication initiation factor; Validated 84.32
PRK13546264 teichoic acids export protein ATP-binding subunit; 84.31
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 84.27
PRK08084235 DNA replication initiation factor; Provisional 84.26
PRK12339197 2-phosphoglycerate kinase; Provisional 84.24
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 84.23
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 84.18
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 84.17
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 84.16
PHA02530300 pseT polynucleotide kinase; Provisional 84.11
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 84.08
PHA00729226 NTP-binding motif containing protein 84.02
PRK04040188 adenylate kinase; Provisional 83.97
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 83.88
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 83.87
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 83.68
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 83.65
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 83.63
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 83.61
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 83.6
PF05729166 NACHT: NACHT domain 83.54
PRK01184184 hypothetical protein; Provisional 83.53
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 83.46
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 83.42
PRK10938 490 putative molybdenum transport ATP-binding protein 83.41
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 83.38
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 83.31
PRK10522547 multidrug transporter membrane component/ATP-bindi 83.28
PRK06620214 hypothetical protein; Validated 83.27
PRK06526254 transposase; Provisional 83.2
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 83.2
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 83.19
COG2255332 RuvB Holliday junction resolvasome, helicase subun 83.14
cd01128249 rho_factor Transcription termination factor rho is 83.05
PRK13947171 shikimate kinase; Provisional 83.04
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 82.91
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 82.89
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 82.86
COG1123539 ATPase components of various ABC-type transport sy 82.86
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 82.82
PRK13537306 nodulation ABC transporter NodI; Provisional 82.8
TIGR00231161 small_GTP small GTP-binding protein domain. This m 82.8
PRK12288347 GTPase RsgA; Reviewed 82.77
PRK09700510 D-allose transporter ATP-binding protein; Provisio 82.77
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 82.77
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 82.75
PF09439181 SRPRB: Signal recognition particle receptor beta s 82.6
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 82.57
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 82.49
PF00025175 Arf: ADP-ribosylation factor family The prints ent 82.49
PRK08903227 DnaA regulatory inactivator Hda; Validated 82.46
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 82.43
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 82.41
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 82.35
PRK10938490 putative molybdenum transport ATP-binding protein 82.33
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 82.3
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 82.28
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 82.25
PF13173128 AAA_14: AAA domain 82.22
PRK03731171 aroL shikimate kinase II; Reviewed 82.21
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 82.18
PRK09270229 nucleoside triphosphate hydrolase domain-containin 82.17
CHL00095821 clpC Clp protease ATP binding subunit 82.16
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 82.1
PRK07667193 uridine kinase; Provisional 82.08
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 82.05
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 82.03
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 82.02
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 81.83
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 81.82
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 81.81
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 81.78
PRK04182180 cytidylate kinase; Provisional 81.76
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 81.76
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 81.75
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 81.73
cd00876160 Ras Ras family. The Ras family of the Ras superfam 81.72
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 81.71
PRK09087226 hypothetical protein; Validated 81.68
cd04123162 Rab21 Rab21 subfamily. The localization and functi 81.46
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 81.4
COG1100219 GTPase SAR1 and related small G proteins [General 81.4
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 81.37
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 81.37
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 81.35
PRK15064 530 ABC transporter ATP-binding protein; Provisional 81.33
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 81.32
PRK14528186 adenylate kinase; Provisional 81.27
PRK15453290 phosphoribulokinase; Provisional 81.24
PRK10762501 D-ribose transporter ATP binding protein; Provisio 81.21
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 81.16
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 81.09
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 81.06
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 81.05
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 81.0
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 80.98
TIGR02236310 recomb_radA DNA repair and recombination protein R 80.97
PRK13536340 nodulation factor exporter subunit NodI; Provision 80.95
PRK13946184 shikimate kinase; Provisional 80.9
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 80.89
PRK15064530 ABC transporter ATP-binding protein; Provisional 80.86
cd01124187 KaiC KaiC is a circadian clock protein primarily f 80.78
PRK10416318 signal recognition particle-docking protein FtsY; 80.64
PRK10789569 putative multidrug transporter membrane\ATP-bindin 80.58
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 80.55
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 80.52
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 80.51
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 80.39
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 80.36
TIGR02012321 tigrfam_recA protein RecA. This model describes or 80.25
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 80.24
PRK11288501 araG L-arabinose transporter ATP-binding protein; 80.22
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 80.11
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 80.11
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 80.08
PRK10261 623 glutathione transporter ATP-binding protein; Provi 80.07
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 80.04
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 80.02
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 80.02
>PLN02597 phosphoenolpyruvate carboxykinase [ATP] Back     alignment and domain information 
Probab=100.00  E-value=2e-155  Score=1244.88  Aligned_cols=440  Identities=90%  Similarity=1.417  Sum_probs=425.0

Q ss_pred             CccccCCCCCcCCCCCCCCCCCCCCCCCcccchhccCcccceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCccc
Q 008523          102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTG  181 (563)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~g~~~~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TG  181 (563)
                      |+|+.|||..+..+++.        .-++...+..+|+...+|+||++++||||+|+++++|++++++|+|+++||++||
T Consensus         1 ~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~v~~nl~~~~Lye~Al~~~eG~l~~~~GaL~v~TGk~TG   72 (555)
T PLN02597          1 PKVVRGDPARKKEPPKS--------VVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG   72 (555)
T ss_pred             CccccCCccccCcCccc--------ccccccccccccCCcceEEeCCCHHHHHHHHHHhCCCeEEecCCCEEecCCCcCC
Confidence            78999999887765543        4667788999999999999999999999999999999877779999999999999


Q ss_pred             CCCCCeeeecCCCccccccccC------cCccc---------------ccEEEEEeeecCCCCCeeEEEEEcccccHHHH
Q 008523          182 RSPRDKRVVKDETTEHELWWGK------MKNHD---------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLF  240 (563)
Q Consensus       182 RSpkdk~IV~d~~~~~~i~wg~------~~e~~---------------~~lyv~d~~~G~d~~~~i~vrvit~~a~~alf  240 (563)
                      |||+|||||+|+.++++||||+      |++++               ++|||+|+|+|+||+||++||+|++.|||+||
T Consensus        73 RSP~DKfIV~d~~t~~~iwWg~g~vN~p~~~~~f~~l~~~~~~~l~~~~~lfv~D~~~Gad~~~r~~vRvite~aw~alF  152 (555)
T PLN02597         73 RSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRERAVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLF  152 (555)
T ss_pred             CCcccceecCCCCcccceeccCCccCccCCHHHHHHHHHHHHHHHccCCCEEEEeeeeccCccceeeEEEEeCHHHHHHH
Confidence            9999999999999999999964      44432               46999999999999999999999999999999


Q ss_pred             HhccCcCCChHhhccCCCCCEEEEEcCCCCCCccccCCCCccEEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCc
Q 008523          241 MHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ  320 (563)
Q Consensus       241 ~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~~g~~s~~~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G  320 (563)
                      ++|||+||+.+|++.|++||||||++|+|+++++.||++|+++|++|+++++++|+||+|+|||||++||+|||+|+++|
T Consensus       153 ~~nmfirP~~~el~~f~~PdftIi~ap~f~a~~~~~g~~Se~~i~in~~~~~~lI~GT~YaGE~KK~iFs~~~~ll~~rg  232 (555)
T PLN02597        153 MHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG  232 (555)
T ss_pred             HHhcCCCCChHHhccCCCCCEEEEeCCCCCCCccccCCCCCcEEEEEccCCeEEEEccchhhhhHHHHHHHHHHHHHHCC
Confidence            99999999999999998999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhcccc
Q 008523          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFG  400 (563)
Q Consensus       321 ~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~  400 (563)
                      +|+||||||++.+|++++|||||||||||||+|++|.||+||||+|+++||||||||||||||+|++|+||+||+|++|+
T Consensus       233 ~l~mHasaNv~~~g~~~lffGlSGtGKTTLsad~~~~li~DDEHgW~~~GVfNfEGGCYAK~i~Ls~e~EPeI~~Ai~fg  312 (555)
T PLN02597        233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSEEKEPDIWNAIKFG  312 (555)
T ss_pred             cEeecCeeccCCCCcEEEEEecCCCCccceecCCCCceeecccccccCCceEeecCceEEEecCCCcccchHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHccc
Q 008523          401 AVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGY  480 (563)
Q Consensus       401 ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGy  480 (563)
                      +|||||++|++++.|||+|.++|||||++|||++|+|+++|++++||++|||||||||||||||+|||+|||||||||||
T Consensus       313 avLENVv~d~~~~~~df~D~s~TeNtR~aYPi~~I~na~~p~~~~hP~~IifLT~DAfGVlPPvskLt~eQA~yhFlsGy  392 (555)
T PLN02597        313 TVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLTLAQTMYHFISGY  392 (555)
T ss_pred             ceEEeeEECCCCCccCCcCCcccccceEEeEHHhccccCCCccCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHhcc
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCccCccccccccccCCCccCChHHHHHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          481 TALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       481 Tak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      |||+||||+|++||+||||+|||+||||+||.+||+||++||++|+++||||||||+||+||+|+||++
T Consensus       393 TakvAGTE~Gv~ep~~tFS~CFG~PFl~l~P~~Ya~~L~eki~~~~~~vyLvNTGw~GG~yg~G~Ri~l  461 (555)
T PLN02597        393 TALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATAWLVNTGWSGGSYGVGKRMSL  461 (555)
T ss_pred             eeccccccCCCCCCcccchhccCCCCcCCCHHHHHHHHHHHHHHcCCCEEEEecCccCCCCCCcceech
Confidence            999999999999999999999999999999999999999999999999999999999999999999998

>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion] Back     alignment and domain information
>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP) Back     alignment and domain information
>PF01293 PEPCK_ATP: Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region; InterPro: IPR001272 Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate Back     alignment and domain information
>PRK09344 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>PF00821 PEPCK: Phosphoenolpyruvate carboxykinase; InterPro: IPR008209 Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate Back     alignment and domain information
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion] Back     alignment and domain information
>KOG3749 consensus Phosphoenolpyruvate carboxykinase [Energy production and conversion] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase Back     alignment and domain information
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK05428 HPr kinase/phosphorylase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
1ii2_A524 Crystal Structure Of Phosphoenolpyruvate Carboxykin 1e-101
1ayl_A541 Phosphoenolpyruvate Carboxykinase Length = 541 1e-94
1k3c_A540 Phosphoenolpyruvate Carboxykinase In Complex With A 2e-94
2py7_X540 Crystal Structure Of E. Coli Phosphoenolpyruvate Ca 7e-94
1yvy_A532 Crystal Strucutre Of Anaerobiospirillum Succinicipr 2e-92
1oen_A540 Phosphoenolpyruvate Carboxykinase Length = 540 9e-92
1j3b_A529 Crystal Structure Of Atp-dependent Phosphoenolpyruv 2e-91
1ygg_A560 Crystal Structure Of Phosphoenolpyruvate Carboxykin 3e-90
>pdb|1II2|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase (Pepck) From Trypanosoma Cruzi Length = 524 Back     alignment and structure 
Iteration: 1

 Score =  365 bits (938), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/415 (45%), Positives = 246/415 (59%), Gaps = 20/415 (4%)
Query: 147 NLSPAELYEQAIKYEQGSFIXXXXXXXXXXXXKTGRSPRDKRVVKDETTEHELWWGKMK- 205
           NL   EL + A+K E+ S +            KTGRSP DKR+V  +     + WGK+  
Sbjct: 7   NLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNM 66
Query: 206 ------------------NHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIR 247
                             +    +FV D F   D + R+KVR+ + R YH+LFM +M I 
Sbjct: 67  KLSEESFARVRKIAKEFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIV 126
Query: 248 PTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKG 307
           PTPEEL  FG PD+ IYNAG+   +     +TS+T + LN   RE VILGT+YAGEMKKG
Sbjct: 127 PTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGEMKKG 186
Query: 308 LFSVMHYLMPKRQILSLHSGCNMGKDGDVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWG 367
           + +VM  LMP+   L +H+  N+GK GDV                D +R LIGDDEH W 
Sbjct: 187 ILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWT 246
Query: 368 DNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTR 427
           D GV NIEGGCYAK I L+ + E DI++A++FGAV EN V D+ T E+D+ D+S+ +NTR
Sbjct: 247 DRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTR 306
Query: 428 AAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGT 487
            AYP+ +I  A    +  HPKNVI L  DAFGV+PPV++L  AQ M+ F+ GYTA V G 
Sbjct: 307 VAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGV 366
Query: 488 E-DGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRC 541
           E  G +     FS+CFG  F++ H T Y   LAEKMQKH +  WL+NTG++GGR 
Sbjct: 367 EAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGRA 421
>pdb|1AYL|A Chain A, Phosphoenolpyruvate Carboxykinase Length = 541 Back     alignment and structure
>pdb|1K3C|A Chain A, Phosphoenolpyruvate Carboxykinase In Complex With Adp, Alf3 And Pyruvate Length = 540 Back     alignment and structure
>pdb|2PY7|X Chain X, Crystal Structure Of E. Coli Phosphoenolpyruvate Carboxykinase Mutant Lys213ser Complexed With Atp-mg2+-mn2+ Length = 540 Back     alignment and structure
>pdb|1YVY|A Chain A, Crystal Strucutre Of Anaerobiospirillum Succiniciproducens Phosphoenolpyruvate Carboxykinase Length = 532 Back     alignment and structure
>pdb|1OEN|A Chain A, Phosphoenolpyruvate Carboxykinase Length = 540 Back     alignment and structure
>pdb|1J3B|A Chain A, Crystal Structure Of Atp-dependent Phosphoenolpyruvate Carboxykinase From Thermus Thermophilus Hb8 Length = 529 Back     alignment and structure
>pdb|1YGG|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase From Actinobacillus Succinogenes Length = 560 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
1ii2_A524 Phosphoenolpyruvate carboxykinase; phosphate bindi 0.0
1j3b_A529 ATP-dependent phosphoenolpyruvate carboxykinase; a 0.0
1ytm_A532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 0.0
2olr_A540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 0.0
3moe_A624 Phosphoenolpyruvate carboxykinase, cytosolic [GTP; 2e-17
2faf_A 608 Phosphoenolpyruvate carboxykinase; pepck, phosphor 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Length = 524 Back     alignment and structure
 Score =  710 bits (1835), Expect = 0.0
 Identities = 207/418 (49%), Positives = 269/418 (64%), Gaps = 22/418 (5%)

Query: 144 VLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK 203
           +  NL   EL + A+K E+ S + + GALA +S AKTGRSP DKR+V  +     + WGK
Sbjct: 4   IHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGK 63

Query: 204 --------------------MKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHN 243
                               +   +  +FV D F   D + R+KVR+ + R YH+LFM +
Sbjct: 64  VNMKLSEESFARVRKIAKEFLDTRE-HLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRD 122

Query: 244 MCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGE 303
           M I PTPEEL  FG PD+ IYNAG+   +     +TS+T + LN   RE VILGT+YAGE
Sbjct: 123 MLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTTCVALNFKTREQVILGTEYAGE 182

Query: 304 MKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDE 363
           MKKG+ +VM  LMP+   L +H+  N+GK GDV +FFGLSGTGKTTLS D +R LIGDDE
Sbjct: 183 MKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDE 242

Query: 364 HCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVT 423
           H W D GV NIEGGCYAK I L+ + E DI++A++FGAV EN V D+ T E+D+ D+S+ 
Sbjct: 243 HVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESIC 302

Query: 424 ENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTAL 483
           +NTR AYP+ +I  A    +  HPKNVI L  DAFGV+PPV++L  AQ M+ F+ GYTA 
Sbjct: 303 KNTRVAYPLSHIEGALSKAIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTAN 362

Query: 484 VAGTEDGI-KEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGR 540
           V G E G  +     FS+CFG  F++ H T Y   LAEKMQKH +  WL+NTG++GGR
Sbjct: 363 VPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGR 420
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Length = 529 Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Length = 532 Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Length = 540 Back     alignment and structure
>3moe_A Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluconeogenesis, lyase; HET: GTP SPV 1PE; 1.25A {Rattus norvegicus} PDB: 3mof_A* 3moh_A* 3dtb_A* 2qey_A* 2qf1_A* 2qew_A* 2rk7_A 2rk8_A 2rka_A* 2rkd_A 2rke_A 2qf2_A* 3dt2_A* 3dt7_A* 3dt4_A* 1khb_A* 1khe_A* 1khf_A* 1khg_A 1m51_A* ... Length = 624 Back     alignment and structure
>2faf_A Phosphoenolpyruvate carboxykinase; pepck, phosphoryl transfer, lyase; HET: 20S EPE 1PE; 1.70A {Gallus gallus} PDB: 2fah_A* 2qzy_A* Length = 608 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
1ii2_A524 Phosphoenolpyruvate carboxykinase; phosphate bindi 100.0
2olr_A540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 100.0
1ytm_A532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 100.0
1j3b_A529 ATP-dependent phosphoenolpyruvate carboxykinase; a 100.0
2zci_A610 Phosphoenolpyruvate carboxykinase [GTP], phosphoen 99.95
2faf_A608 Phosphoenolpyruvate carboxykinase; pepck, phosphor 99.95
3moe_A624 Phosphoenolpyruvate carboxykinase, cytosolic [GTP; 99.93
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 97.66
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 97.43
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 97.43
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 97.17
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.27
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.1
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.05
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.01
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.88
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.76
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.73
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.63
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.42
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.33
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.28
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.14
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.07
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.96
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.88
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.82
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.72
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.7
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.62
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.61
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.47
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.37
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.27
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.25
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.19
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.17
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.12
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.02
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.94
4a74_A231 DNA repair and recombination protein RADA; hydrola 91.91
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.91
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.9
1b0u_A262 Histidine permease; ABC transporter, transport pro 91.79
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.52
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.5
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.47
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.38
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.35
2kjq_A149 DNAA-related protein; solution structure, NESG, st 91.26
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 91.21
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 91.18
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.16
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.1
1g6h_A257 High-affinity branched-chain amino acid transport 91.03
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 91.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.95
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.92
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.9
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 90.87
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 90.8
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 90.8
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.79
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.78
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 90.77
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.74
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.73
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 90.68
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 90.61
2ghi_A260 Transport protein; multidrug resistance protein, M 90.59
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 90.59
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 90.56
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 90.55
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.52
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 90.43
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 90.42
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 90.39
1sgw_A214 Putative ABC transporter; structural genomics, P p 90.37
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 90.31
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.31
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 90.29
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 90.24
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 90.22
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.2
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.17
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 90.16
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 90.06
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 90.05
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 90.05
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 89.89
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 89.84
2eyu_A261 Twitching motility protein PILT; pilus retraction 89.84
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.79
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.73
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.72
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.71
2vli_A183 Antibiotic resistance protein; transferase, tunica 89.71
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.61
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 89.59
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 89.58
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 89.51
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 89.43
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.41
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.36
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.29
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 89.29
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 89.26
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 89.26
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 89.19
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 89.06
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.06
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.03
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 88.99
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 88.99
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 88.88
3bos_A242 Putative DNA replication factor; P-loop containing 88.88
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 88.82
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 88.77
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 88.77
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 88.72
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 88.58
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 88.52
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 88.49
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.4
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 88.26
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 88.26
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 88.18
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.15
1via_A175 Shikimate kinase; structural genomics, transferase 88.15
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 88.09
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 87.99
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.97
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.88
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 87.82
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.82
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 87.77
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 87.71
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 87.64
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 87.56
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 87.53
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.41
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.39
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 87.31
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 87.27
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 87.21
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.16
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 87.08
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 87.06
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.92
2og2_A359 Putative signal recognition particle receptor; nuc 86.91
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 86.89
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.87
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.86
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 86.81
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 86.76
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 86.72
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 86.68
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 86.48
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 86.44
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 86.27
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 86.14
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 86.14
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 86.05
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 86.01
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 85.98
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 85.97
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 85.96
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 85.88
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.86
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 85.8
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 85.67
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 85.58
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 85.52
3tlx_A243 Adenylate kinase 2; structural genomics, structura 85.41
3kta_A182 Chromosome segregation protein SMC; structural mai 85.36
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 85.27
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 85.11
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.1
3co5_A143 Putative two-component system transcriptional RES 85.07
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 84.99
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 84.83
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.64
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 84.59
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 84.57
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 84.55
1nrj_B218 SR-beta, signal recognition particle receptor beta 84.52
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 84.43
2chg_A226 Replication factor C small subunit; DNA-binding pr 84.4
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 84.38
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 84.36
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 84.36
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 84.32
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.25
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 84.2
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 84.03
2ewv_A372 Twitching motility protein PILT; pilus retraction 83.99
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 83.97
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 83.96
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 83.95
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.85
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.82
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 83.79
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 83.76
1xjc_A169 MOBB protein homolog; structural genomics, midwest 83.68
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 83.63
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 83.61
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 83.6
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 83.59
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.42
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 83.28
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 83.25
3r20_A233 Cytidylate kinase; structural genomics, seattle st 83.16
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 83.13
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 83.05
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 82.91
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 82.91
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 82.87
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 82.86
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 82.84
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 82.84
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 82.82
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 82.77
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 82.69
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 82.69
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 82.64
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 82.64
2r62_A268 Cell division protease FTSH homolog; ATPase domain 82.62
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.59
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 82.5
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 82.48
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 82.47
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 82.4
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 82.18
2wji_A165 Ferrous iron transport protein B homolog; membrane 82.15
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 81.97
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 81.84
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 81.83
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 81.81
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 81.77
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 81.58
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 81.46
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 81.42
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 81.41
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 81.29
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 81.21
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 81.2
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 81.2
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 81.19
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 81.15
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 81.12
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 81.1
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 81.07
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 80.94
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 80.92
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 80.85
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 80.81
2qgz_A308 Helicase loader, putative primosome component; str 80.72
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 80.63
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 80.63
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 80.62
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 80.6
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 80.56
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 80.47
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 80.38
2ged_A193 SR-beta, signal recognition particle receptor beta 80.36
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 80.31
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 80.29
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 80.2
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 80.2
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 80.2
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 80.19
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 80.17
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 80.08
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 80.07
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 80.03
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 80.03
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
Probab=100.00  E-value=1.7e-131  Score=1073.06  Aligned_cols=409  Identities=51%  Similarity=0.843  Sum_probs=398.3

Q ss_pred             ceeEecCCHHHHHHHHHhccCCeEEeccCceEEecCCcccCCCCCeeeecCCCccccccccC----cCccc---------
Q 008523          142 THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD---------  208 (563)
Q Consensus       142 ~~v~~Nls~~eL~e~A~~~~~Gt~~t~~GaL~~~tG~~TGRSpkdk~IV~d~~~~~~i~wg~----~~e~~---------  208 (563)
                      .+|+||++++||||+|+++++|+.++++|+|+++||++|||||+|||||+++.+++++||++    ++++.         
T Consensus         2 ~~v~~n~~~~eL~e~A~~~~eg~~lt~~Gal~~~tg~~tgRsp~dk~iv~~~~~~~~i~w~~~n~~~~~e~f~~l~~~~~   81 (524)
T 1ii2_A            2 PTIHRNLLSPELVQWALKIEKDSRLTARGALAVMSYAKTGRSPLDKRIVDTDDVRENVDWGKVNMKLSEESFARVRKIAK   81 (524)
T ss_dssp             CEEEESCCHHHHHHHHHHHCTTCEECTTSCEEECCTTCSSBCGGGEEEECCHHHHTTSCBTTTBCEECHHHHHHHHHHHH
T ss_pred             CeeEeCCCHHHHHHHHHHhCCCcEEcCCCCEEEecCcccCCCcCceEEeCCCCCccccccCcCcccCCHHHHHHHHHHHH
Confidence            57999999999999999999997799999999999999999999999999999999999987    44432         


Q ss_pred             -----cc-EEEEEeeecCCCCCeeEEEEEcccccHHHHHhccCcCCChHhhccCCCCCEEEEEcCCCCCCccccCCCCcc
Q 008523          209 -----VQ-VFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSST  282 (563)
Q Consensus       209 -----~~-lyv~d~~~G~d~~~~i~vrvit~~a~~alf~~Nlf~rp~~~el~~~~~pd~tI~~~p~f~~~~~~~g~~s~~  282 (563)
                           ++ |||+|+++|+|++|+++||+|++++||+||++|||+||..+|+++|++|||+||++|+|.+++..+|++|++
T Consensus        82 ~~l~~k~~l~v~d~~~G~d~~~~~~vrvit~~a~~~lf~~nl~~rp~~~e~~~fg~pd~~i~~~p~f~~~~~~~G~~s~~  161 (524)
T 1ii2_A           82 EFLDTREHLFVVDCFAGHDERYRLKVRVFTTRPYHALFMRDMLIVPTPEELATFGEPDYVIYNAGECKADPSIPGLTSTT  161 (524)
T ss_dssp             HHHHTSSEEEEEEEEECSSTTTCEEEEEEESSHHHHHHHHHHSBCCCHHHHHTCCSCSEEEEEETTSCCCTTSTTCCSSC
T ss_pred             HHHcCCCcEEEEeeeeecChhhcccEEEEECHHHHHHHHHHhhccCCHHHhcccCCCCEEEEeCCCccCCcccCCcCccc
Confidence                 54 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCCCeEEEEccccchhhHHHHHHHHHHhcccCceeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecC
Q 008523          283 SIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDD  362 (563)
Q Consensus       283 ~i~id~~~~~i~I~Gt~Y~GEiKK~iltl~n~~l~~~G~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDD  362 (563)
                      +|++|+++++++|+||+|+|||||++||+||++++++|+||||||+|++++|++++|||||||||||||+|++|.|||||
T Consensus       162 ~v~~~~~~~~~~I~Gt~Y~GemKK~~ftl~n~~~~~~g~L~~H~san~g~~g~~~~ffGlSGtGKTTLs~d~~r~lIgDD  241 (524)
T 1ii2_A          162 CVALNFKTREQVILGTEYAGEMKKGILTVMFELMPQMNHLCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDD  241 (524)
T ss_dssp             EEEEETTTTEEEEESCCCTHHHHHHHHHHHHHHHHHTTCEEESEEEEECTTCCEEEEECCTTSSHHHHHCCTTSEEEESS
T ss_pred             EEEEECCCCeEEEECCcchHHHHHHHHHHHHHHHHHCCcEeecceeeeCCCCCEEEEEccCCcchhhhhhccCCeEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeecCCCccccCCceeEeecCCCCCCCchhhhhccccceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCC
Q 008523          363 EHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPC  442 (563)
Q Consensus       363 e~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai~f~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~  442 (563)
                      ||+|+++|+||+|+|||+||+||++|.||+||++++|++|+|||+||++++.|||+|+++|+|+|++||+++|+|++.++
T Consensus       242 e~~w~~~Gvfn~E~G~y~K~idl~~e~eP~I~~ai~~~~ilENV~~d~~g~~vd~~d~s~t~NtR~~~P~~~i~n~~~~~  321 (524)
T 1ii2_A          242 EHVWTDRGVFNIEGGCYAKAIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSKA  321 (524)
T ss_dssp             CEEECSSCEEESCSEEEEECTTCCTTTCHHHHHTCSTTCEEESCCBCTTTCSBCTTCCSSCSCCEEEEEGGGSTTCCSSC
T ss_pred             hhhccCCCccccccceEEEecCCCcccChhHHHhcCcCceEEEEEECCCCCcccCCCCcccCCceEEEEHHHCCCCCCcc
Confidence            99999999999999999999999999999999999999999999999998999999999999999999999999999998


Q ss_pred             CCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcccccccccccCC-ccCccccccccccCCCccCChHHHHHHHHHH
Q 008523          443 VGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDG-IKEPTATFSACFGAAFIMLHPTKYAAMLAEK  521 (563)
Q Consensus       443 ~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsGyTak~aGtE~G-v~ep~atFs~cFg~PF~p~~p~~yae~L~~k  521 (563)
                      +++||++||||+||+|||||||+|||++||||||+||||||+||||.| ++||+||||+|||+||+|+||.+||++|+++
T Consensus       322 ~~g~P~~Iifl~~Da~gvlPPVskLt~eqa~y~F~sG~Tak~agtE~G~~~ep~~~fs~~fg~PF~~~~~~~ya~~L~~~  401 (524)
T 1ii2_A          322 IAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSSCFGGPFLVRHATFYGEQLAEK  401 (524)
T ss_dssp             EECCEEEEEEEECCTTSCSCSEEEECHHHHHHHHHHCEEEECSSSBTTCCSSCEEEECGGGCGGGCCSCHHHHHHHHHHH
T ss_pred             cCCCCceEEEEEcCCcCCCCCcEecCHHHHHHHHhcCccccccccccCccccCceeeccccCCCccCCCHHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999999999 9999999999999999999999999999999


Q ss_pred             HHHcCCEEEEEeccccCCcccc-cccchHH
Q 008523          522 MQKHGATGWLVNTGWSGGRCVL-KMVNLYA  550 (563)
Q Consensus       522 l~~~~v~v~LiNTGw~gg~yg~-G~r~~~~  550 (563)
                      |++++++||||||||+||+||+ |+||++.
T Consensus       402 i~~~~~~vylvNTg~~Gg~yg~~g~r~~~~  431 (524)
T 1ii2_A          402 MQKHNSRVWLLNTGYAGGRADRGAKRMPLR  431 (524)
T ss_dssp             HHHHTCEEEEEECSEESSCGGGTCEECCHH
T ss_pred             HHHhCCeEEEEeCCccccccCccCccCCHH
Confidence            9999999999999999999999 9999983
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>2zci_A Phosphoenolpyruvate carboxykinase [GTP], phosphoenolpyruvate; GTP-dependent, signaling protein, lyase; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2faf_A Phosphoenolpyruvate carboxykinase; pepck, phosphoryl transfer, lyase; HET: 20S EPE 1PE; 1.70A {Gallus gallus} PDB: 2fah_A* 2qzy_A* Back     alignment and structure
>3moe_A Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluconeogenesis, lyase; HET: GTP SPV 1PE; 1.25A {Rattus norvegicus} PDB: 3mof_A* 3moh_A* 3dtb_A* 2qey_A* 2qf1_A* 2qew_A* 2rk7_A 2rk8_A 2rka_A* 2rkd_A 2rke_A 2qf2_A* 3dt2_A* 3dt7_A* 3dt4_A* 1khb_A* 1khe_A* 1khf_A* 1khg_A 1m51_A* ... Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 563
d1ii2a1323 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) car 5e-99
d1j3ba1318 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) car 9e-97
d2olra1313 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) car 7e-93
d1ii2a2199 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carb 4e-67
d1j3ba2210 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carb 4e-62
d2olra2222 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carb 4e-60
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Length = 323 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Trypanosoma cruzi [TaxId: 5693]

 Score =  301 bits (772), Expect = 5e-99
 Identities = 123/220 (55%), Positives = 156/220 (70%), Gaps = 1/220 (0%)

Query: 322 LSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAK 381
           L +H+  N+GK GDV +FFGLSGTGKTTLS D +R LIGDDEH W D GV NIEGGCYAK
Sbjct: 2   LCMHASANVGKQGDVTVFFGLSGTGKTTLSADPHRNLIGDDEHVWTDRGVFNIEGGCYAK 61

Query: 382 CIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIP 441
            I L+ + E DI++A++FGAV EN V D+ T E+D+ D+S+ +NTR AYP+ +I  A   
Sbjct: 62  AIGLNPKTEKDIYDAVRFGAVAENCVLDKRTGEIDFYDESICKNTRVAYPLSHIEGALSK 121

Query: 442 CVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTE-DGIKEPTATFSA 500
            +  HPKNVI L  DAFGV+PPV++L  AQ M+ F+ GYTA V G E  G +     FS+
Sbjct: 122 AIAGHPKNVIFLTNDAFGVMPPVARLTSAQAMFWFVMGYTANVPGVEAGGTRTARPIFSS 181

Query: 501 CFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGR 540
           CFG  F++ H T Y   LAEKMQKH +  WL+NTG++GGR
Sbjct: 182 CFGGPFLVRHATFYGEQLAEKMQKHNSRVWLLNTGYAGGR 221
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Length = 313 Back     information, alignment and structure
>d1ii2a2 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Length = 199 Back     information, alignment and structure
>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Length = 210 Back     information, alignment and structure
>d2olra2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Length = 222 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d1j3ba2210 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d2olra2222 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d1ii2a2199 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 99.67
d1khba2250 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 97.94
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 97.53
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 97.49
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 97.39
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.17
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.61
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.49
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.22
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.05
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.91
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.89
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.77
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.56
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.15
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.07
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.05
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.03
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.72
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.87
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.81
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.66
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.66
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.54
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.46
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.27
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.08
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.97
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.74
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.66
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.47
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.42
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 91.35
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.28
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.08
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.05
d1g2912240 Maltose transport protein MalK, N-terminal domain 90.88
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.76
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 90.76
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.74
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.67
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.63
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.57
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.57
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.46
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.46
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.39
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.2
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.18
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.11
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.94
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.9
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.86
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.74
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.61
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.43
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.42
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.17
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.13
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.96
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.85
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 88.84
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.57
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.56
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.43
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.41
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.38
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.27
d1okkd2207 GTPase domain of the signal recognition particle r 88.21
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.16
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 88.09
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 87.84
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.77
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.57
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.46
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.23
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.22
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.1
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 86.79
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.69
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.4
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.38
d1ls1a2207 GTPase domain of the signal sequence recognition p 86.31
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.27
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 86.27
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 86.14
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.62
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 85.61
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.48
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 85.44
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.29
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.06
d1j8yf2211 GTPase domain of the signal sequence recognition p 85.05
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 84.93
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 84.59
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 84.5
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 84.41
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.33
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.3
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 84.01
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 84.01
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 83.99
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 83.98
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 83.92
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.85
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.56
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.11
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 83.09
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 82.74
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.48
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.33
d2qy9a2211 GTPase domain of the signal recognition particle r 82.3
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 82.23
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.21
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.15
d1vmaa2213 GTPase domain of the signal recognition particle r 82.1
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.8
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 81.73
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 81.61
d2fh5b1207 Signal recognition particle receptor beta-subunit 81.36
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.25
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 81.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 80.37
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.3
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.12
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=2.4e-93  Score=731.16  Aligned_cols=229  Identities=55%  Similarity=0.944  Sum_probs=217.1

Q ss_pred             eeeecccceecCCCCEEEEEecCCCCcccccccCCCceeecCceeecCCCccccCCceeEeecCCCCCCCchhhhhc-cc
Q 008523          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAI-KF  399 (563)
Q Consensus       321 ~L~mH~sanvg~~G~valfFGLSGTGKTTLsad~~r~lIgDDe~~w~~~Gvfn~EgGcyaK~~dLs~e~EP~I~~ai-~f  399 (563)
                      +||||||||++++|++++|||||||||||||+||+|.|||||||+|+++|+||+|+|||+||++|+++.||+||+|+ +|
T Consensus         1 ~lpmh~san~~~~~~valffGLSGTGKTTLs~~~~r~ligDDe~~w~~~gv~~~EgGcyaKt~~L~~~~ep~i~~a~~~~   80 (318)
T d1j3ba1           1 VFPMHASANVGKEGDVAVFFGLSGTGKTTLSTDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHEPLIYKASNQF   80 (318)
T ss_dssp             CEEEECEEEECTTCCEEEEEECTTSCHHHHTCBTTBCEEESSEEEECSSCEEESCSEEEEECTTCCTTTCHHHHHHHSST
T ss_pred             CcccccccccCCCCCEEEEEccCCCCccccccCCCceEEcCcceeEcCCCeeeeccceeeeecccCccCCcchHHHHHhh
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999 58


Q ss_pred             cceeeeeEEcCCCCcccCCCCCcccceeEEEecccccCCcCCCCCCCcceEEEEEeccCCCCCCeeecCHHHHHHHHHcc
Q 008523          400 GAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISG  479 (563)
Q Consensus       400 ~ailENV~~d~~~~~vdf~d~s~t~NtR~~yPi~~i~N~~~~~~~g~P~~iIflt~Da~gvLPPVskLt~eQA~~~FlsG  479 (563)
                      ++|+|||++|+++++|||+|+++|+|||++|||++|+|++.++.++||++||||+||||||||||+|||++||||||+||
T Consensus        81 ~ailENV~~d~~~~~vdf~d~s~t~N~R~~yp~~~i~n~~~~~~~~~p~~iifLt~Da~GVLPPvskLt~eQa~~~F~sG  160 (318)
T d1j3ba1          81 EAILENVVVNPESRRVQWDDDSKTENTRSSYPIAHLENVVESGVAGHPRAIFFLSADAYGVLPPIARLSPEEAMYYFLSG  160 (318)
T ss_dssp             TCEEESCEECTTTCCEETTCCSSCSCCEEEEEGGGCSSBCTTSEECCEEEEEEEECCTTSCSCSEEEECHHHHHHHHHHC
T ss_pred             hheeeeeEEecCCccccccCCcccCcceEEeehHhhhhhhhcccCCCCceeEEEecCcccCCChhhccCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999988889999999999999999999999999999999999999


Q ss_pred             cccccccccCCccCccccccccccCCCccCChHHHHHHHHHHHHHcCCEEEEEeccccCCcccccccchH
Q 008523          480 YTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGRCVLKMVNLY  549 (563)
Q Consensus       480 yTak~aGtE~Gv~ep~atFs~cFg~PF~p~~p~~yae~L~~kl~~~~v~v~LiNTGw~gg~yg~G~r~~~  549 (563)
                      ||+|++|||.|++||+||||+|||+||||+||.+||++|++||++|+++||||||||+||+||+|+||++
T Consensus       161 yT~k~agtE~g~~ep~~tfs~cfg~PFl~~~p~~ya~lL~~ki~~~~~~~~LvNTGW~Gg~yg~G~Ri~l  230 (318)
T d1j3ba1         161 YTARVAGTERGVTEPRATFSACFGAPFLPMHPGVYARMLGEKIRKHAPRVYLVNTGWTGGPYGVGYRFPL  230 (318)
T ss_dssp             EEEEC---------CEEEECGGGCGGGCSSCHHHHHHHHHHHHHHHCCEEEEEECSEESSSTTTSEECCH
T ss_pred             HhhhccCCccccccccceeehhhhccccccChhhHHHHHHHHHHhcCCcEEEEeccccccccccCCcCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a2 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khba2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure