Citrus Sinensis ID: 008611

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKVIA
cccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccHHHHHHEEEEEccccccEEEccccccccccEEcccccccccccccccccccccccEEEEEcccEEEEcccccccccccccEEccEEEEcccccccccccccccEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEEEccccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEEEccccEEEEEEEEccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEcccccccccccccEEEEEcccEEEEEcccccccccccEEEEEccccEEEcccccccccccccccEEEEEccEEEEEEEccccccccccEEEEEccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccc
ccHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHccccccccccccccEEEEccccccHHHcccccHHHHHHHHHHHHcccccccccccccccccccccEcccccccccccccccEEEEEccEEEEEcccccccccccEEEEcccccccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEccccccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEcccccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEcccccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccccccEEEEccccccccEccccccccccccHHHEEcccccccccccEEcccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHc
mamarassglaypeRFYAAAsyagfdgspnssakeltskfsnDSALLLYALYQQatvgpcnvpkpsswspveqskwkSWQGLGNMATTEAMRLFVKILeeedpgwysrasnsvaepivdvemnhdskTEAVKengnsfpetktistengnlmetqdkdvvseglgsvvvydqwiappisgqrpkaryehgaavvqdkmyiyggnhngrylsdmhiLDLRSWAWSKIQAKAVAestespspalltpcaghslipwENKLLSiaghtkdpseiIQVKVFdlqtcswstlktygkppvsrggqsvtLVGTSLVIfggedakrsllndlhildletmtwdeidavgvppsprsdhAAAVHAERYLLIfgggshaacfndlhvldlqtmewsrptqqgeiptpraghagvtiGENWFLGLSLVVSSYSGEDVIVAFGgyngrynnevhvlkpshkstlsskmietpvpdsvsavqnntnptrdleselevgqegkireivvdnvdsepliskhpetTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKVIA
mamarassglayPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEavkengnsfpetktistengnlmeTQDKDVVSEGLGSVVVYDQWIappisgqrpkaRYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWstlktygkppvsrggqsvTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIEtpvpdsvsavqnntnptrdleselevgqegkireivvdnvdsepliskhpettEHLIATLKAEKEELESSLSKEKLQSIqlkqdlteaesqntdlykvia
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSalllyalyqqaTVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFlglslvvssysgEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATlkaekeelesslskeklqsiqlkqDLTEAESQNTDLYKVIA
*************ERFYAAASYA********************SALLLYALYQQATVGPCNVPK***W**VEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYS****************************************************VSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAV*********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGV*******HAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSR**********RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVL************************************************IV****************************************************************
***********YPERFYAAASYAG*******************SALLLYALYQQATVGPCNVPKP*SWSPVEQ*****************MRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSK****************ISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAK***********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQ*EIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTL*****************************************************************************************************YKVIA
*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNV*************WKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKI**************ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAE*************QSIQLKQDLTEAESQNTDLYKVIA
*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAV********PALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYKVIA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLISKHPETTEHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNTDLYKVIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query559 2.2.26 [Sep-21-2011]
Q9MA55668 Acyl-CoA-binding domain-c yes no 0.982 0.821 0.702 0.0
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.942 0.813 0.655 0.0
Q7M3S9 943 RING finger protein B OS= no no 0.407 0.241 0.3 6e-26
P51611 2090 Host cell factor 1 OS=Mes N/A no 0.382 0.102 0.279 6e-21
Q61191 2045 Host cell factor 1 OS=Mus yes no 0.382 0.104 0.279 7e-21
Q5EA50372 Rab9 effector protein wit no no 0.415 0.623 0.280 9e-21
P51610 2035 Host cell factor 1 OS=Hom yes no 0.382 0.105 0.279 1e-20
Q9V4C8 1500 Host cell factor OS=Droso no no 0.449 0.167 0.283 2e-20
Q7Z6M1372 Rab9 effector protein wit no no 0.411 0.618 0.266 2e-19
Q58CV6382 Kelch domain-containing p no no 0.452 0.662 0.275 4e-19
>sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 Back     alignment and function desciption
 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/594 (70%), Positives = 483/594 (81%), Gaps = 45/594 (7%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAM RA+SG AYPERFYAAASY G DGS +SSAK + SKF +D+ALLLYALYQQATVGPC
Sbjct: 1   MAMPRATSGPAYPERFYAAASYVGLDGS-DSSAKNVISKFPDDTALLLYALYQQATVGPC 59

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           N PKPS+W PVEQSKWKSWQGLG M + EAMRLFVKILEE+DPGWYSRASN + +P+VDV
Sbjct: 60  NTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEDDPGWYSRASNDIPDPVVDV 119

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++N  +K E V ENG++F ETKTISTENG L ETQDKDVVSE   +V VY+QW AP  SG
Sbjct: 120 QINR-AKDEPVVENGSTFSETKTISTENGRLAETQDKDVVSEDSNTVSVYNQWTAPQTSG 178

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAV+QDKMYIYGGNHNGRYL D+H+LDL+SW WS+++ K   ES E+ +P
Sbjct: 179 QRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESQETSTP 238

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
            LL PCAGHSLI W+NKLLSI GHTKDPSE +QVKVFD  T +WS LKTYGKPPVSRGGQ
Sbjct: 239 TLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGKPPVSRGGQ 298

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVT+VG +LVIFGG+DAKRSLLNDLHILDL+TMTWDEIDAVGV PSPRSDHAAAVHAER+
Sbjct: 299 SVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERF 358

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           LLIFGGGSHA CF+DLHVLDLQTMEWSRP QQG+ PTPRAGHAGVTIGENWF+       
Sbjct: 359 LLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNK 418

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSLVVSSY+GEDV+VAFGGYNGRYNNE+
Sbjct: 419 SGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEI 478

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSE 502
           ++LKPSHKSTL +K +E P+P S+SAV N T  TRD+ESE+EV QEG++REIV+DNV+  
Sbjct: 479 NLLKPSHKSTLQTKTLEAPLPGSLSAVNNAT--TRDIESEVEVSQEGRVREIVMDNVNPG 536

Query: 503 PLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYK 556
              SK    +E +IAT+K+EKEELE+SL+KE++Q++QL+Q+L EAE +NTDLYK
Sbjct: 537 ---SKVEGNSERIIATIKSEKEELEASLNKERMQTLQLRQELGEAELRNTDLYK 587
Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description
>sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 Back     alignment and function description
>sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
255542698 675 acyl-CoA binding protein, putative [Rici 0.994 0.823 0.769 0.0
428754002 669 acyl-CoA binding protein 4 [Vernicia for 0.983 0.822 0.762 0.0
225450825 675 PREDICTED: acyl-CoA-binding domain-conta 0.992 0.822 0.760 0.0
296089677 674 unnamed protein product [Vitis vinifera] 0.991 0.821 0.762 0.0
224125222 686 predicted protein [Populus trichocarpa] 0.992 0.809 0.749 0.0
449454077 671 PREDICTED: acyl-CoA-binding domain-conta 0.985 0.821 0.734 0.0
224123550644 predicted protein [Populus trichocarpa] 0.953 0.827 0.738 0.0
357511945 664 Acyl-CoA-binding domain-containing prote 0.971 0.817 0.713 0.0
225450823651 PREDICTED: acyl-CoA-binding domain-conta 0.949 0.815 0.732 0.0
42572263 669 acyl-CoA binding protein 4 [Arabidopsis 0.983 0.822 0.702 0.0
>gi|255542698|ref|XP_002512412.1| acyl-CoA binding protein, putative [Ricinus communis] gi|223548373|gb|EEF49864.1| acyl-CoA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/594 (76%), Positives = 516/594 (86%), Gaps = 38/594 (6%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAMARASSGLAYPERFYAAA+YAGFDGSP+S++  ++SKF +D+ALLLYALYQQAT+GPC
Sbjct: 1   MAMARASSGLAYPERFYAAATYAGFDGSPDSASSTVSSKFQSDTALLLYALYQQATIGPC 60

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           + PKPS+W  VE SKWKSWQGLGNMA+TEAMRLFVKILEEEDPGWYSRASNSV EP+VD+
Sbjct: 61  SAPKPSTWKAVELSKWKSWQGLGNMASTEAMRLFVKILEEEDPGWYSRASNSVPEPVVDM 120

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++NH+ K E++ ENGNS+PETKTIS+ENGN++ETQDKDVVSEGLGSV VYDQWI PPISG
Sbjct: 121 QLNHNPKVESIVENGNSYPETKTISSENGNVIETQDKDVVSEGLGSVAVYDQWITPPISG 180

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAVVQDKMYIYGGNHNGRYL+D+H+LDLRSW+WSK+ AK  AES ES S 
Sbjct: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLNDLHVLDLRSWSWSKVDAKVEAESNESKSS 240

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
             LTPCAGHSLI WENKLLSIAGHTKDPSE +QVKVFDLQT +WSTLKTYGKPPVSRGGQ
Sbjct: 241 PTLTPCAGHSLISWENKLLSIAGHTKDPSEYMQVKVFDLQTRTWSTLKTYGKPPVSRGGQ 300

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVTLVGTSLVIFGG+DAKRSLLNDLHILDLE+MTWDEIDAVGVPPSPRSDHAAAVHAERY
Sbjct: 301 SVTLVGTSLVIFGGQDAKRSLLNDLHILDLESMTWDEIDAVGVPPSPRSDHAAAVHAERY 360

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           +LIFGGGSHA CFNDLHVLD + MEW+RPTQQG++P+PRAGHAGVT+GENWF+       
Sbjct: 361 ILIFGGGSHATCFNDLHVLDSKNMEWTRPTQQGKLPSPRAGHAGVTVGENWFIAGGGDNK 420

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSL+VSSY+GED++V+FGGYNGRY+N+V
Sbjct: 421 SGVSETIVLNMSTLVWSVVTSVEGRVPLASEGLSLMVSSYNGEDILVSFGGYNGRYSNDV 480

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSE 502
           +VLKPSHKSTL SK+IETPVPDSVSAV N TN TRDLESE E GQEGKIREIV+DNVD E
Sbjct: 481 NVLKPSHKSTLQSKIIETPVPDSVSAVHNATNATRDLESESEAGQEGKIREIVMDNVDPE 540

Query: 503 PLISKHPETTEHLIATLKAEKEELESSLSKEKLQSIQLKQDLTEAESQNTDLYK 556
           P+ SK   ++EHL+ATLKAEKEELESSLSKEK Q++QLKQ+L EAE++NTDLYK
Sbjct: 541 PMKSKGEVSSEHLLATLKAEKEELESSLSKEKFQTLQLKQELAEAETRNTDLYK 594

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|428754002|gb|AFZ62126.1| acyl-CoA binding protein 4 [Vernicia fordii] Back     alignment and taxonomy information
>gi|225450825|ref|XP_002284019.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089677|emb|CBI39496.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125222|ref|XP_002319530.1| predicted protein [Populus trichocarpa] gi|222857906|gb|EEE95453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454077|ref|XP_004144782.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449526493|ref|XP_004170248.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224123550|ref|XP_002330149.1| predicted protein [Populus trichocarpa] gi|222871605|gb|EEF08736.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357511945|ref|XP_003626261.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi|124360024|gb|ABN08040.1| Acyl-coA-binding protein, ACBP; Serine/threonine protein phosphatase, BSU1 [Medicago truncatula] gi|355501276|gb|AES82479.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225450823|ref|XP_002284025.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42572263|ref|NP_974227.1| acyl-CoA binding protein 4 [Arabidopsis thaliana] gi|332640717|gb|AEE74238.1| acyl-CoA binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
TAIR|locus:2143676648 ACBP5 "acyl-CoA binding protei 0.729 0.629 0.734 6.1e-170
TAIR|locus:2184352514 AT5G04420 [Arabidopsis thalian 0.466 0.507 0.5 3e-69
TAIR|locus:2183008 708 AT5G18590 [Arabidopsis thalian 0.429 0.338 0.359 2.6e-43
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.388 0.447 0.330 1.1e-25
UNIPROTKB|F1SKQ3370 RABEPK "Uncharacterized protei 0.406 0.613 0.286 2.9e-23
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.402 0.238 0.307 1.3e-21
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.413 0.620 0.281 1.7e-21
ZFIN|ZDB-GENE-070424-100411 zgc:163014 "zgc:163014" [Danio 0.386 0.525 0.319 4.7e-21
MGI|MGI:2139530380 Rabepk "Rab9 effector protein 0.406 0.597 0.298 5.6e-21
RGD|1310612372 Rabepk "Rab9 effector protein 0.406 0.610 0.290 6.5e-20
TAIR|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1631 (579.2 bits), Expect = 6.1e-170, Sum P(2) = 6.1e-170
 Identities = 301/410 (73%), Positives = 343/410 (83%)

Query:     3 MARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNV 62
             M RASSGL+YPERFYAAASY G DGS  SS K+L+SKFSND+           T+GPC++
Sbjct:     4 MVRASSGLSYPERFYAAASYVGLDGS-QSSVKQLSSKFSNDTSLLLYTLHQQATLGPCSI 62

Query:    63 PKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEM 122
             PKPS+W+PVEQSKWKSWQGLG M + EAMRLFVKILEE DPGWY R SNSV +P V V++
Sbjct:    63 PKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEADPGWYPRTSNSVLDPAVHVQI 122

Query:   123 NHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQR 182
             N  +K E   E+G SF ETKTI++E+G L ETQDKDVV E   +V VY+QW AP  SGQ 
Sbjct:   123 N-STKAEPSFESGASFGETKTITSEDGRLTETQDKDVVLEDPDTVSVYNQWTAPRTSGQP 181

Query:   183 PKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPAL 242
             PKARY+HGAAV+QDKMY+YGGNHNGRYL D+H+LDL++W WS+++ K V  S E+ SPA 
Sbjct:   182 PKARYQHGAAVIQDKMYMYGGNHNGRYLGDLHVLDLKNWTWSRVETKVVTGSQETSSPAK 241

Query:   243 LTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSV 302
             LT CAGHSLIPW+N+LLSI GHTKDPSE + V VFDL  CSWS LKTYGKPP+SRGGQSV
Sbjct:   242 LTHCAGHSLIPWDNQLLSIGGHTKDPSESMPVMVFDLHCCSWSILKTYGKPPISRGGQSV 301

Query:   303 TLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLL 362
             TLVG SLVIFGG+DAKRSLLNDLHILDL+TMTW+EIDAVG PP+PRSDHAAAVHAERYLL
Sbjct:   302 TLVGKSLVIFGGQDAKRSLLNDLHILDLDTMTWEEIDAVGSPPTPRSDHAAAVHAERYLL 361

Query:   363 IFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWF 412
             IFGGGSHA CF+DLHVLDLQTMEWSR TQQG+ PTPRAGHAGVTIGENW+
Sbjct:   362 IFGGGSHATCFDDLHVLDLQTMEWSRHTQQGDAPTPRAGHAGVTIGENWY 411
GO:0000062 "fatty-acyl-CoA binding" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006869 "lipid transport" evidence=RCA;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009416 "response to light stimulus" evidence=TAS
GO:0006306 "DNA methylation" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-100 zgc:163014 "zgc:163014" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2139530 Rabepk "Rab9 effector protein with kelch motifs" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310612 Rabepk "Rab9 effector protein with kelch motifs" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MA55ACBP4_ARATHNo assigned EC number0.70200.98210.8218yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022741001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (673 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
pfam0088787 pfam00887, ACBP, Acyl CoA binding protein 2e-22
cd0043585 cd00435, ACBP, Acyl CoA binding protein (ACBP) bin 4e-19
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-10
PTZ0045890 PTZ00458, PTZ00458, acyl CoA binding protein; Prov 3e-10
COG428187 COG4281, ACB, Acyl-CoA-binding protein [Lipid meta 5e-09
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-09
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 1e-08
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 3e-08
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 4e-08
pfam1385442 pfam13854, Kelch_5, Kelch motif 1e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-06
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 8e-05
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 9e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 4e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 4e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.003
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.003
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.003
>gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein Back     alignment and domain information 
 Score = 91.1 bits (227), Expect = 2e-22
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 12/89 (13%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKF--SNDSALLLYALYQQATVGPCNVPKPSSWSPV 71
           E F AA  +           K+L      SN+  L LYALY+QAT G  N P+P  +  +
Sbjct: 3   EEFEAAVKFV----------KKLPKDGRPSNEEKLKLYALYKQATEGDVNTPRPGMFDVI 52

Query: 72  EQSKWKSWQGLGNMATTEAMRLFVKILEE 100
            ++KW +W+ L  M+  EAM+ +V+++EE
Sbjct: 53  GKAKWDAWKKLKGMSKEEAMKKYVELVEE 81

Length = 87
>gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|185637 PTZ00458, PTZ00458, acyl CoA binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 559
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.98
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
PHA02790480 Kelch-like protein; Provisional 99.98
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
PHA02713557 hypothetical protein; Provisional 99.97
KOG1230521 consensus Protein containing repeated kelch motifs 99.97
PHA03098534 kelch-like protein; Provisional 99.97
PTZ0045890 acyl CoA binding protein; Provisional 99.96
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.96
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 99.96
PHA02790480 Kelch-like protein; Provisional 99.96
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 99.94
KOG0817142 consensus Acyl-CoA-binding protein [Lipid transpor 99.94
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 99.92
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.73
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.71
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.65
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.53
KOG3878469 consensus Protein involved in maintenance of Golgi 99.28
PLN02772 398 guanylate kinase 99.1
PF1396450 Kelch_6: Kelch motif 99.1
PF1396450 Kelch_6: Kelch motif 99.07
PLN02772398 guanylate kinase 98.93
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.9
PF1341549 Kelch_3: Galactose oxidase, central domain 98.9
PF1341549 Kelch_3: Galactose oxidase, central domain 98.89
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.86
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.82
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.77
PF1385442 Kelch_5: Kelch motif 98.72
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.72
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.72
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.62
PF1385442 Kelch_5: Kelch motif 98.55
smart0061247 Kelch Kelch domain. 98.41
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.38
smart0061247 Kelch Kelch domain. 98.35
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.96
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.77
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.66
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.53
PF12768281 Rax2: Cortical protein marker for cell polarity 96.47
PF12768281 Rax2: Cortical protein marker for cell polarity 96.34
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.31
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.29
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.2
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.04
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.03
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.65
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.16
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.11
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 94.94
KOG2055514 consensus WD40 repeat protein [General function pr 94.89
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 94.8
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.55
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.32
PTZ00421493 coronin; Provisional 94.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.93
PTZ00420568 coronin; Provisional 93.68
KOG0646476 consensus WD40 repeat protein [General function pr 93.63
PRK04922433 tolB translocation protein TolB; Provisional 93.59
PRK04792448 tolB translocation protein TolB; Provisional 93.47
KOG2055514 consensus WD40 repeat protein [General function pr 93.26
PRK05137435 tolB translocation protein TolB; Provisional 93.07
PF12217367 End_beta_propel: Catalytic beta propeller domain o 92.91
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.85
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.85
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.56
PRK00178430 tolB translocation protein TolB; Provisional 92.35
PRK04043419 tolB translocation protein TolB; Provisional 92.28
KOG2321 703 consensus WD40 repeat protein [General function pr 92.1
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.92
PF09910339 DUF2139: Uncharacterized protein conserved in arch 91.73
PF12217367 End_beta_propel: Catalytic beta propeller domain o 91.53
PRK04792448 tolB translocation protein TolB; Provisional 91.35
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.08
PRK13684334 Ycf48-like protein; Provisional 90.97
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 90.77
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 90.67
PRK04922433 tolB translocation protein TolB; Provisional 90.55
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.1
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.16
PRK03629429 tolB translocation protein TolB; Provisional 88.6
PRK02889427 tolB translocation protein TolB; Provisional 88.57
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 88.52
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.48
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.23
PRK13684334 Ycf48-like protein; Provisional 87.87
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 87.6
PF14282106 FlxA: FlxA-like protein 87.22
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.97
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 86.77
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 86.0
PLN00033398 photosystem II stability/assembly factor; Provisio 85.65
KOG0310 487 consensus Conserved WD40 repeat-containing protein 85.62
PRK00178430 tolB translocation protein TolB; Provisional 85.34
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 85.32
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.8
PRK11028330 6-phosphogluconolactonase; Provisional 83.9
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 83.76
COG3167 211 PilO Tfp pilus assembly protein PilO [Cell motilit 83.68
PRK10884206 SH3 domain-containing protein; Provisional 83.15
COG307479 Uncharacterized protein conserved in bacteria [Fun 83.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 82.91
PRK10884206 SH3 domain-containing protein; Provisional 82.79
PRK05137435 tolB translocation protein TolB; Provisional 82.76
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 82.36
PRK11028330 6-phosphogluconolactonase; Provisional 82.31
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 82.3
PF14282106 FlxA: FlxA-like protein 82.12
PLN029191057 haloacid dehalogenase-like hydrolase family protei 81.85
PRK13169110 DNA replication intiation control protein YabA; Re 81.82
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 81.75
smart00284255 OLF Olfactomedin-like domains. 81.54
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 81.52
KOG0310487 consensus Conserved WD40 repeat-containing protein 81.48
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 81.48
PRK11637 428 AmiB activator; Provisional 81.09
PRK11637 428 AmiB activator; Provisional 80.81
KOG3530616 consensus FERM domain protein EHM2 [General functi 80.77
PF04859131 DUF641: Plant protein of unknown function (DUF641) 80.77
PRK02889427 tolB translocation protein TolB; Provisional 80.75
>PLN02193 nitrile-specifier protein Back     alignment and domain information 
Probab=100.00  E-value=1.8e-37  Score=329.54  Aligned_cols=256  Identities=22%  Similarity=0.361  Sum_probs=218.7

Q ss_pred             ceEEecccCCCCCCcccceeEEEECCEEEEEccCCCC--cccCcEEEEEcCCCeEEEeeeccccCCCCCCCCCCCC-CCc
Q 008611          171 DQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNG--RYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLT-PCA  247 (559)
Q Consensus       171 ~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~~--~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~p~-~r~  247 (559)
                      ++|..+.+.+.+|.+|.+|+++++++.|||+||....  ...+++|+||+.+++|..++++.          ..|. +|.
T Consensus       151 ~~W~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~v~~yD~~~~~W~~~~~~g----------~~P~~~~~  220 (470)
T PLN02193        151 GKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATG----------DVPHLSCL  220 (470)
T ss_pred             ceEEEcccCCCCCCCccccEEEEECCEEEEECCcCCCCCCeeCcEEEEECCCCEEEeCCCCC----------CCCCCccc
Confidence            6999998877889999999999999999999997532  34578999999999999876543          2233 477


Q ss_pred             cceeEEeCCEEEEEeccCCCCCCcceEEEEECCCCeEEEeccCCCCCCCccceEEEEECCEEEEEcCcCCCCCCcCceEE
Q 008611          248 GHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHI  327 (559)
Q Consensus       248 ~~~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~  327 (559)
                      +|+++.++++||||||.... ..++++++||+.+++|+.+++.+..|.+|..|++++++++||||||.+... .++++++
T Consensus       221 ~~~~v~~~~~lYvfGG~~~~-~~~ndv~~yD~~t~~W~~l~~~~~~P~~R~~h~~~~~~~~iYv~GG~~~~~-~~~~~~~  298 (470)
T PLN02193        221 GVRMVSIGSTLYVFGGRDAS-RQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATA-RLKTLDS  298 (470)
T ss_pred             ceEEEEECCEEEEECCCCCC-CCCccEEEEECCCCEEEEcCcCCCCCCCccceEEEEECCEEEEECCCCCCC-CcceEEE
Confidence            99999999999999998754 567899999999999999986656689999999999999999999997654 4789999


Q ss_pred             EECCCCceEEecCCCCCCCcccccEEEEEcCCEEEEEcCCCCCCCcCceEEEECCCCeeEeccCCCCCCCCccccEEEEE
Q 008611          328 LDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTI  407 (559)
Q Consensus       328 yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~l~v~GG~~~~~~~~dv~~~d~~~~~W~~~~~~~~~p~~R~~hs~~~~  407 (559)
                      ||+.+++|+.++..+.+|.+|..|+++++ +++|||+||.++. .++++++||+.+++|+.+...+..|.+|..|+++++
T Consensus       299 yd~~t~~W~~~~~~~~~~~~R~~~~~~~~-~gkiyviGG~~g~-~~~dv~~yD~~t~~W~~~~~~g~~P~~R~~~~~~~~  376 (470)
T PLN02193        299 YNIVDKKWFHCSTPGDSFSIRGGAGLEVV-QGKVWVVYGFNGC-EVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAV  376 (470)
T ss_pred             EECCCCEEEeCCCCCCCCCCCCCcEEEEE-CCcEEEEECCCCC-ccCceEEEECCCCEEEEeccCCCCCCCcceeEEEEE
Confidence            99999999999876667889999999988 4569999997643 478999999999999999766677999999999999


Q ss_pred             CCceecceeeeeeccCCCcEEEEEcCcCC----------CCcccEEEEeCCCcceecccC
Q 008611          408 GENWFLGLSLVVSSYSGEDVIVAFGGYNG----------RYNNEVHVLKPSHKSTLSSKM  457 (559)
Q Consensus       408 ~~~~~iG~s~~~~~~~~~~~l~v~GG~~~----------~~~~~v~~~d~~~~~~~~~~~  457 (559)
                      ++                 +||||||...          ...+++++||+.++.|.....
T Consensus       377 ~~-----------------~iyv~GG~~~~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~~  419 (470)
T PLN02193        377 GK-----------------HIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDK  419 (470)
T ss_pred             CC-----------------EEEEECCccCCccccccCccceeccEEEEEcCcCEEEEccc
Confidence            66                 8999999753          246799999999998876543

>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>KOG0817 consensus Acyl-CoA-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>COG3167 PilO Tfp pilus assembly protein PilO [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG3530 consensus FERM domain protein EHM2 [General function prediction only] Back     alignment and domain information
>PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
2lbb_A96 Solution Structure Of Acyl Coa Binding Protein From 1e-06
2cop_A109 Solution Structure Of Rsgi Ruh-040, An Acbp Domain 2e-06
2wh5_A106 Crystal Structure Of Human Acyl-Coa Binding Domain 4e-06
3flv_A119 The Crystal Structure Of Human Acyl-Coenzymea Bindi 6e-05
>pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 36/81 (44%)
Query: 25  FDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNVPKPSSWSPVEQSKWKSWQGLGN 84
           FD +    +   T   SND            TVG CN PKP      E+ KW++W  L  
Sbjct: 14  FDAAVKYVSNTTTMMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRG 73
Query: 85  MATTEAMRLFVKILEEEDPGW 105
           M+T  A   +VK+L+   P W
Sbjct: 74  MSTESAKEAYVKLLDTLAPSW 94
>pdb|2COP|A Chain A, Solution Structure Of Rsgi Ruh-040, An Acbp Domain From Human Cdna Length = 109 Back     alignment and structure
>pdb|2WH5|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 4 Complexed With Stearoyl-Coa Length = 106 Back     alignment and structure
>pdb|3FLV|A Chain A, The Crystal Structure Of Human Acyl-Coenzymea Binding Domain Containing 5 Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-36
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-33
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 1e-28
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-09
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 7e-24
2lbb_A96 Acyl COA binding protein; protein binding, structu 7e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-24
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-04
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 9e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-12
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 4e-23
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 6e-23
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 1e-22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-17
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-11
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-22
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 3e-06
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-04
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-22
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-20
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 1e-21
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 2e-21
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 3e-21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-20
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-18
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-06
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  142 bits (359), Expect = 4e-36
 Identities = 49/299 (16%), Positives = 92/299 (30%), Gaps = 55/299 (18%)

Query: 170 YDQWIAPPISGQRPKARYEHGAAVV--QDKMYIYGG-NHNGRYLSDMHILDLRSWAWSKI 226
            D       S + P AR  H    +   +++ + GG     + LSD  I D+++  WS I
Sbjct: 424 IDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 227 QAKAVAESTESPSPALLTPCAGHSLIPW-ENKLLSIAGHTKDPSEIIQVKVFDLQTCSWS 285
           +                     HS     +  +L + G T+ P+    + ++++    + 
Sbjct: 484 K----------SLS---HTRFRHSACSLPDGNVLILGGVTEGPA----MLLYNVTEEIFK 526

Query: 286 TLKTYGKPPVSRGGQSVTLVGT----SLVIFGGEDAKRSLLNDLHILDLE----TMTWDE 337
            +    +   +    +           +++ GG   + ++ +   I   +    T     
Sbjct: 527 DVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITV 586

Query: 338 IDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACF---NDLHVLDLQTMEWSRPTQQGE 394
           I  +  P   R          R LLI GG S +  F   N +  LD  +   +       
Sbjct: 587 IKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRR 646

Query: 395 IPTP----RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYN----GRYNNEVHVL 445
           I        AG + V+                    + +  GG      G   N    L
Sbjct: 647 IWEDHSLMLAGFSLVSTSMG---------------TIHIIGGGATCYGFGSVTNVGLKL 690
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 99.97
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 99.97
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 99.97
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 99.97
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 99.97
2lbb_A96 Acyl COA binding protein; protein binding, structu 99.96
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 99.96
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 99.96
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 99.96
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 99.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.0
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.92
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 97.72
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.63
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.55
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.51
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.49
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.09
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.87
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.67
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.49
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.39
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.29
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.2
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.17
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.16
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.15
3jrp_A379 Fusion protein of protein transport protein SEC13 96.1
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.01
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.92
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.87
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.85
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.75
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.7
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.66
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.59
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.56
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.54
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.5
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.5
3jrp_A379 Fusion protein of protein transport protein SEC13 95.38
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.36
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.35
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.16
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.02
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.76
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 94.52
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.47
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.41
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.28
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.2
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.19
3jro_A 753 Fusion protein of protein transport protein SEC13 94.17
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 94.11
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.1
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.04
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.97
3jro_A 753 Fusion protein of protein transport protein SEC13 93.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.91
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 93.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.86
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.83
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.82
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.77
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.7
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.68
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.54
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 93.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.45
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 93.39
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.26
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.26
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.16
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.1
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.09
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.07
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.06
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.06
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.88
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 92.88
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.74
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.72
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.6
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.6
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.52
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 92.52
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.36
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 92.34
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 92.33
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.05
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.97
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 91.86
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.83
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.67
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 91.6
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 91.58
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.57
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.57
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.54
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 91.53
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.52
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.5
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.42
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.31
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.29
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 91.27
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.23
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 91.22
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 91.13
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.12
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.1
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.02
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.98
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 90.92
4a2l_A 795 BT_4663, two-component system sensor histidine kin 90.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 90.74
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 90.59
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 90.59
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 90.5
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.5
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 90.39
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 90.2
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.19
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 90.05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 89.98
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 89.93
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 89.83
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 89.38
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 89.27
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.19
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 88.91
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 88.88
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 88.55
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 88.5
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 88.47
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.44
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 88.18
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.17
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.17
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 88.06
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 88.04
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 88.03
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.97
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 87.91
3v9f_A781 Two-component system sensor histidine kinase/RESP 87.86
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 87.85
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 87.58
2q6q_A74 Spindle POLE BODY component SPC42; SPC42P, budding 87.42
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.41
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 87.32
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.32
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 87.24
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 87.2
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 87.19
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 87.15
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 86.41
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 86.33
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 86.28
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 86.25
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 86.21
4emc_A 190 Monopolin complex subunit CSM1; RWD domain, kineto 86.18
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 86.16
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 86.09
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 86.05
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 86.03
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 85.95
2ece_A462 462AA long hypothetical selenium-binding protein; 85.86
2xyi_A430 Probable histone-binding protein CAF1; transcripti 85.67
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 85.67
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 85.67
1itv_A195 MMP9; adaptive molecular recognition, beta propell 85.58
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 85.46
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 85.36
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 85.21
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.17
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 84.92
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 84.84
2pm7_B297 Protein transport protein SEC13, protein transport 84.83
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 84.77
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 84.31
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 84.17
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 84.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 83.87
2xyi_A430 Probable histone-binding protein CAF1; transcripti 83.79
3au4_A555 Myosin-X; protein-protein complex, motor protein c 83.69
3ott_A758 Two-component system sensor histidine kinase; beta 83.48
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 83.36
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 83.29
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.28
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 83.1
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 82.87
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 82.84
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 82.72
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 82.67
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 82.54
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 82.37
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 82.3
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 82.22
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 82.14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 82.13
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 82.08
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 81.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 81.53
2k48_A107 Nucleoprotein; viral protein; NMR {Andes virus} 81.25
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 81.13
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 80.92
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 80.64
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.54
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 80.25
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.8e-39  Score=325.20  Aligned_cols=248  Identities=17%  Similarity=0.281  Sum_probs=220.6

Q ss_pred             Ccceeccc----eEEecccCCCCCCcccceeEEEECCEEEEEccCCCCcccCcEEEEEcCCCeEEEeeeccccCCCCCCC
Q 008611          164 LGSVVVYD----QWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPS  239 (559)
Q Consensus       164 ~~~~~~~~----~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~  239 (559)
                      ...++.||    +|..++.   +|.+|.+|++++++++|||+||.. ...++++++||+.+++|..+++           
T Consensus        23 ~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~~lyv~GG~~-~~~~~~~~~~d~~~~~W~~~~~-----------   87 (306)
T 3ii7_A           23 PQSCRYFNPKDYSWTDIRC---PFEKRRDAACVFWDNVVYILGGSQ-LFPIKRMDCYNVVKDSWYSKLG-----------   87 (306)
T ss_dssp             TTSEEEEETTTTEEEECCC---CSCCCBSCEEEEETTEEEEECCBS-SSBCCEEEEEETTTTEEEEEEC-----------
T ss_pred             CceEEEecCCCCCEecCCC---CCcccceeEEEEECCEEEEEeCCC-CCCcceEEEEeCCCCeEEECCC-----------
Confidence            45666665    9999874   899999999999999999999987 7788999999999999999855           


Q ss_pred             CCCCCCCccceeEEeCCEEEEEeccCCCCCCcceEEEEECCCCeEEEeccCCCCCCCccceEEEEECCEEEEEcCcCCCC
Q 008611          240 PALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKR  319 (559)
Q Consensus       240 ~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~~~~  319 (559)
                        +|.+|.+|+++.++++|||+||.+......+++++||+.+++|+.++   ++|.+|.+|+++.++++||||||.+...
T Consensus        88 --~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~  162 (306)
T 3ii7_A           88 --PPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKP---SMLTQRCSHGMVEANGLIYVCGGSLGNN  162 (306)
T ss_dssp             --CSSCCBSCEEEEETTEEEEECCBBTTBSCCCCEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTEEEEECCEESCT
T ss_pred             --CCccccceeEEEECCEEEEECCCCCCCcEeeeEEEEeCCCCceEeCC---CCcCCcceeEEEEECCEEEEECCCCCCC
Confidence              46899999999999999999999755577899999999999999996   6899999999999999999999986654


Q ss_pred             C---CcCceEEEECCCCceEEecCCCCCCCcccccEEEEEcCCEEEEEcCCCCCCCcCceEEEECCCCeeEeccCCCCCC
Q 008611          320 S---LLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIP  396 (559)
Q Consensus       320 ~---~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~l~v~GG~~~~~~~~dv~~~d~~~~~W~~~~~~~~~p  396 (559)
                      .   .++++++||+.+++|+.+..   +|.+|..|+++++ +++|||+||......++++++||+.+++|+.+   +.+|
T Consensus       163 ~~~~~~~~~~~yd~~~~~W~~~~~---~p~~r~~~~~~~~-~~~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~---~~~p  235 (306)
T 3ii7_A          163 VSGRVLNSCEVYDPATETWTELCP---MIEARKNHGLVFV-KDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMV---SPMP  235 (306)
T ss_dssp             TTCEECCCEEEEETTTTEEEEECC---CSSCCBSCEEEEE-TTEEEEECCEETTEEBCCEEEEETTTTEEEEC---CCCS
T ss_pred             CcccccceEEEeCCCCCeEEECCC---ccchhhcceEEEE-CCEEEEEeCCCCCCCCceEEEeeCCCCcEEEC---CCCC
Confidence            3   27999999999999999974   5889999999998 56799999987777789999999999999999   4788


Q ss_pred             CCccccEEEEECCceecceeeeeeccCCCcEEEEEcCcCCC-CcccEEEEeCCCcceecc
Q 008611          397 TPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGR-YNNEVHVLKPSHKSTLSS  455 (559)
Q Consensus       397 ~~R~~hs~~~~~~~~~iG~s~~~~~~~~~~~l~v~GG~~~~-~~~~v~~~d~~~~~~~~~  455 (559)
                      .+|.+|+++++++                 .||+|||+++. ..+++++||+.++.|...
T Consensus       236 ~~r~~~~~~~~~~-----------------~i~v~GG~~~~~~~~~~~~yd~~~~~W~~~  278 (306)
T 3ii7_A          236 WKGVTVKCAAVGS-----------------IVYVLAGFQGVGRLGHILEYNTETDKWVAN  278 (306)
T ss_dssp             CCBSCCEEEEETT-----------------EEEEEECBCSSSBCCEEEEEETTTTEEEEE
T ss_pred             CCccceeEEEECC-----------------EEEEEeCcCCCeeeeeEEEEcCCCCeEEeC
Confidence            9999999999966                 89999999765 778999999999977664
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2k48_A Nucleoprotein; viral protein; NMR {Andes virus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 559
d1hbka_89 a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium 3e-25
d1hb6a_86 a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t 6e-22
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-12
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-05
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Plasmodium falciparum [TaxId: 5833]

 Score = 97.6 bits (243), Expect = 3e-25
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQ 73
           + F    S+       N   +  T    N+  L LY  Y+Q+T+G CN+ +PS+   +++
Sbjct: 4   QVFEECVSFI------NGLPR--TINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDR 55

Query: 74  SKWKSWQGLGNMATTEAMRLFVKILEEEDPGW 105
            K+++W+ + N+   +A + +V I+ E  P W
Sbjct: 56  KKYEAWKSVENLNREDAQKRYVDIVSEIFPYW 87
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.97
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 99.96
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.8
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 96.88
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.73
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 96.61
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 96.6
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 96.47
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.58
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.84
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.77
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.37
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.09
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.77
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.5
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.4
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.29
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.19
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.75
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 92.53
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.24
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.27
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 90.92
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.58
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 89.9
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.64
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 89.44
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.39
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 88.71
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 88.56
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 87.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 87.0
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 86.8
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 86.21
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 86.2
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.92
d1tbga_340 beta1-subunit of the signal-transducing G protein 84.91
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 84.42
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 82.91
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.74
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.62
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 81.93
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 81.02
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 80.51
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 80.09
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-33  Score=278.38  Aligned_cols=254  Identities=19%  Similarity=0.277  Sum_probs=219.0

Q ss_pred             cCcceeccc----eEEecccCCCCCCcccceeEEEECCEEEEEccCC----CCcccCcEEEEEcCCCeEEEeeeccccCC
Q 008611          163 GLGSVVVYD----QWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNH----NGRYLSDMHILDLRSWAWSKIQAKAVAES  234 (559)
Q Consensus       163 ~~~~~~~~~----~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG~~----~~~~~~~v~~yd~~t~~W~~~~~~~~~~~  234 (559)
                      .++.++.||    +|+.++   ++|.+|.+|++++++++|||+||..    +...++++++||+.+++|+.+++      
T Consensus        17 ~~~~~~~yd~~t~~W~~~~---~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~------   87 (288)
T d1zgka1          17 SLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAP------   87 (288)
T ss_dssp             BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCC------
T ss_pred             CCceEEEEECCCCeEEECC---CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhccccccccccccc------
Confidence            355677775    899987   4899999999999999999999963    23567899999999999999854      


Q ss_pred             CCCCCCCCCCCCccceeEEeCCEEEEEeccCCCCCCcceEEEEECCCCeEEEeccCCCCCCCccceEEEEECCEEEEEcC
Q 008611          235 TESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGG  314 (559)
Q Consensus       235 ~~~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~lyv~GG  314 (559)
                             +|.+|.+|+++.++++||++||.... ...+.++.||+.++.|....   .+|.+|.+|+++.+.+.+|++||
T Consensus        88 -------~p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~~~~~~~~~GG  156 (288)
T d1zgka1          88 -------MSVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAVLNRLLYAVGG  156 (288)
T ss_dssp             -------CSSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECC
T ss_pred             -------ccceecceeccccceeeEEecceecc-cccceeeeeccccCcccccc---ccccccccceeeeeeecceEecC
Confidence                   47899999999999999999998765 56788999999999999886   57889999999999999999999


Q ss_pred             cCCCCCCcCceEEEECCCCceEEecCCCCCCCcccccEEEEEcCCEEEEEcCCCCCCCcCceEEEECCCCeeEeccCCCC
Q 008611          315 EDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGE  394 (559)
Q Consensus       315 ~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~l~v~GG~~~~~~~~dv~~~d~~~~~W~~~~~~~~  394 (559)
                      .+... ..++++.||+.+++|.....   .+.++..|+++.+ ++.|+++||......+++++.||+.+++|..+   ++
T Consensus       157 ~~~~~-~~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~-~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~---~~  228 (288)
T d1zgka1         157 FDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVL-HNCIYAAGGYDGQDQLNSVERYDVETETWTFV---AP  228 (288)
T ss_dssp             BCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEE-TTEEEEECCBCSSSBCCCEEEEETTTTEEEEC---CC
T ss_pred             ccccc-ccceEEEeeccccccccccc---cccccccccccce-eeeEEEecCccccccccceeeeeecceeeecc---cC
Confidence            87655 47889999999999998864   4778888888887 55699999998888899999999999999998   47


Q ss_pred             CCCCccccEEEEECCceecceeeeeeccCCCcEEEEEcCcCCC-CcccEEEEeCCCcceeccc-CCCCC
Q 008611          395 IPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGR-YNNEVHVLKPSHKSTLSSK-MIETP  461 (559)
Q Consensus       395 ~p~~R~~hs~~~~~~~~~iG~s~~~~~~~~~~~l~v~GG~~~~-~~~~v~~~d~~~~~~~~~~-~~~~~  461 (559)
                      .|.+|.+|+++++++                 +||||||.++. ..+++++||++++.|.... ++.++
T Consensus       229 ~p~~r~~~~~~~~~~-----------------~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R  280 (288)
T d1zgka1         229 MKHRRSALGITVHQG-----------------RIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGR  280 (288)
T ss_dssp             CSSCCBSCEEEEETT-----------------EEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCC
T ss_pred             ccCcccceEEEEECC-----------------EEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCc
Confidence            789999999999976                 89999998775 7789999999999876654 44443
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure