Citrus Sinensis ID: 008689


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------
MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMNTGSDLDCGG
ccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEccccccccEEEEEcccccHHHHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEEEEEcccccccccccccEEEEEEEccccccccccccEEEEEEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHcccEEEEcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEcccccccEEEEEEcccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccccccccccccccccEEEEcccccccccccEEcHHHcEEEEEEccccccccccccEEEEEEEEEEccccEEEEcccccccEEEEcccccccHHHHHHHHHcccccEEEEEEcHHHccccccEcccEcccccEEEEEEEEEccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEcccccEEEEEccccccHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEEccccccccccccEEEEEEEEEcccccEEEcccccccccEEEEEEccccccHHHHHHHHHcccccEEEEEEccccccccccccccccccccccEEEEEEEEEEccccccccEEccccccHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccc
mdedfdipaanemdadmdlpddapmmkvgeekeignQGLKKKLVkegegwdtpengdevevhytgtlldgtqfdssrdrstpfkftlgqgnvikgWDIGIKTmkkgenavftippelaygesgspptippnatlqfDVELLSWTSVKDICKDGGIIKKILKegekwenpkdlDEVLVNYEARLEdgmvvgkadgveftvkdghfcPTLAKAVKTMKKGEKVLLAVkpqygfgekgksasgnegavppnaTLQIALELVSWKTVSEITDDKKVIKKILKegdgferpnegaVVKVKLIGklqdgtvfvkkgHSEEEqlfefktdeeQVIDGLDRAVITMKKNEVALLTIapeyafgsaesqqelavvppnstvHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKaleidpdnrdVKLEYKTLKEKMKEYNKKEAKFYGNMfakmntgsdldcgg
mdedfdipaanemdadmdlpDDAPMMKVGeekeignqglkkKLVKEgegwdtpengdEVEVHYTGTLLDGTQFDSSRDRSTpfkftlgqgnvikGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKIlkegekwenpkdlDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKtvseitddkkVIKKIlkegdgferpnegavVKVKLIGKLQDGTVFVKKGHSEEeqlfefktdeeqVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSfekekeswdmNTEEKIeaagkkkeqgntlfkagkyaraskrYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCtkvldldsrnVKALYRRAQAYIQMADLDLAEFDIKKaleidpdnrdvKLEYKTLKEKMKEYNKKEAKfygnmfakmntgsdldcgg
MDEDFDIPAANEmdadmdlpddapmmKVGEEKEIGNQglkkklvkegegWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVkdickdggiikkilkegekWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTeekieaagkkkeQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMNTGSDLDCGG
**********************************************************VEVHYTGTLLDGT**********PFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAY***********NATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGF*****************ATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSA****ELAVVPPNSTVHYEVELVSF****************************FKAGKYARASKRYEKAVKYIEYDTSFGD****QAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKT**************FYGNM**************
****FDI*************************EIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEK**********VPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQ****VVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTS******KQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMF*************
MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE*********GAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMNTGSDLDCGG
*********ANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMNTGS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDxxxxxxxxxxxxxxxxxxxxxEAKFYGNMFAKMNTGSDLDCGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query557 2.2.26 [Sep-21-2011]
Q38931551 Peptidyl-prolyl cis-trans yes no 0.982 0.992 0.821 0.0
Q9FJL3578 Peptidyl-prolyl cis-trans no no 0.955 0.920 0.799 0.0
Q43207559 70 kDa peptidyl-prolyl is N/A no 0.985 0.982 0.789 0.0
Q9TRY0459 Peptidyl-prolyl cis-trans yes no 0.684 0.830 0.374 5e-68
Q02790459 Peptidyl-prolyl cis-trans yes no 0.684 0.830 0.364 8e-68
P30416458 Peptidyl-prolyl cis-trans yes no 0.684 0.831 0.362 2e-65
Q9QVC8458 Peptidyl-prolyl cis-trans yes no 0.684 0.831 0.359 4e-65
P27124458 Peptidyl-prolyl cis-trans yes no 0.684 0.831 0.369 5e-63
Q64378456 Peptidyl-prolyl cis-trans no no 0.687 0.839 0.358 6e-62
Q9XSI2457 Peptidyl-prolyl cis-trans N/A no 0.687 0.838 0.353 2e-60
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function desciption
 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/550 (82%), Positives = 500/550 (90%), Gaps = 3/550 (0%)

Query: 1   MDEDFDIPAANEMDADMDLPDD--APMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDE 58
           MD +F++P    M+ D D+     A  +KVGEEKEI  QGLKKKL+KEGEG++TPENGDE
Sbjct: 1   MDANFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDE 59

Query: 59  VEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELA 118
           VEVHYTGTLLDGT+FDSSRDR+TPFKFTLGQG VIKGWDIGIKTMKKGENAVFTIP ELA
Sbjct: 60  VEVHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELA 119

Query: 119 YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVN 178
           YGESGSPPTIP NATLQFDVELL W SVKDICKDGG+ KKIL  GEKWENPKDLDEVLV 
Sbjct: 120 YGESGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVK 179

Query: 179 YEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSA 238
           +EA+LEDG VVGK+DGVEFTVKDGHFCP L KAVKTMKKGEKVLL VKPQYGFGEKGK A
Sbjct: 180 FEAKLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPA 239

Query: 239 SGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIG 298
           S  EGAVPPNATL+I LELVSWKTVSE+TDD KV+KK+LKEGDG+ERPNEGAVVKVKLIG
Sbjct: 240 SAGEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIG 299

Query: 299 KLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAE 358
           KLQDGTVF+KKGH E E+ FEFKTDEEQV+DGLDRAV+ MKK EVAL+TI PEYAFGS E
Sbjct: 300 KLQDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFGSNE 359

Query: 359 SQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARA 418
           SQQELAVVPPNSTV YEV+L++F+KE+ESWDMNTEEKIEAA KKKE+GN+ FK GKY+ A
Sbjct: 360 SQQELAVVPPNSTVTYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLA 419

Query: 419 SKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLD 478
           SKRYEKAVK+IEYDTSF +EEKKQAKALKVACNLN+AACKLKLKDYKQAEKLCTKVL+L+
Sbjct: 420 SKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELE 479

Query: 479 SRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAK 538
           S NVKALYRRAQAY++++DLDLAEFD+KKALEIDP+NR+VKLE K LKEKMKE+NKKEAK
Sbjct: 480 STNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAK 539

Query: 539 FYGNMFAKMN 548
           FYGNMFAK++
Sbjct: 540 FYGNMFAKLS 549




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Co-chaperone that positively modulates thermotolerance by interacting with HSP90.1 and increasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
359497288571 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.983 0.959 0.870 0.0
255589766574 peptidylprolyl isomerase, putative [Rici 0.996 0.966 0.852 0.0
224065421575 predicted protein [Populus trichocarpa] 0.992 0.961 0.853 0.0
255587695583 peptidylprolyl isomerase, putative [Rici 0.994 0.950 0.854 0.0
355329948573 FK506-binding protein [Nicotiana tabacum 0.982 0.954 0.852 0.0
356527318544 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.969 0.992 0.828 0.0
449463204553 PREDICTED: peptidyl-prolyl cis-trans iso 0.982 0.989 0.839 0.0
356567794544 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.969 0.992 0.819 0.0
297831424551 peptidylprolyl isomerase [Arabidopsis ly 0.982 0.992 0.826 0.0
9294180555 peptidylprolyl isomerase; FK506-binding 0.983 0.987 0.820 0.0
>gi|359497288|ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|296085741|emb|CBI29552.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/548 (87%), Positives = 513/548 (93%)

Query: 1   MDEDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVE 60
           MDEDFDIPAA EM+ DMDLPD++P++KVGEEKEIG QGLKKKLVKEGEGWDTPENGDEVE
Sbjct: 1   MDEDFDIPAAEEMNDDMDLPDESPILKVGEEKEIGKQGLKKKLVKEGEGWDTPENGDEVE 60

Query: 61  VHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYG 120
           VHYTGTLLDGTQFDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGENA+FTIPPELAYG
Sbjct: 61  VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG 120

Query: 121 ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYE 180
           ESGS  TIPPNATLQFDVELLSWTSVKDICKDGGI KKI+ EG+KWENPKDLDEV V YE
Sbjct: 121 ESGSSTTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIVTEGDKWENPKDLDEVFVKYE 180

Query: 181 ARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASG 240
           ARLEDG +V K+DGVEFTVK+ +FCP L+KAVKTMKKGEKV+L VKPQYGFGEKGK ASG
Sbjct: 181 ARLEDGTLVAKSDGVEFTVKEDYFCPALSKAVKTMKKGEKVILTVKPQYGFGEKGKPASG 240

Query: 241 NEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKL 300
            EGAVPPNATL+I LELVSWKTV+E+TDDKKVIKKILKEG+G+ERPNEGAVVK+KLIGKL
Sbjct: 241 EEGAVPPNATLEITLELVSWKTVTEVTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKL 300

Query: 301 QDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQ 360
           QDGTVF+KKGH E E LFEFKTD+EQVIDGLDRAV+TMKK EVALLTI  +YAFGS+ES 
Sbjct: 301 QDGTVFLKKGHGEGEDLFEFKTDDEQVIDGLDRAVMTMKKGEVALLTIHSDYAFGSSESS 360

Query: 361 QELAVVPPNSTVHYEVELVSFEKEKESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASK 420
           QELAVVPPNSTV+YEVEL SF K+KESWDMNTEEKIEAAGKKKE+GN LFKAGKYARASK
Sbjct: 361 QELAVVPPNSTVYYEVELESFVKDKESWDMNTEEKIEAAGKKKEEGNVLFKAGKYARASK 420

Query: 421 RYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLDSR 480
           RYEKA KYIEYD+SFG+EEKKQAK LKV CNLNNAACKLKLKDYK+AEKLCTKVLD+ S+
Sbjct: 421 RYEKAAKYIEYDSSFGEEEKKQAKTLKVTCNLNNAACKLKLKDYKEAEKLCTKVLDIQSK 480

Query: 481 NVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFY 540
           NVKALYRRAQAYI +ADLDLAEFDIKKALEIDPDNRDVKLEY+TLKEKMKEYNKKEAKFY
Sbjct: 481 NVKALYRRAQAYIHLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFY 540

Query: 541 GNMFAKMN 548
           GNMFA+MN
Sbjct: 541 GNMFARMN 548




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255589766|ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224065421|ref|XP_002301809.1| predicted protein [Populus trichocarpa] gi|222843535|gb|EEE81082.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255587695|ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223525436|gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|355329948|dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|356527318|ref|XP_003532258.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
>gi|449463204|ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] gi|449515125|ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356567794|ref|XP_003552100.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
>gi|297831424|ref|XP_002883594.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata] gi|297329434|gb|EFH59853.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9294180|dbj|BAB02082.1| peptidylprolyl isomerase; FK506-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
TAIR|locus:2090265562 ROF1 "AT3G25230" [Arabidopsis 0.980 0.971 0.748 1.2e-218
TAIR|locus:2152561578 ROF2 "AT5G48570" [Arabidopsis 0.935 0.901 0.741 1.9e-211
UNIPROTKB|Q7F1F2580 OJ1191_A10.119 "cDNA clone:J03 0.933 0.896 0.748 2.7e-210
UNIPROTKB|Q9XFE4585 OSJNBa0091C07.4 "OSJNBa0091C07 0.931 0.887 0.721 1.4e-204
UNIPROTKB|Q6K5Q1682 P0579G08.8 "Putative peptidylp 0.951 0.777 0.656 2.5e-191
UNIPROTKB|A8J0I6569 FKB62 "Peptidyl-prolyl cis-tra 0.622 0.609 0.459 1.3e-88
UNIPROTKB|Q657L6422 P0468H06.14-3 "Peptidyl-prolyl 0.574 0.758 0.457 3.3e-70
UNIPROTKB|F1NIM4442 FKBP4 "Uncharacterized protein 0.658 0.830 0.371 9.7e-64
UNIPROTKB|F1NP08464 FKBP4 "Uncharacterized protein 0.658 0.790 0.371 9.7e-64
UNIPROTKB|F1MU79459 FKBP4 "Peptidyl-prolyl cis-tra 0.658 0.799 0.360 3.9e-60
TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2112 (748.5 bits), Expect = 1.2e-218, P = 1.2e-218
 Identities = 411/549 (74%), Positives = 453/549 (82%)

Query:     1 MDEDFDIPAAN--EXXXXXXXXXXXXXXKVGEEKEIGNQXXXXXXXXXXXXWDTPENGDE 58
             MD +F++P                    KVGEEKEI  Q            ++TPENGDE
Sbjct:     1 MDANFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDE 59

Query:    59 VEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELA 118
             VEVHYTGTLLDGT+FDSSRDR+TPFKFTLGQG VIKGWDIGIKTMKKGENAVFTIP ELA
Sbjct:    60 VEVHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELA 119

Query:   119 YGESGSPPTIPPNATLQFDVELLSWTSVXXXXXXXXXXXXXXXXXXXWENPKDLDEVLVN 178
             YGESGSPPTIP NATLQFDVELL W SV                   WENPKDLDEVLV 
Sbjct:   120 YGESGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVK 179

Query:   179 YEARLEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSA 238
             +EA+LEDG VVGK+DGVEFTVKDGHFCP L KAVKTMKKGEKVLL VKPQYGFGEKGK A
Sbjct:   180 FEAKLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPA 239

Query:   239 SGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDGFERPNEGAVVKVKLIG 298
             S  EGAVPPNATL+I LELVSWKTVSE+TDD KV+KK+LKEGDG+ERPNEGAVVKVKLIG
Sbjct:   240 SAGEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIG 299

Query:   299 KLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAE 358
             KLQDGTVF+KKGH E E+ FEFKTDEEQV+DGLDRAV+ MKK EVAL+TI PEYAFGS E
Sbjct:   300 KLQDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFGSNE 359

Query:   359 SQQELAVVPPNSTVHYEVELVSFEKEKESWDMNTXXXXXXXXXXXXQGNTLFKAGKYARA 418
             SQQELAVVPPNSTV YEV+L++F+KE+ESWDMNT            +GN+ FK GKY+ A
Sbjct:   360 SQQELAVVPPNSTVTYEVDLLTFDKERESWDMNTEEKIEAASKKKEEGNSKFKGGKYSLA 419

Query:   419 SKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVLDLD 478
             SKRYEKAVK+IEYDTSF +EEKKQAKALKVACNLN+AACKLKLKDYKQAEKLCTKVL+L+
Sbjct:   420 SKRYEKAVKFIEYDTSFSEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELE 479

Query:   479 SRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAK 538
             S NVKALYRRAQAY++++DLDLAEFD+KKALEIDP+NR+VKLE K LKEKMKE+NKKEAK
Sbjct:   480 STNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAK 539

Query:   539 FYGNMFAKM 547
             FYGNMFAK+
Sbjct:   540 FYGNMFAKL 548




GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009408 "response to heat" evidence=RCA;IMP
GO:0070370 "cellular heat acclimation" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006457 "protein folding" evidence=RCA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009845 "seed germination" evidence=IMP
GO:0032266 "phosphatidylinositol-3-phosphate binding" evidence=IDA
GO:0071944 "cell periphery" evidence=IDA
GO:0080025 "phosphatidylinositol-3,5-bisphosphate binding" evidence=IDA
GO:0009611 "response to wounding" evidence=IEP
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q657L6 P0468H06.14-3 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MU79 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FJL3FKB65_ARATH5, ., 2, ., 1, ., 80.79960.95510.9204nono
Q43207FKB70_WHEAT5, ., 2, ., 1, ., 80.78910.98560.9821N/Ano
Q38931FKB62_ARATH5, ., 2, ., 1, ., 80.82180.98200.9927yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.998
4th Layer5.2.1.80.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00011129001
SubName- Full=Chromosome undetermined scaffold_2180, whole genome shotgun sequence; (571 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-41
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 4e-40
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 3e-23
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 4e-23
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 6e-23
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-17
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 1e-16
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-14
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 3e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-10
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 4e-09
TIGR03516177 TIGR03516, ppisom_GldI, peptidyl-prolyl isomerase, 1e-08
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 3e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 8e-07
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 2e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 6e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-05
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 6e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 1e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 2e-04
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 3e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-04
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 6e-04
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 0.001
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 0.002
pfam1342844 pfam13428, TPR_14, Tetratricopeptide repeat 0.002
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.002
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
COG3063 250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 0.003
pfam1341469 pfam13414, TPR_11, TPR repeat 0.004
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.004
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
 Score =  143 bits (364), Expect = 2e-41
 Identities = 59/94 (62%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 49  GWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGEN 108
           G +  + GD V VHYTG L DGT FDSS+DR  PF+FTLG G VI GWD G+  MK GE 
Sbjct: 1   GPEKAKKGDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEK 60

Query: 109 AVFTIPPELAYGESGS-PPTIPPNATLQFDVELL 141
              TIPPELAYGE G     IPPNATL F+VELL
Sbjct: 61  RKLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94


Length = 94

>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|132555 TIGR03516, ppisom_GldI, peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|222121 pfam13428, TPR_14, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 557
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 100.0
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.94
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.94
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.88
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.87
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.87
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.86
KOG0553304 consensus TPR repeat-containing protein [General f 99.85
KOG4234271 consensus TPR repeat-containing protein [General f 99.85
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.82
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.79
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.77
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.75
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.74
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.74
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.71
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.7
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.69
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.69
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.68
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.65
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.63
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.6
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.55
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.55
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.51
PRK15359144 type III secretion system chaperone protein SscB; 99.49
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.42
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.4
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.38
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 99.38
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.36
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.35
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.27
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.2
PRK11189296 lipoprotein NlpI; Provisional 99.19
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.18
PRK10370198 formate-dependent nitrite reductase complex subuni 99.15
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.13
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.11
KOG1126638 consensus DNA-binding cell division cycle control 99.06
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.06
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.05
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.0
PRK15331165 chaperone protein SicA; Provisional 99.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.99
PRK15359144 type III secretion system chaperone protein SscB; 98.98
KOG4555175 consensus TPR repeat-containing protein [Function 98.98
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.97
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.96
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.96
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.95
PRK10370198 formate-dependent nitrite reductase complex subuni 98.95
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.93
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.93
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 98.91
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.9
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.89
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.89
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.88
PRK12370553 invasion protein regulator; Provisional 98.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.87
KOG0553 304 consensus TPR repeat-containing protein [General f 98.87
PRK12370 553 invasion protein regulator; Provisional 98.86
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.86
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.85
PF1337173 TPR_9: Tetratricopeptide repeat 98.83
PRK01490435 tig trigger factor; Provisional 98.83
PRK11189 296 lipoprotein NlpI; Provisional 98.83
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.81
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.79
PRK10803263 tol-pal system protein YbgF; Provisional 98.79
KOG1126638 consensus DNA-binding cell division cycle control 98.78
KOG1125579 consensus TPR repeat-containing protein [General f 98.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.77
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.74
PF13512142 TPR_18: Tetratricopeptide repeat 98.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.73
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.7
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.69
PLN02789 320 farnesyltranstransferase 98.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.66
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.64
KOG2076 895 consensus RNA polymerase III transcription factor 98.64
PRK11788389 tetratricopeptide repeat protein; Provisional 98.63
PRK11788389 tetratricopeptide repeat protein; Provisional 98.62
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.61
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.61
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.6
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.6
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.59
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.59
KOG1310 758 consensus WD40 repeat protein [General function pr 98.58
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.57
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.57
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.55
PLN02789 320 farnesyltranstransferase 98.54
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.53
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.52
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.52
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.47
KOG2003 840 consensus TPR repeat-containing protein [General f 98.45
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.44
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.44
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.43
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.43
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.39
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.39
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.36
PRK14574 822 hmsH outer membrane protein; Provisional 98.36
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.36
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.35
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.34
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.3
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.28
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.27
PF1337173 TPR_9: Tetratricopeptide repeat 98.27
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 98.26
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.23
KOG1125579 consensus TPR repeat-containing protein [General f 98.22
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.21
PF12688120 TPR_5: Tetratrico peptide repeat 98.21
KOG1129478 consensus TPR repeat-containing protein [General f 98.2
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.15
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.13
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.12
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 98.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.11
PRK01490435 tig trigger factor; Provisional 98.1
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.1
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.1
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.09
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.08
PRK14574 822 hmsH outer membrane protein; Provisional 98.07
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.05
KOG2076 895 consensus RNA polymerase III transcription factor 98.05
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.02
KOG1129 478 consensus TPR repeat-containing protein [General f 98.01
PRK10803263 tol-pal system protein YbgF; Provisional 98.0
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.0
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.99
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.99
PF1343134 TPR_17: Tetratricopeptide repeat 97.97
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.97
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.96
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.96
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.94
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.93
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 97.91
KOG4234271 consensus TPR repeat-containing protein [General f 97.9
PF1342844 TPR_14: Tetratricopeptide repeat 97.9
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.89
KOG1586288 consensus Protein required for fusion of vesicles 97.89
PF12688120 TPR_5: Tetratrico peptide repeat 97.87
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.85
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.83
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.82
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.82
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.81
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.8
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.8
PRK11906458 transcriptional regulator; Provisional 97.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.76
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 97.73
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.72
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.7
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.69
COG4700251 Uncharacterized protein conserved in bacteria cont 97.69
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.65
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.64
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.59
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.59
PF1342844 TPR_14: Tetratricopeptide repeat 97.59
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.58
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.57
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.56
KOG4555175 consensus TPR repeat-containing protein [Function 97.56
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.54
PRK10941269 hypothetical protein; Provisional 97.54
KOG2003 840 consensus TPR repeat-containing protein [General f 97.53
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.51
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.5
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.49
PRK15331165 chaperone protein SicA; Provisional 97.43
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.41
PF13512142 TPR_18: Tetratricopeptide repeat 97.39
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.39
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.33
KOG3364149 consensus Membrane protein involved in organellar 97.32
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.31
PRK11906458 transcriptional regulator; Provisional 97.3
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.29
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.28
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.22
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.2
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.18
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.15
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.12
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.05
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.05
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.01
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.01
KOG0495 913 consensus HAT repeat protein [RNA processing and m 96.93
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.92
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.9
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.89
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.89
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.85
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.8
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.76
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.74
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.68
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.67
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.66
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.66
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.62
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.58
COG4105 254 ComL DNA uptake lipoprotein [General function pred 96.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.49
KOG1586288 consensus Protein required for fusion of vesicles 96.44
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.39
PF1343134 TPR_17: Tetratricopeptide repeat 96.34
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.28
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.24
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.23
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.11
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.1
KOG2471 696 consensus TPR repeat-containing protein [General f 96.1
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.1
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.08
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.03
KOG1585308 consensus Protein required for fusion of vesicles 95.99
COG2912269 Uncharacterized conserved protein [Function unknow 95.97
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.79
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.75
KOG1585 308 consensus Protein required for fusion of vesicles 95.67
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.63
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.63
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 95.59
PRK04841 903 transcriptional regulator MalT; Provisional 95.49
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.44
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.44
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.41
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.29
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.29
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.26
PLN03218 1060 maturation of RBCL 1; Provisional 95.13
COG3629280 DnrI DNA-binding transcriptional activator of the 95.12
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.11
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.06
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.01
PLN03218 1060 maturation of RBCL 1; Provisional 94.99
PRK04841 903 transcriptional regulator MalT; Provisional 94.93
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.92
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.91
COG3947361 Response regulator containing CheY-like receiver a 94.9
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.85
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.81
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 94.66
COG4700251 Uncharacterized protein conserved in bacteria cont 94.43
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.41
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.39
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.32
KOG4814 872 consensus Uncharacterized conserved protein [Funct 94.32
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.14
PLN03077 857 Protein ECB2; Provisional 94.06
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.01
KOG2300 629 consensus Uncharacterized conserved protein [Funct 94.01
PLN03077857 Protein ECB2; Provisional 93.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.68
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.62
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.52
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.52
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 93.11
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.09
KOG3364149 consensus Membrane protein involved in organellar 93.02
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.97
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 92.49
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.42
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.25
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 91.94
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.81
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.67
COG5191 435 Uncharacterized conserved protein, contains HAT (H 91.58
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 91.45
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 91.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.35
PRK10941269 hypothetical protein; Provisional 91.13
KOG2796366 consensus Uncharacterized conserved protein [Funct 91.07
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 91.06
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 90.94
KOG2471 696 consensus TPR repeat-containing protein [General f 90.89
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.84
KOG2422 665 consensus Uncharacterized conserved protein [Funct 90.78
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.77
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.33
KOG2300 629 consensus Uncharacterized conserved protein [Funct 90.16
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 90.13
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 90.05
PF0421269 MIT: MIT (microtubule interacting and transport) d 89.76
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 89.59
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 89.54
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.52
COG4976 287 Predicted methyltransferase (contains TPR repeat) 89.37
cd0267979 MIT_spastin MIT: domain contained within Microtubu 89.01
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.92
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.69
cd0265675 MIT MIT: domain contained within Microtubule Inter 88.57
KOG1550 552 consensus Extracellular protein SEL-1 and related 88.56
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.49
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 88.45
KOG2610 491 consensus Uncharacterized conserved protein [Funct 88.39
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 87.9
PF13281374 DUF4071: Domain of unknown function (DUF4071) 87.71
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 87.55
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.4
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 87.13
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 86.59
PHA02537230 M terminase endonuclease subunit; Provisional 86.44
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.36
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.33
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.08
smart0074577 MIT Microtubule Interacting and Trafficking molecu 85.64
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 85.56
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 85.34
COG4455 273 ImpE Protein of avirulence locus involved in tempe 85.15
KOG2047 835 consensus mRNA splicing factor [RNA processing and 84.11
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 83.7
KOG0529 421 consensus Protein geranylgeranyltransferase type I 83.07
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 82.83
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 82.82
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.74
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.68
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 82.63
KOG2581 493 consensus 26S proteasome regulatory complex, subun 82.27
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 81.53
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 81.36
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.28
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 81.26
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.26
COG3898 531 Uncharacterized membrane-bound protein [Function u 80.92
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.86
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 80.57
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 80.48
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 80.2
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.9e-66  Score=504.44  Aligned_cols=354  Identities=50%  Similarity=0.814  Sum_probs=334.3

Q ss_pred             ccccccCCCCCCeEEEEEEEEeCCCeEeeec---cceEEEecCCCCCchHHHHHhhccCCcEEEEEecCCCccCCCCCCC
Q 008689          162 EGEKWENPKDLDEVLVNYEARLEDGMVVGKA---DGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSA  238 (557)
Q Consensus       162 ~g~g~~~~~~~d~V~v~y~~~~~~g~~~~~~---~~~~~~~g~~~~~~gl~~~l~~m~~Ge~~~i~vp~~~~~g~~g~~~  238 (557)
                      +|+|+.+|..|+.|.+||++++.+|+.|+++   +|+.|.+|.|+++.||..++.+|+.              |+.+.| 
T Consensus         2 eg~g~~~p~~g~~v~~hytg~l~dgt~fdss~d~~~~~~~lg~g~vi~~~~~gv~tm~~--------------g~~~~p-   66 (397)
T KOG0543|consen    2 EGTGTETPMTGDKVEVHYTGTLLDGTKFDSSRDGDPFKFDLGKGSVIKGWDLGVATMKK--------------GEAGSP-   66 (397)
T ss_pred             CCCCccCCCCCceeEEEEeEEecCCeecccccCCCceeeecCCCccccccccccccccc--------------cccCCC-
Confidence            6888999999999999999999999999988   5899999999999999999999998              666665 


Q ss_pred             CCCCCCCCCCCeEEEEEEeecccceeeeeCCcceeEEEEeCCCC-CCCCCCCCEEEEEEEEEecCCcEEEecCCCCCccc
Q 008689          239 SGNEGAVPPNATLQIALELVSWKTVSEITDDKKVIKKILKEGDG-FERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQL  317 (557)
Q Consensus       239 ~~~~~~ip~~~~l~~~v~l~~~~~~~d~~~d~~~~kkil~~G~g-~~~p~~~~~v~v~~~~~l~~g~~~~~~~~~~~~~~  317 (557)
                          +.||++++|.|+|+|.          |++|+|+|+++|.| ..+|..|..|+|||.+.+.|+ +|+++..     .
T Consensus        67 ----p~ip~~a~l~fe~el~----------Dg~iiKriir~G~gd~~~P~~g~~V~v~~~G~~~~~-~f~~~~~-----~  126 (397)
T KOG0543|consen   67 ----PKIPSNATLLFEVELL----------DGGIIKRIIREGEGDYSRPNKGAVVKVHLEGELEDG-VFDQREL-----R  126 (397)
T ss_pred             ----CCCCCCcceeeeeccc----------CCceEEeeeecCCCCCCCCCCCcEEEEEEEEEECCc-ceecccc-----c
Confidence                7899999999999998          89999999999999 789999999999999999988 7776543     3


Q ss_pred             EEEEcCc-cchhhHHHHHHhccCcCcEEEEEEcCCCccCCccccccccCCCCCceEEEEEEEeeee-ecccccCCChHHH
Q 008689          318 FEFKTDE-EQVIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFE-KEKESWDMNTEEK  395 (557)
Q Consensus       318 ~~~~lg~-~~vi~gle~~l~~M~~GE~~~v~i~~~~~yg~~~~~~~~~~ip~~~~l~~~ieL~~~~-~~~~~~~~~~~e~  395 (557)
                      |+|.+|+ ..+|.||++||++|++||+|.|+|+|+|+||..+..  .+.|||++++.|+|+|++|. +....|.+..+++
T Consensus       127 fe~~~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~--~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~  204 (397)
T KOG0543|consen  127 FEFGEGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGE--PPLIPPNATLLYEVELLDFELKEDESWKMFAEER  204 (397)
T ss_pred             eEEecCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCCC--CCCCCCCceEEEEEEEEeeecCcccccccchHHH
Confidence            8889999 689999999999999999999999999999955433  36899999999999999999 8899999999999


Q ss_pred             HHHHhhhHHHHHHHHHcCcHHHHHHHHHHHHHHhhhcCCCChHHHHHHHHHHHHHHhhHHHHHHhhhCHHHHHHHHHHHH
Q 008689          396 IEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDYKQAEKLCTKVL  475 (557)
Q Consensus       396 ~~~a~~~k~~G~~~~~~~~y~~A~~~y~~Al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~~~k~~~~~~A~~~~~~al  475 (557)
                      +..|...|+.||.+|+.++|..|+..|.+|++++.+....++++......+++.||+|+|.||+|+++|..|+.+|++||
T Consensus       205 l~~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvL  284 (397)
T KOG0543|consen  205 LEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVL  284 (397)
T ss_pred             HHHHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCC
Q 008689          476 DLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMFAKMNTGSD  552 (557)
Q Consensus       476 ~~~p~~~ka~~~~g~a~~~lg~~~~A~~~~~~al~l~p~n~~~~~~l~~l~~~~~~~~~~~~~~~~~mf~~~~~~~~  552 (557)
                      .++|+|+||+||+|+||+.+++|+.|+.+|++|++++|+|++++.+|.+|+++.++++++++++|++||.++...++
T Consensus       285 e~~~~N~KALyRrG~A~l~~~e~~~A~~df~ka~k~~P~Nka~~~el~~l~~k~~~~~~kekk~y~~mF~k~~~~~~  361 (397)
T KOG0543|consen  285 ELDPNNVKALYRRGQALLALGEYDLARDDFQKALKLEPSNKAARAELIKLKQKIREYEEKEKKMYANMFAKLAEESA  361 (397)
T ss_pred             hcCCCchhHHHHHHHHHHhhccHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999986543



>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
3jym_A377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-148
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-145
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-30
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 7e-55
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-54
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 1e-51
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 2e-49
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 5e-34
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-23
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 1e-12
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 1e-32
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 2e-26
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 8e-13
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 7e-29
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 3e-09
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 6e-28
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 2e-12
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 1e-27
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 5e-27
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 4e-13
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 8e-27
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 3e-13
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 8e-27
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-13
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 8e-26
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 1e-12
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 1e-25
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 1e-12
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 1e-25
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 1e-12
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 1e-25
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 1e-12
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 6e-25
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 6e-09
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-24
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 2e-05
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-24
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 3e-09
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-24
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 1e-06
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-24
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-06
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-24
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-07
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-24
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-06
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-24
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 4e-24
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-08
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 5e-24
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-08
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 5e-24
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-08
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 6e-24
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-08
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 6e-24
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 1e-06
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 6e-24
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-08
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 8e-24
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 3e-08
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 8e-24
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 7e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-23
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 1e-08
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-23
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-06
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 3e-23
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 9e-08
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 4e-23
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 1e-07
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 7e-23
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-08
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 1e-22
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 4e-09
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 3e-22
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 2e-08
2pbc_A102 Fk506-Binding Protein 2 Length = 102 4e-22
2pbc_A102 Fk506-Binding Protein 2 Length = 102 9e-05
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-21
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 6e-21
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 1e-04
2ki3_A126 Structural And Biochemical Characterization Of Fk50 7e-21
2ki3_A126 Structural And Biochemical Characterization Of Fk50 2e-09
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 6e-20
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 4e-10
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 6e-20
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 4e-10
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 7e-18
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 3e-13
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 3e-17
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 3e-17
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 7e-17
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 1e-12
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 8e-16
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 6e-14
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 1e-13
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 1e-11
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 1e-11
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 2e-11
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 6e-06
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 2e-10
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 5e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 4e-09
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 3e-07
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 5e-04
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 3e-07
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 5e-04
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 3e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-06
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 1e-06
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-06
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 2e-06
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 2e-06
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 4e-04
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 3e-06
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 4e-04
2f4e_A180 N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia 1e-05
2f4e_A180 N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia 6e-04
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-05
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 1e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-04
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 2e-04
4dt4_A169 Crystal Structure Of The Ppiase-Chaperone Slpa With 3e-04
1wao_1 477 Pp5 Structure Length = 477 3e-04
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 4e-04
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure

Iteration: 1

Score = 523 bits (1347), Expect = e-148, Method: Compositional matrix adjust. Identities = 269/363 (74%), Positives = 293/363 (80%), Gaps = 2/363 (0%) Query: 27 KVGEEKEIGNQXXXXXXXXXXXXWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFT 86 KVGEE EIG Q WDTPE GDEVEVHYTGTLLDG +FDSSRDR FKF Sbjct: 17 KVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFK 76 Query: 87 LGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSV 146 LGQG VIKGWD GIKTMKKGENA+FTIPPELAYGESGSPPTIP NATLQFDVELLSWTSV Sbjct: 77 LGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSV 136 Query: 147 XXXXXXXXXXXXXXXXXXXWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCP 206 WENPKD DEV V YEARLEDG VV K++GVEFTVKDGH CP Sbjct: 137 RDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCP 196 Query: 207 TLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEI 266 LAKAVKTMKKGEKVLLAVKPQYGFGE G+ A+G GAVPPNA+L I LELVSWKTV+EI Sbjct: 197 ALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI 256 Query: 267 TDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQ 326 DDKK++KK+LKE +G+ERPNEGAVV VK+ GKLQDGTVF+KKGH E+E FEFKTDEE Sbjct: 257 GDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEP-FEFKTDEEA 315 Query: 327 VIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKE 386 VI+GLDRAV+ MKK EVAL+TI PEYA+GS ES+Q+ A+VPPNSTV YEVELVSF K+KE Sbjct: 316 VIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQD-AIVPPNSTVIYEVELVSFVKDKE 374 Query: 387 SWD 389 SWD Sbjct: 375 SWD 377
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|4DT4|A Chain A, Crystal Structure Of The Ppiase-Chaperone Slpa With The Chaperone Binding Site Occupied By The Linker Of The Purification Tag Length = 169 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-160
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-57
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-125
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-100
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 6e-24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-18
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 4e-95
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-58
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 4e-29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 9e-90
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-30
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-20
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-66
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 4e-26
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-66
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-63
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 8e-27
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-19
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-63
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-24
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 2e-17
2ppn_A107 FK506-binding protein 1A; high resolution protein 6e-63
2ppn_A107 FK506-binding protein 1A; high resolution protein 2e-25
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-17
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-61
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 3e-23
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 9e-16
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-61
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-25
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-18
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 4e-59
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 5e-23
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 7e-16
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 9e-59
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 2e-58
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 1e-26
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 5e-17
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 6e-58
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 8e-21
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 2e-12
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 1e-56
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-26
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 4e-16
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 9e-56
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 8e-32
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-25
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-55
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 1e-29
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 5e-25
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 3e-55
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 3e-19
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 5e-12
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 3e-53
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 3e-28
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-20
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 2e-52
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 6e-20
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 8e-16
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 3e-52
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 1e-29
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 1e-22
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-51
1jvw_A167 Macrophage infectivity potentiator; chagas disease 3e-16
1jvw_A167 Macrophage infectivity potentiator; chagas disease 6e-12
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-51
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 5e-19
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 9e-14
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 4e-49
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 8e-18
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-10
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-48
1fd9_A213 Protein (macrophage infectivity potentiator prote; 3e-39
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-14
1fd9_A213 Protein (macrophage infectivity potentiator prote; 4e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-39
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-37
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 4e-13
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 3e-09
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 3e-37
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-14
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 6e-09
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-27
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-26
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-26
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-25
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 2e-22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-22
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-17
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-15
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-20
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-19
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-20
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-10
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 4e-19
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 1e-05
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-17
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-09
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 3e-16
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 9e-05
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 3e-16
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 4e-06
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 1e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-16
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-16
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 1e-15
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 4e-06
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 1e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-13
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-09
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 1e-14
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-04
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 2e-14
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-13
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-05
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-08
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 4e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-08
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-04
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-09
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 7e-09
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-08
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 1e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-05
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 5e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 8e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-06
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-06
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 2e-04
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 3e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 9e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-04
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-05
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 5e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 6e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-04
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
 Score =  460 bits (1184), Expect = e-160
 Identities = 289/358 (80%), Positives = 318/358 (88%), Gaps = 2/358 (0%)

Query: 27  KVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFT 86
           KVGEE EIG QGLKKKL+KEGEGWDTPE GDEVEVHYTGTLLDG +FDSSRDR   FKF 
Sbjct: 1   KVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFK 60

Query: 87  LGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSV 146
           LGQG VIKGWD GIKTMKKGENA+FTIPPELAYGESGSPPTIP NATLQFDVELLSWTSV
Sbjct: 61  LGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSV 120

Query: 147 KDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVGKADGVEFTVKDGHFCP 206
           +DI KDGGI KKILKEG+KWENPKD DEV V YEARLEDG VV K++GVEFTVKDGH CP
Sbjct: 121 RDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCP 180

Query: 207 TLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEI 266
            LAKAVKTMKKGEKVLLAVKPQYGFGE G+ A+G  GAVPPNA+L I LELVSWKTV+EI
Sbjct: 181 ALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI 240

Query: 267 TDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQ 326
            DDKK++KK+LKE +G+ERPNEGAVV VK+ GKLQDGTVF+KKGH +E++ FEFKTDEE 
Sbjct: 241 GDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGH-DEQEPFEFKTDEEA 299

Query: 327 VIDGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKE 384
           VI+GLDRAV+ MKK EVAL+TI PEYA+GS ES+Q+ A+VPPNSTV YEVELVSF K+
Sbjct: 300 VIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQD-AIVPPNSTVIYEVELVSFVKD 356


>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 100.0
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 100.0
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.93
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.91
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.91
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.91
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.9
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.9
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.9
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.9
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.9
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.89
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.89
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.89
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.88
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.88
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.88
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.88
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.88
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.88
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.88
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.88
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.87
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.87
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.87
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.84
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.83
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.83
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.83
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.82
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.82
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.82
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.82
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.81
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.81
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.8
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.8
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.79
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.79
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.78
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.78
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.78
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.78
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.78
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.77
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.77
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.77
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.75
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.75
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.75
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.74
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.74
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.74
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.74
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.73
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.72
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.72
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.72
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.7
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.69
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.68
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.65
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.63
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.62
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.58
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.57
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.57
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.54
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.51
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.47
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.46
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.46
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.45
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.44
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.43
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.43
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.42
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.41
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.4
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.4
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.39
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.36
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.36
3k9i_A117 BH0479 protein; putative protein binding protein, 99.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.35
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.35
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.32
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.31
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.3
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.3
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.3
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.28
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.27
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 99.27
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.26
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.24
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.23
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.23
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.21
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.21
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.2
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.19
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.18
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.18
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.18
3u4t_A272 TPR repeat-containing protein; structural genomics 99.18
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.17
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.15
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.15
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.15
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.15
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.14
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.12
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.1
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.1
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.1
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.07
3u4t_A272 TPR repeat-containing protein; structural genomics 99.07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.06
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.01
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.99
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.98
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.98
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.97
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.97
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.97
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.95
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.93
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.93
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.93
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.92
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.92
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.9
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.9
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.9
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 98.9
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.9
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.89
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.88
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.87
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.86
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.86
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.85
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.85
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.85
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.84
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.83
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 98.8
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.8
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.78
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.78
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.77
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.75
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.75
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.75
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.75
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.74
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.71
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.71
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.68
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.65
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.65
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.63
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.62
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.6
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.6
3k9i_A117 BH0479 protein; putative protein binding protein, 98.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.56
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.56
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.53
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.47
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.46
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.46
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.41
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.4
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.39
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.34
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.34
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.33
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.33
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.33
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.29
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.27
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.24
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.19
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.16
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.16
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.15
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.09
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.06
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.05
3gty_X433 Trigger factor, TF; chaperone-client complex, cell 98.03
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.02
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.98
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.96
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.89
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.86
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.85
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.84
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.76
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.69
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.48
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.42
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.29
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.29
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.2
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.19
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.16
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 96.73
3gty_X433 Trigger factor, TF; chaperone-client complex, cell 96.65
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.55
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.49
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.39
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.36
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.03
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.66
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.41
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 94.96
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 94.87
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 94.87
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.86
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.42
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.39
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.86
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.8
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 93.41
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 92.73
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 92.53
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 91.54
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 90.64
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 90.0
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.64
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 88.45
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.41
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 88.32
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 86.48
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 85.53
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 85.52
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 85.41
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 85.15
2dl1_A116 Spartin; SPG20, MIT, structural genomics, NPPSFA, 84.63
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 83.5
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 83.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 82.02
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 81.91
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 81.42
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 80.87
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
Probab=100.00  E-value=4.7e-66  Score=525.70  Aligned_cols=355  Identities=81%  Similarity=1.270  Sum_probs=222.7

Q ss_pred             cCcceeeecCCCeEEEEEEcccCcCCCCCCCEEEEEEEEEEcCCCEEeecCCCCCceEEEccCCcccHHHHHHHcccccc
Q 008689           27 KVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKG  106 (557)
Q Consensus        27 ~~~~~~~~~~~g~~~~~~~~G~G~~~~~~gd~V~v~y~~~~~dg~~~~~t~~~~~p~~~~lg~~~~~~gl~~~l~gm~~G  106 (557)
                      +++++..++++|++|+++++|+|+..|..||.|.+||++++.||++|++|+.+++|+.|.+|.+++++||+++|.+|++|
T Consensus         1 ~~~~~~~~~~~Gl~~~i~~~G~G~~~~~~gd~V~v~Y~g~~~dG~~fdss~~~~~p~~~~lG~g~~i~g~e~~l~gm~~G   80 (356)
T 3jxv_A            1 KVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDQGIKTMKKG   80 (356)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCccceECCCCeEEEEEEeecCCccCCCCCEEEEEEEEEECCCCEEEEcccCCCcEEEEeCCCccchHHHHHHhcCCCC
Confidence            36778889999999999999999778999999999999999999999999987789999999999999999999999999


Q ss_pred             cEEEEEecCCcccCCCCCCCCCCCCCcEEEEEEEEEeeeccccccccceeeeeeeccccccCCCCCCeEEEEEEEEeCCC
Q 008689          107 ENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDG  186 (557)
Q Consensus       107 e~~~v~ip~~~ayg~~~~~~~ip~~~~l~~~v~l~~~~~~~d~~~d~~~~~~i~~~g~g~~~~~~~d~V~v~y~~~~~~g  186 (557)
                      ++++|+|||++|||+.+.++.||+|++++|+|+|++|..+.++..++.+.++++.+|.|+.+|..++.|++||+++++||
T Consensus        81 e~~~~~ip~~~aYG~~g~~~~Ip~~~~l~f~vel~~~~~~~di~~D~~~~k~i~~~G~g~~~p~~g~~V~v~y~g~l~dg  160 (356)
T 3jxv_A           81 ENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDG  160 (356)
T ss_dssp             -------------------------------------CCEEETTSSSSEEEEEEECCBSSCCCCTTCEEEEEEEEEETTS
T ss_pred             CEEEEEEChHHhCCCCCCCCCcCCCCEEEEEeeEEeeecccccccCceeEEEEEecCcccCCCCCCCEEEEEEEEEECCC
Confidence            99999999999999999988999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeeeccceEEEecCCCCCchHHHHHhhccCCcEEEEEecCCCccCCCCCCCCCCCCCCCCCCeEEEEEEeecccceeee
Q 008689          187 MVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEI  266 (557)
Q Consensus       187 ~~~~~~~~~~~~~g~~~~~~gl~~~l~~m~~Ge~~~i~vp~~~~~g~~g~~~~~~~~~ip~~~~l~~~v~l~~~~~~~d~  266 (557)
                      ++|+++.++.|.+|.+++++||+++|.+|+.||++++.|||+++||+.|.+.......|||+++|+|+|+|++|....++
T Consensus       161 t~~~~~~~~~f~~g~~~v~~gl~~~l~~m~~GE~~~~~v~p~~~yg~~G~~~~~~~~~ip~~~~l~~~vel~~~~~v~dv  240 (356)
T 3jxv_A          161 TVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI  240 (356)
T ss_dssp             CEEEEEEEEEEEGGGCSSSHHHHHHHTTCCBTCEEEEEECGGGTTTTTCBCCCC--CCBCTTCCEEEEEEEEEEECEEEE
T ss_pred             CEEeccCCEEEEeCCCCcchHHHHHHhhCCCCCEEEEEEChHhhcCCCCCCcccccccCCCCcEEEEEEEEEEEeccccc
Confidence            99999999999999999999999999999999999999999999999998866666789999999999999999999999


Q ss_pred             eCCcceeEEEEeCCCCCCCCCCCCEEEEEEEEEecCCcEEEecCCCCCcccEEEEcCccchhhHHHHHHhccCcCcEEEE
Q 008689          267 TDDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVIDGLDRAVITMKKNEVALL  346 (557)
Q Consensus       267 ~~d~~~~kkil~~G~g~~~p~~~~~v~v~~~~~l~~g~~~~~~~~~~~~~~~~~~lg~~~vi~gle~~l~~M~~GE~~~v  346 (557)
                      +.|.+++++++++|.|..+|..|+.|+|||++++.||++|+++.. ...+|++|.+|.+.+|+||+.+|..|++||++.|
T Consensus       241 ~~d~~~~~~i~~~g~g~~~~~~gd~V~v~y~g~l~dG~~fd~~~~-~~~~p~~f~~G~g~~i~G~e~~l~gm~~Ge~~~v  319 (356)
T 3jxv_A          241 GDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGH-DEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALV  319 (356)
T ss_dssp             STTCCEEEEEEECCBSSCCCCTTCEEEEEEEEEESSSCEEEEESC-TTSCCCEEETTTTSSCHHHHHHHTTCCBTCEEEE
T ss_pred             ccccceeEEeeecccccCCCCCCCEEEEEEEEEECCCCEEeeccc-cCCcCEEEEECCCccchHHHHHHhCCCCCCEEEE
Confidence            999999999999999988999999999999999999999998753 3578999999999999999999999999999999


Q ss_pred             EEcCCCccCCccccccccCCCCCceEEEEEEEeeeee
Q 008689          347 TIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEK  383 (557)
Q Consensus       347 ~i~~~~~yg~~~~~~~~~~ip~~~~l~~~ieL~~~~~  383 (557)
                      +|++.++||+.+... ...||++++++|+|+|.++.+
T Consensus       320 ~ip~~~aYG~~~~~~-~~~Ip~~~~l~f~vel~~~~~  355 (356)
T 3jxv_A          320 TIPPEYAYGSTESKQ-DAIVPPNSTVIYEVELVSFVK  355 (356)
T ss_dssp             EECGGGTTTTSCEES-SSEECTTCCEEEEEEEEEEEC
T ss_pred             EEChHHccCCCCcCC-CCcCCcCCeEEEEEEEEEEEc
Confidence            999999999987543 256899999999999999874



>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 557
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 1e-35
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-19
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 3e-18
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-33
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 5e-32
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 3e-18
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 4e-15
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 7e-32
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-19
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-17
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 1e-30
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 6e-22
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 1e-19
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-29
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 4e-14
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 6e-14
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-29
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-29
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 8e-16
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 1e-12
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 6e-29
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-18
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-14
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-26
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 9e-21
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 8e-16
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-25
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-12
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-24
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 4e-24
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 6e-12
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-09
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 8e-23
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 5e-11
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-10
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 4e-22
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-11
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 8e-19
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 1e-17
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 8e-05
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 0.001
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 7e-17
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 4e-06
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-13
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-10
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 7e-12
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-09
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 1e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-06
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-06
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-05
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 2e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-04
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKB-6, N-terminal domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  127 bits (320), Expect = 1e-35
 Identities = 62/111 (55%), Positives = 78/111 (70%)

Query: 35  GNQGLKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIK 94
            + G+ K + KEG+G   P  G  V+VHY GTL +GT+FDSSRDR   F F LG+GNVIK
Sbjct: 8   KDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQFSFNLGRGNVIK 67

Query: 95  GWDIGIKTMKKGENAVFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTS 145
           GWD+G+ TM KGE A FTI  +  YG++GSPP IP  ATL F+VEL  W++
Sbjct: 68  GWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSA 118


>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.95
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.95
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.93
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.93
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.92
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.92
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.92
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.9
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.9
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.89
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.89
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.88
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.88
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.86
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.86
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.85
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.85
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.84
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.82
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.8
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.79
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.78
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.7
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.68
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.56
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.52
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.5
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.45
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.3
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.3
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.3
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.29
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.24
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.24
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.22
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.22
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.22
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.19
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.15
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.13
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.12
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.1
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.08
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.05
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.94
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.84
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.73
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.71
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.63
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.63
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.62
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.5
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.49
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.49
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.45
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.32
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.27
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.23
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.23
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.15
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.15
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.98
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.93
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.81
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.68
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.27
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.14
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.91
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 92.79
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.42
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 88.51
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 85.36
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 84.4
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Probab=99.95  E-value=7.4e-27  Score=210.10  Aligned_cols=166  Identities=40%  Similarity=0.669  Sum_probs=159.3

Q ss_pred             ccccCCChHHHHHHHhhhHHHHHHHHHcCcHHHHHHHHHHHHHHhhhcCCCChHHHHHHHHHHHHHHhhHHHHHHhhhCH
Q 008689          385 KESWDMNTEEKIEAAGKKKEQGNTLFKAGKYARASKRYEKAVKYIEYDTSFGDEEKKQAKALKVACNLNNAACKLKLKDY  464 (557)
Q Consensus       385 ~~~~~~~~~e~~~~a~~~k~~G~~~~~~~~y~~A~~~y~~Al~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~~~k~~~~  464 (557)
                      ++.|.|+..|+++.+..+++.|+.+|+.|+|.+|+..|.+|+.+++.......+.......+...+|+|+|.||+++++|
T Consensus         1 ~e~~~m~~~E~~~~a~~~~e~G~~~~~~~~~~~A~~~Y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~Nla~~~~~l~~~   80 (168)
T d1kt1a1           1 KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREY   80 (168)
T ss_dssp             CCGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             CCcccCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhccchhhhhhcchhHHHHHHhHHHHHHHhhhc
Confidence            36899999999999999999999999999999999999999999998888877888888889999999999999999999


Q ss_pred             HHHHHHHHHHHccCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 008689          465 KQAEKLCTKVLDLDSRNVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFYGNMF  544 (557)
Q Consensus       465 ~~A~~~~~~al~~~p~~~ka~~~~g~a~~~lg~~~~A~~~~~~al~l~p~n~~~~~~l~~l~~~~~~~~~~~~~~~~~mf  544 (557)
                      .+|+.+|+++|.++|++.++||++|.+|..+|+|++|+.+|++|++++|+|..+...+..+..++.+.++.+++.|++||
T Consensus        81 ~~Ai~~~~~al~l~p~~~~a~~~~~~~~~~l~~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~e~~kk~~~~~f  160 (168)
T d1kt1a1          81 TKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMF  160 (168)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccchhhhhhhhhcccchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCC
Q 008689          545 AKMNTG  550 (557)
Q Consensus       545 ~~~~~~  550 (557)
                      .+....
T Consensus       161 ~~~~~~  166 (168)
T d1kt1a1         161 KKFAEQ  166 (168)
T ss_dssp             HHHHTT
T ss_pred             hhhhhc
Confidence            998654



>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure