Citrus Sinensis ID: 008716

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550------
MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEEEEEccEEEEEEEEEcccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccccEEcccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEHHHcEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcccEccccccHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccEEcccHHHHccccccccccccHccccHHHHcccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccHHHcccccccccccHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc
mdthahsahltapnrsrssqtpspshsasasatSSIHKRKLAATAaagasedhaphafppsfsadtrdgaltsnddlesisargadsdaddsedavvdddedefendndssmRTFTAARLennnsvgsarntklktenstvkiensdggkegvtsgsgvlgstalagssvlgtagkeDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFarqlpnmpkEYIVRLVMDRSHKSVMVIRGNVVVGGityrpyvsqkfgEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDrwqgyikdydggilmeckidpklpytdlsTMIRRQRQAIDEKIRELSnchivypgidfqkkeagvpkkiikvedipglreagwtpdqwghsrfrtltaatdgasnQKHLTAFMRSLLKSMHdhvdawpfkepvdardvpdyyeiikdpmdlrtmskrveseqYYVTFEMFVADVKRMFANartynspdtiyykcatrhvdTINIVFVFHLLSN
mdthahsahltapnrsrssqtpsPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESisargadsdaddseDAVVdddedefendndssmRTFTAarlennnsvgsarntklktenstvkiensdggkegvTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTeniqasgaySAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGidfqkkeagvpKKIIkvedipglreagwtpdqwghSRFRTLTaatdgasnQKHLTAFMRSLLKSMHDHVDAWPfkepvdardvPDYYEIIkdpmdlrtmskrvESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
MDTHAHSAHLTAPNrsrssqtpspshsasasatssIHKRKLaataaagaSEDHAPHAFPPSFSADTRDGALTSNDDLESISARGAdsdaddsedavvdddedefendndssMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEgvtsgsgvlgstalagssVLGTAGKEDTVKIFTENIQASGAYSareellkreeeaGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
**************************************************************************************************************************************************************************LGTAGKEDTVKIFTENIQASGAY***********EAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLL**
***********************************************************************************************************************************************************************************************************EEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRE*****************************************************************AFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLL**
*****************************************************APHAFPPSFSADTRDGALTSNDDLESISA***************************SSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
*******************************************TA*************************************************************************************************************************************TVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRF********GASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPPSFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARLENNNSVGSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFHLLSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query556 2.2.26 [Sep-21-2011]
Q9AR19568 Histone acetyltransferase yes no 0.964 0.943 0.747 0.0
Q338B9511 Histone acetyltransferase yes no 0.75 0.816 0.741 0.0
Q756G9452 Histone acetyltransferase yes no 0.701 0.862 0.449 1e-89
Q03330439 Histone acetyltransferase yes no 0.701 0.888 0.433 2e-89
Q6CXW4516 Histone acetyltransferase yes no 0.582 0.627 0.479 6e-88
Q6FTW5546 Histone acetyltransferase yes no 0.582 0.593 0.476 1e-87
Q9UUK2454 Histone acetyltransferase yes no 0.580 0.711 0.463 2e-87
Q8WZM0464 Histone acetyltransferase yes no 0.598 0.717 0.458 2e-86
Q6BGW1455 Histone acetyltransferase yes no 0.604 0.738 0.452 3e-85
Q9JHD2830 Histone acetyltransferase yes no 0.616 0.413 0.444 3e-83
>sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 Back     alignment and function desciption
 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/546 (74%), Positives = 464/546 (84%), Gaps = 10/546 (1%)

Query: 5   AHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGA--SEDHAPHAFPPSF 62
           +HS+HL A NRSRSSQTPSPSHSASAS TSS+HKRKLAAT AA A  SEDHAP +     
Sbjct: 3   SHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSFPP 62

Query: 63  S---ADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEF----ENDNDSSMRTF 115
           S   ADTRDGALTSND+LESISARGAD+D+D  E   +  D+DE     E D DSS+RTF
Sbjct: 63  SSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIRTF 122

Query: 116 TAARLENNNSV-GSARNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSSVLGTA 174
           TAARL++++ V GS+RNTKLKTE+STVK+E+SDGGK+G +S  G   S  + GSS+ G  
Sbjct: 123 TAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISGLV 182

Query: 175 GKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGLKNIFA 234
            K+++VK+  EN Q SGAY AREE LKREE+AG LKFVC SND IDEHM+ LIGLKNIFA
Sbjct: 183 PKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNIFA 242

Query: 235 RQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVK 294
           RQLPNMPKEYIVRL+MDR HKSVMV+RGN+VVGGITYRPY SQKFGEIAFCAITADEQVK
Sbjct: 243 RQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVK 302

Query: 295 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDG 354
           GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYF+KQGFTKEIYLEKD W G+IKDYDG
Sbjct: 303 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDG 362

Query: 355 GILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIK 414
           G+LMECKIDPKLPYTDLS+MIR+QR+AIDE+IRELSNC  VYP I+F K EAG+P+KIIK
Sbjct: 363 GLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIK 422

Query: 415 VEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKE 474
           VE+I GLREAGWTPDQWGH+RF+    + D  +NQK L A MR+LLK+M DH DAWPFKE
Sbjct: 423 VEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLKTMQDHADAWPFKE 482

Query: 475 PVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIY 534
           PVD+RDVPDYY+IIKDP+DL+ ++KRVESEQYYVT +MFVAD +RMF N RTYNSPDTIY
Sbjct: 483 PVDSRDVPDYYDIIKDPIDLKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDTIY 542

Query: 535 YKCATR 540
           YKCATR
Sbjct: 543 YKCATR 548
Acetylates histone H3 and ADA2 proteins in vitro. Acetylates 'Lys-14' of histone H3. Acetylation of histones gives a specific tag for epigenetic transcription activation. Operates in concert with certain DNA-binding transcriptional activators. Acts via the formation of large multiprotein complexes that modify the chromatin.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 Back     alignment and function description
>sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 Back     alignment and function description
>sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 Back     alignment and function description
>sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 Back     alignment and function description
>sp|Q9JHD2|KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus GN=Kat2a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query556
255559909561 histone acetyltransferase gcn5, putative 0.953 0.944 0.840 0.0
224082720564 histone acetyltransferase [Populus trich 0.953 0.939 0.832 0.0
449433487561 PREDICTED: histone acetyltransferase GCN 0.949 0.941 0.789 0.0
356570608540 PREDICTED: histone acetyltransferase GCN 0.879 0.905 0.806 0.0
356503570543 PREDICTED: histone acetyltransferase GCN 0.881 0.902 0.809 0.0
18410098568 histone acetyltransferase GCN5 [Arabidop 0.964 0.943 0.747 0.0
297816758568 hypothetical protein ARALYDRAFT_485863 [ 0.964 0.943 0.743 0.0
359479577541 PREDICTED: histone acetyltransferase GCN 0.928 0.953 0.744 0.0
7258364586 histon acetyltransferase HAT1 [Arabidops 0.964 0.914 0.723 0.0
284519768507 putative histone acetyltransferase GCN5 0.741 0.812 0.727 0.0
>gi|255559909|ref|XP_002520973.1| histone acetyltransferase gcn5, putative [Ricinus communis] gi|223539810|gb|EEF41390.1| histone acetyltransferase gcn5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/551 (84%), Positives = 487/551 (88%), Gaps = 21/551 (3%)

Query: 1   MDTHAHSAHLTAPNRSRSSQTPSPSHSASASATSSIHKRKLAATAAAGASEDHAPHAFPP 60
           MDTH+HS HL   NRSRSSQ+PSPSHSASASATSSIHKRKLAA A+A ASEDHAP   P 
Sbjct: 1   MDTHSHS-HLNVTNRSRSSQSPSPSHSASASATSSIHKRKLAAAASA-ASEDHAPPFPPS 58

Query: 61  SFSADTRDGALTSNDDLESISARGADSDADDSEDAVVDDDEDEFENDNDSSMRTFTAARL 120
           SFSADTRDGALTSNDDLESISARGADSD+D  +   V DD+++ E DNDSSMRTF AARL
Sbjct: 59  SFSADTRDGALTSNDDLESISARGADSDSDADDSDAVVDDDED-EFDNDSSMRTFNAARL 117

Query: 121 ENNNSVGSA-----------RNTKLKTENSTVKIENSDGGKEGVTSGSGVLGSTALAGSS 169
           E N    +            RNTK+KTENSTVKIE  DGGK+G   G+G +GS   AGSS
Sbjct: 118 ETNAGASAPGGGSGGGGSSARNTKIKTENSTVKIEKLDGGKDG---GTGAMGSIT-AGSS 173

Query: 170 VLGTAGKEDTVKIFTENIQASGAYSAREELLKREEEAGNLKFVCLSNDGIDEHMVWLIGL 229
           +L    KED VKIFTEN+Q SGAYSAREE LKREEEAG LKFVCLSNDGID HMVWLIGL
Sbjct: 174 ILA---KEDAVKIFTENLQTSGAYSAREESLKREEEAGRLKFVCLSNDGIDAHMVWLIGL 230

Query: 230 KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITA 289
           KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR N VVGGITYRPYVSQKFGEIAFCAITA
Sbjct: 231 KNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRRNHVVGGITYRPYVSQKFGEIAFCAITA 290

Query: 290 DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI 349
           DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI
Sbjct: 291 DEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYI 350

Query: 350 KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVP 409
           KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVY GIDFQKKEAG+P
Sbjct: 351 KDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYQGIDFQKKEAGIP 410

Query: 410 KKIIKVEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDA 469
           KKI+KVEDIPGLREAGWTPDQWGHSRF T   +TD A+NQKH TAFMRSLLKSMHDHVDA
Sbjct: 411 KKIVKVEDIPGLREAGWTPDQWGHSRFNTFNTSTDTATNQKHWTAFMRSLLKSMHDHVDA 470

Query: 470 WPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNS 529
           WPFKEPVD RDVPDYY+IIKDP+DL+TMSKR+ESEQYYVTF+MFVADVKRMFANARTYNS
Sbjct: 471 WPFKEPVDGRDVPDYYDIIKDPIDLKTMSKRIESEQYYVTFDMFVADVKRMFANARTYNS 530

Query: 530 PDTIYYKCATR 540
           PDTIYYKCATR
Sbjct: 531 PDTIYYKCATR 541

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224082720|ref|XP_002306812.1| histone acetyltransferase [Populus trichocarpa] gi|222856261|gb|EEE93808.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449433487|ref|XP_004134529.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] gi|449490675|ref|XP_004158674.1| PREDICTED: histone acetyltransferase GCN5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356570608|ref|XP_003553477.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] Back     alignment and taxonomy information
>gi|356503570|ref|XP_003520580.1| PREDICTED: histone acetyltransferase GCN5-like [Glycine max] Back     alignment and taxonomy information
>gi|18410098|ref|NP_567002.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|75167544|sp|Q9AR19.1|GCN5_ARATH RecName: Full=Histone acetyltransferase GCN5; Short=AtGCN5; AltName: Full=BIG TOP protein gi|13591696|gb|AAK31318.1|AF338768_1 histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|13591702|gb|AAK31321.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] gi|25083382|gb|AAN72068.1| Expressed protein [Arabidopsis thaliana] gi|31711984|gb|AAP68348.1| At3g54610 [Arabidopsis thaliana] gi|332645734|gb|AEE79255.1| histone acetyltransferase GCN5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297816758|ref|XP_002876262.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] gi|297322100|gb|EFH52521.1| hypothetical protein ARALYDRAFT_485863 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359479577|ref|XP_002275146.2| PREDICTED: histone acetyltransferase GCN5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|7258364|emb|CAB77581.1| histon acetyltransferase HAT1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|284519768|gb|ADB92636.1| putative histone acetyltransferase GCN5 [Hordeum vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query556
TAIR|locus:3354973568 HAG1 "histone acetyltransferas 0.964 0.943 0.655 4.1e-191
SGD|S000003484439 GCN5 "Acetyltransferase, modif 0.577 0.731 0.489 5.1e-83
DICTYBASE|DDB_G0283459412 gcn5 "HAG group protein" [Dict 0.571 0.771 0.461 1.8e-78
POMBASE|SPAC1952.05454 gcn5 "SAGA complex histone ace 0.573 0.702 0.468 2.3e-78
UNIPROTKB|F1MRA1836 F1MRA1 "Uncharacterized protei 0.543 0.361 0.474 3e-78
UNIPROTKB|E1BP59823 KAT2A "Uncharacterized protein 0.541 0.365 0.482 6.2e-78
UNIPROTKB|E2RGW1837 KAT2A "Uncharacterized protein 0.541 0.359 0.482 6.2e-78
UNIPROTKB|Q92830837 KAT2A "Histone acetyltransfera 0.541 0.359 0.482 6.2e-78
UNIPROTKB|F1S0Q0837 KAT2A "Uncharacterized protein 0.541 0.359 0.482 6.2e-78
MGI|MGI:1343101830 Kat2a "K(lysine) acetyltransfe 0.541 0.362 0.482 6.2e-78
TAIR|locus:3354973 HAG1 "histone acetyltransferase of the GNAT family 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1852 (657.0 bits), Expect = 4.1e-191, P = 4.1e-191
 Identities = 358/546 (65%), Positives = 407/546 (74%)

Query:     5 AHSAHLTAPNXXXXXXXXXXXXXXXXXXXXXIHKRKLXXXXXX--XXSEDHAP--HAFPP 60
             +HS+HL A N                     +HKRKL          SEDHAP   +FPP
Sbjct:     3 SHSSHLNAANRSRSSQTPSPSHSASASVTSSLHKRKLAATTAANAAASEDHAPPSSSFPP 62

Query:    61 S-FSADTRDGALTSNDDLESISARGAXXXXXXXXXXXXXXXXXXXXXX----XXXXMRTF 115
             S FSADTRDGALTSND+LESISARGA                              +RTF
Sbjct:    63 SSFSADTRDGALTSNDELESISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSIRTF 122

Query:   116 TAARLENNNSV-GSARNTKLKTENSTVKIENSDGGKEXXXXXXXXXXXXXXXXXXVLGTA 174
             TAARL++++ V GS+RNTKLKTE+STVK+E+SDGGK+                  + G  
Sbjct:   123 TAARLDSSSGVNGSSRNTKLKTESSTVKLESSDGGKDGGSSVVGTGVSGTVGGSSISGLV 182

Query:   175 GKEDTVKIFTENIQASGAYSXXXXXXXXXXXXGNLKFVCLSNDGIDEHMVWLIGLKNIFA 234
              K+++VK+  EN Q SGAY             G LKFVC SND IDEHM+ LIGLKNIFA
Sbjct:   183 PKDESVKVLAENFQTSGAYIAREEALKREEQAGRLKFVCYSNDSIDEHMMCLIGLKNIFA 242

Query:   235 RQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEIAFCAITADEQVK 294
             RQLPNMPKEYIVRL+MDR HKSVMV+RGN+VVGGITYRPY SQKFGEIAFCAITADEQVK
Sbjct:   243 RQLPNMPKEYIVRLLMDRKHKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVK 302

Query:   295 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDG 354
             GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYF+KQGFTKEIYLEKD W G+IKDYDG
Sbjct:   303 GYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDG 362

Query:   355 GILMECKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGVPKKIIK 414
             G+LMECKIDPKLPYTDLS+MIR+QR+AIDE+IRELSNC  VYP I+F K EAG+P+KIIK
Sbjct:   363 GLLMECKIDPKLPYTDLSSMIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIK 422

Query:   415 VEDIPGLREAGWTPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKE 474
             VE+I GLREAGWTPDQWGH+RF+    + D  +NQK L A MR+LLK+M DH DAWPFKE
Sbjct:   423 VEEIRGLREAGWTPDQWGHTRFKLFNGSADMVTNQKQLNALMRALLKTMQDHADAWPFKE 482

Query:   475 PVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFEMFVADVKRMFANARTYNSPDTIY 534
             PVD+RDVPDYY+IIKDP+DL+ ++KRVESEQYYVT +MFVAD +RMF N RTYNSPDTIY
Sbjct:   483 PVDSRDVPDYYDIIKDPIDLKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDTIY 542

Query:   535 YKCATR 540
             YKCATR
Sbjct:   543 YKCATR 548
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0000123 "histone acetyltransferase complex" evidence=IPI
GO:0004402 "histone acetyltransferase activity" evidence=ISS;IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0009908 "flower development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003677 "DNA binding" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0010015 "root morphogenesis" evidence=IMP
GO:0016573 "histone acetylation" evidence=IDA
GO:0010484 "H3 histone acetyltransferase activity" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0048522 "positive regulation of cellular process" evidence=RCA
SGD|S000003484 GCN5 "Acetyltransferase, modifies N-terminal lysines on histones H2B and H3" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283459 gcn5 "HAG group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC1952.05 gcn5 "SAGA complex histone acetyltransferase catalytic subunit Gcn5" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRA1 F1MRA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP59 KAT2A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGW1 KAT2A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q92830 KAT2A "Histone acetyltransferase KAT2A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0Q0 KAT2A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1343101 Kat2a "K(lysine) acetyltransferase 2A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q338B9GCN5_ORYSJ2, ., 3, ., 1, ., 4, 80.74120.750.8160yesno
Q9AR19GCN5_ARATH2, ., 3, ., 1, ., 4, 80.74720.96400.9436yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.983
3rd Layer2.3.1.480.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query556
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-46
smart00297107 smart00297, BROMO, bromo domain 1e-35
COG5076371 COG5076, COG5076, Transcription factor involved in 4e-34
cd0436999 cd04369, Bromodomain, Bromodomain 5e-30
pfam0043984 pfam00439, Bromodomain, Bromodomain 5e-23
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 5e-22
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 3e-21
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 1e-20
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-20
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 3e-20
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 4e-20
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-18
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 1e-17
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 2e-17
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 2e-17
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 2e-17
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 8e-17
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 6e-16
COG5076 371 COG5076, COG5076, Transcription factor involved in 5e-15
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-15
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 9e-15
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 4e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 7e-14
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 5e-13
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 1e-12
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 2e-12
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 3e-12
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-11
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 4e-11
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 1e-10
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 6e-10
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 2e-09
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 2e-09
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 4e-09
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 8e-09
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 1e-08
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 1e-07
pfam1350879 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT 1e-07
COG1246153 COG1246, ArgA, N-acetylglutamate synthase and rela 1e-05
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 1e-05
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 3e-05
TIGR01890429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran 7e-04
pfam13673118 pfam13673, Acetyltransf_10, Acetyltransferase (GNA 0.001
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information 
 Score =  156 bits (398), Expect = 3e-46
 Identities = 48/89 (53%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 452 LTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQYYVTFE 511
           L   ++ +L S+ +H  AWPF EPVD  + PDYY++IK PMDL TM +++E+  YYVT E
Sbjct: 2   LYTQLKKVLDSLKNHKSAWPFLEPVDKEEAPDYYDVIKKPMDLSTMEEKLENG-YYVTLE 60

Query: 512 MFVADVKRMFANARTYNSPDTIYYKCATR 540
            FVAD+K +F N R YN PDT YYKCA +
Sbjct: 61  EFVADLKLIFDNCRLYNGPDTEYYKCANK 89

Gcn5p is a histone acetyltransferase (HAT) which mediates acetylation of histones at lysine residues; such acetylation is generally correlated with the activation of transcription. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 101
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain Back     alignment and domain information
>gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 556
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 100.0
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.94
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.94
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.94
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.93
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.93
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.93
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.92
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.92
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.92
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.92
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.92
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.91
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.91
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.91
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.91
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.91
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.91
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.9
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.9
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.9
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.9
KOG1474 640 consensus Transcription initiation factor TFIID, s 99.89
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.89
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.89
smart00297107 BROMO bromo domain. 99.89
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.88
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.88
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.88
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.88
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.88
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.87
COG5076 371 Transcription factor involved in chromatin remodel 99.86
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.85
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.85
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.84
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.83
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.82
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.7
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.7
PRK07757152 acetyltransferase; Provisional 99.52
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.37
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.36
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.29
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.27
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.26
PTZ00330147 acetyltransferase; Provisional 99.23
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.17
PRK03624140 putative acetyltransferase; Provisional 99.15
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.15
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.15
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.14
PRK07922169 N-acetylglutamate synthase; Validated 99.14
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.12
PRK10140162 putative acetyltransferase YhhY; Provisional 99.12
COG0456177 RimI Acetyltransferases [General function predicti 99.1
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.09
PRK10314153 putative acyltransferase; Provisional 99.08
PHA00673154 acetyltransferase domain containing protein 99.07
PRK13688156 hypothetical protein; Provisional 99.04
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.02
PLN02825515 amino-acid N-acetyltransferase 99.01
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.0
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.0
KOG00081563 consensus Transcription initiation factor TFIID, s 98.99
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.98
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 98.98
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 98.97
PRK10514145 putative acetyltransferase; Provisional 98.97
PRK05279441 N-acetylglutamate synthase; Validated 98.94
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.9
PRK09831147 putative acyltransferase; Provisional 98.89
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 98.88
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 98.86
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 98.86
PRK15130186 spermidine N1-acetyltransferase; Provisional 98.86
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.83
PHA01807153 hypothetical protein 98.82
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.81
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 98.78
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 98.78
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.76
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 98.74
KOG3139165 consensus N-acetyltransferase [General function pr 98.74
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 98.73
PRK10562145 putative acetyltransferase; Provisional 98.71
KOG0008 1563 consensus Transcription initiation factor TFIID, s 98.69
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 98.69
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.68
COG5076371 Transcription factor involved in chromatin remodel 98.66
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.6
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.59
KOG3138187 consensus Predicted N-acetyltransferase [General f 98.52
PRK01346411 hypothetical protein; Provisional 98.52
COG3153171 Predicted acetyltransferase [General function pred 98.47
COG1247169 Sortase and related acyltransferases [Cell envelop 98.44
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 98.41
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.33
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 98.29
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 98.28
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.24
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 98.22
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 98.21
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 98.2
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 98.17
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 98.16
KOG3397225 consensus Acetyltransferases [General function pre 98.08
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 98.02
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 97.93
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 97.74
COG3393268 Predicted acetyltransferase [General function pred 97.7
COG1670187 RimL Acetyltransferases, including N-acetylases of 97.66
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 97.64
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 97.55
COG2153155 ElaA Predicted acyltransferase [General function p 97.51
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 97.39
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 97.37
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 97.35
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 97.35
COG3053352 CitC Citrate lyase synthetase [Energy production a 97.31
COG3981174 Predicted acetyltransferase [General function pred 97.28
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 96.86
COG238899 Predicted acetyltransferase [General function pred 96.64
COG4552389 Eis Predicted acetyltransferase involved in intrac 96.38
PRK13834207 putative autoinducer synthesis protein; Provisiona 95.34
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 95.31
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 95.24
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.2
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 95.18
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 94.96
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 94.17
COG5628143 Predicted acetyltransferase [General function pred 93.85
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 93.57
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 92.14
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 92.08
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 92.01
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 91.84
KOG2535554 consensus RNA polymerase II elongator complex, sub 91.66
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 90.11
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 86.76
KOG06441113 consensus Uncharacterized conserved protein, conta 85.72
PLN03238290 probable histone acetyltransferase MYST; Provision 85.04
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 84.51
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 83.73
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 83.34
PTZ00064552 histone acetyltransferase; Provisional 82.7
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 82.15
COG3375266 Uncharacterized conserved protein [Function unknow 81.88
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-64  Score=555.33  Aligned_cols=345  Identities=46%  Similarity=0.808  Sum_probs=321.9

Q ss_pred             chhhHHHHHHHHcCCeEEEEeeCCCh----hhHHHHHHHHHHHHhhhCCCCcHHHHHHHhhcCCCcEEEEEECCE-EEEE
Q 008716          194 SAREELLKREEEAGNLKFVCLSNDGI----DEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNV-VVGG  268 (556)
Q Consensus       194 ~~r~~~~~~ee~~g~i~f~~~~nd~~----~~~~~~L~~lkniF~~qLp~MPkeYI~Rlv~D~~~~~~vl~~~g~-VIGG  268 (556)
                      ..|++.+..||..|.|+|+||.|+.+    ...++||++++|+|++|||+||++||.|||||..|++++++.+++ ||||
T Consensus       355 ~~n~~~~n~ee~~~~~~~~vv~~~~s~~~~~~~~~~li~~~~~f~~qL~empkEyi~rlv~d~~h~~~~~~~d~~g~vgg  434 (720)
T KOG1472|consen  355 WRNCEKYNSEESHGLIEFAVIMNSKSLALIKEIPIELIGLRNEFSKQLPEMPKEYISRLVFDTSHHVMARIKDNEGVVGG  434 (720)
T ss_pred             HhcchhhccccchhhhhhhhhhccCcHhHhccchhhhccchhHHHhhcccchHHHHHhhccccccccceeeccccccccc
Confidence            45999999999999999999999987    788999999999999999999999999999999999999998876 9999


Q ss_pred             EEEeeecCCceEEEEEEeecCCCcccChHHHHHHHHHHHHHhcCCceEEEEccCCcchhhhhhcCCccccccccceEeee
Q 008716          269 ITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGY  348 (556)
Q Consensus       269 I~~r~f~~~~f~EI~flAV~~~~QgKGyGs~LM~~lke~ar~~~gi~~llt~aD~~Ai~FYkKqGFtk~i~l~~~~w~G~  348 (556)
                      ||+|+|+.++|.||+||||+.+.|++|||++||+|++++.+....+.++++|||+.|+++|+||||+++|.+++.+|.||
T Consensus       435 i~~r~f~~k~f~eivf~av~~~eqv~g~g~hlmnhlkd~~~~~~~i~~~ltyad~~aigyfkkqgfs~ei~~~~~~~~g~  514 (720)
T KOG1472|consen  435 ICFRPFPEKGFTEIVFCAVTTDEQVKGSGTHLMNHLKDYVRSSSTIDYALTYADEGAIGYFKKQGFSKEIKFEKSPYVGY  514 (720)
T ss_pred             cccCcCcccCCcceeeccccCcccccccCcCchhhHHHHhhccchHHHHHHhhhhcccccccCccchhhcccccCcCccc
Confidence            99999999999999999999999999999999999999999833489999999999999999999999999999999999


Q ss_pred             eccCCCceeEeeeeCCCCCccchhHHHH-HHHHHHHHHHH-hhcccccccCCccccccccCCCccccCCCCCCcccccCC
Q 008716          349 IKDYDGGILMECKIDPKLPYTDLSTMIR-RQRQAIDEKIR-ELSNCHIVYPGIDFQKKEAGVPKKIIKVEDIPGLREAGW  426 (556)
Q Consensus       349 IKdY~gatLM~C~l~p~i~y~~~~~~i~-~Qk~al~~kir-~~s~~hiVypGl~~~k~e~g~p~k~i~~~~IPGl~EaGw  426 (556)
                      ||+|+|||||.|.++|.|+|+++..++. .|+..+.++|. .+...++|||||++++.  +  .+.+.+..|||++|+||
T Consensus       515 ikdye~~tl~~c~l~~~i~~t~~~~~~~~~~~a~l~~~i~~~~~~~~kv~~gl~~~~~--~--~~~~~~~~iPg~~E~~~  590 (720)
T KOG1472|consen  515 IKDYEGGTLMPCELLPEIPYTELSAIVEHPQKAKLGREIEPEIDEYFKVYPGLECFKD--G--VPQIPPRKIPGFRESGW  590 (720)
T ss_pred             cccccCccccchhhccCcchhhhhhhhhhhHHHHHHHhhccccccccccccccccccc--c--ccccCcccCCCchhhcc
Confidence            9999999999999999999999999999 99999999998 77889999999998875  3  46788999999999999


Q ss_pred             CCCCCCCccccccccCCCCcccHHHHHHHHHHHHHHhhcCCCCCCcccCCCCCCCCchhhhcCCCCChHHHHHHHhcCCC
Q 008716          427 TPDQWGHSRFRTLTAATDGASNQKHLTAFMRSLLKSMHDHVDAWPFKEPVDARDVPDYYEIIKDPMDLRTMSKRVESEQY  506 (556)
Q Consensus       427 tp~~~~~sr~r~~~~~~d~~~~~~~L~~~l~~IL~~L~~~~~a~pF~~PVd~~evPDYy~IIk~PMDLsTIkkKL~s~~Y  506 (556)
                      .|.....++.         -.....+...+..+|..|.+|..+|||.+||+..++||||++|++||||.||+.+|..+. 
T Consensus       591 ~~~~~~~r~~---------~~~~~~~~s~~~~il~~l~~h~~awPf~~Pv~~~e~pdyy~~I~~pmDl~tM~~~l~~~~-  660 (720)
T KOG1472|consen  591 KPEKESYRQE---------YKKPGKLFSAIQNILDQLQNHGDAWPFLKPVNKKEVPDYYDVIKHPMDLRTMQNRLKDNQ-  660 (720)
T ss_pred             CcchHHHHhh---------hcccchhhHHHHhHHhhhhcCCccCCccCccccccCCcHHHHhcccccHHHHhhhccccc-
Confidence            9987544321         012346778899999999999999999999999999999999999999999999999976 


Q ss_pred             CCCHHHHHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHHhh
Q 008716          507 YVTFEMFVADVKRMFANARTYNSPDTIYYKCATRHVDTINIVFVFH  552 (556)
Q Consensus       507 Y~s~~eF~aDvrLIF~Ncr~YN~pdS~~~k~A~~Lek~Fe~~lk~~  552 (556)
                      |..+..|++|+.+||.||+.||+.++.+|++|..|+.+|...+...
T Consensus       661 y~~~~~f~ad~~~vf~ncr~yn~~~~~y~k~~~~le~~~~~k~~~~  706 (720)
T KOG1472|consen  661 YTEVELFMADVVRVFANCRMYNGSDTQYYKCAQALEKFFLFKLNEL  706 (720)
T ss_pred             hhhHHHHHHHHHHHHhhhhccCCccchheecccchhhhhcchhhhh
Confidence            8999999999999999999999999999999999999999988765

>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query556
1ygh_A164 Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Le 5e-54
5gcn_A166 Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyl 3e-49
1qst_A160 Crystal Structure Of Tetrahymena Gcn5 Length = 160 5e-49
1m1d_A163 Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhi 6e-49
1qsn_A162 Crystal Structure Of Tetrahymena Gcn5 With Bound Co 6e-49
1cm0_B168 Crystal Structure Of The PcafCOENZYME-A Complex Len 2e-47
1z4r_A168 Human Gcn5 Acetyltransferase Length = 168 2e-47
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 2e-21
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 3e-21
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 8e-21
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 8e-21
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-20
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 4e-20
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-19
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-19
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-19
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-18
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 7e-17
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 9e-14
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 9e-14
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-13
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 1e-13
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 6e-13
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 9e-13
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 1e-12
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 6e-12
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 7e-12
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 9e-12
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-11
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-11
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 2e-11
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-11
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 2e-11
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 2e-11
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 2e-11
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 4e-11
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 5e-11
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 5e-11
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 6e-11
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 8e-11
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 8e-11
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 8e-11
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 2e-10
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 5e-10
2e7n_A117 Solution Structure Of The Second Bromodomain From H 6e-10
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 7e-10
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 1e-09
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 1e-09
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 1e-09
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 1e-09
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 2e-09
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 2e-09
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 3e-09
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 3e-09
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 3e-09
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 4e-09
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 4e-09
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 5e-09
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 5e-09
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 4e-08
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 5e-08
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 5e-08
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 1e-07
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-07
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 5e-07
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 7e-07
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 9e-07
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 1e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 2e-06
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 4e-06
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 1e-05
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 1e-05
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 2e-05
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 9e-05
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 1e-04
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 2e-04
3mqm_A126 Crystal Structure Of The Bromodomain Of Human Ash1l 4e-04
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 5e-04
>pdb|1YGH|A Chain A, Hat Domain Of Gcn5 From Saccharomyces Cerevisiae Length = 164 Back     alignment and structure 
Iteration: 1

 Score =  208 bits (530), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 97/163 (59%), Positives = 123/163 (75%), Gaps = 1/163 (0%)
Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNV-VVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VIR  + VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61
Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121
Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>pdb|5GCN|A Chain A, Catalytic Domain Of Tetrahymena Gcn5 Histone Acetyltransferase In Complex With Coenzyme A Length = 166 Back     alignment and structure
>pdb|1QST|A Chain A, Crystal Structure Of Tetrahymena Gcn5 Length = 160 Back     alignment and structure
>pdb|1M1D|A Chain A, Tetrahymena Gcn5 With Bound Bisubstrate Analog Inhibitor Length = 163 Back     alignment and structure
>pdb|1QSN|A Chain A, Crystal Structure Of Tetrahymena Gcn5 With Bound Coenzyme A And Histone H3 Peptide Length = 162 Back     alignment and structure
>pdb|1CM0|B Chain B, Crystal Structure Of The PcafCOENZYME-A Complex Length = 168 Back     alignment and structure
>pdb|1Z4R|A Chain A, Human Gcn5 Acetyltransferase Length = 168 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query556
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 2e-90
1z4r_A168 General control of amino acid synthesis protein 5- 9e-82
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 1e-80
2d9e_A121 Peregrin; four-helix bundle, transcription activat 5e-44
3d7c_A112 General control of amino acid synthesis protein 5; 1e-43
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-43
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-43
3nxb_A116 CAT eye syndrome critical region protein 2; struct 6e-43
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 6e-43
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 5e-34
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 2e-42
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-42
3aad_A292 Transcription initiation factor TFIID subunit 1; p 4e-42
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 9e-35
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 5e-42
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-41
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 2e-41
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-41
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 1e-39
3uv4_A158 Second bromodomain of human transcription initiat 2e-38
2dat_A123 Possible global transcription activator SNF2L2; br 3e-38
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 8e-38
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-37
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-37
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 4e-37
3fkm_X166 Signaling protein; bromodomain, malaria, structura 4e-37
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 4e-37
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 3e-36
2grc_A129 Probable global transcription activator SNF2L4; br 3e-36
3p1f_A119 CREB-binding protein; structural genomics consorti 5e-36
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-36
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-35
3dai_A130 ATPase family AAA domain-containing protein 2; anc 2e-35
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-35
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 1e-34
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 3e-34
2r10_A361 Chromatin structure-remodeling complex protein RSC 1e-33
2r10_A 361 Chromatin structure-remodeling complex protein RSC 8e-26
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-32
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 2e-27
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 8e-30
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 1e-26
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-21
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-15
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 4e-12
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 2e-07
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 7e-07
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 1e-06
3frm_A254 Uncharacterized conserved protein; APC61048, staph 3e-06
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 6e-06
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 6e-06
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 8e-06
2aj6_A159 Hypothetical protein MW0638; structural genomics, 9e-06
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 2e-05
1y7r_A133 Hypothetical protein SA2161; structural genomics, 2e-05
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 2e-05
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 3e-05
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 5e-05
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 8e-05
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 1e-04
2gan_A190 182AA long hypothetical protein; alpha-beta protei 2e-04
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 2e-04
3owc_A188 Probable acetyltransferase; structural genomics, P 2e-04
3mgd_A157 Predicted acetyltransferase; structural genomics, 2e-04
1vkc_A158 Putative acetyl transferase; structural genomics, 3e-04
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 3e-04
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 4e-04
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 4e-04
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 5e-04
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 6e-04
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 6e-04
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 7e-04
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 8e-04
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 Back     alignment and structure
 Score =  274 bits (702), Expect = 2e-90
 Identities = 97/163 (59%), Positives = 122/163 (74%), Gaps = 1/163 (0%)

Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIR-GNVVVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VIR    VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61

Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121

Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query556
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.95
3d7c_A112 General control of amino acid synthesis protein 5; 99.94
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.94
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.94
2dat_A123 Possible global transcription activator SNF2L2; br 99.94
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.94
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.94
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.94
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.93
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.93
3p1f_A119 CREB-binding protein; structural genomics consorti 99.93
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.93
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.93
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.93
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.93
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.93
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.93
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.93
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.93
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.93
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.92
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.92
3uv4_A158 Second bromodomain of human transcription initiat 99.92
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.91
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.91
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.9
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
1z4r_A168 General control of amino acid synthesis protein 5- 99.9
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 99.88
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.88
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.88
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.87
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.87
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 99.86
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.85
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.85
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.84
2r10_A 361 Chromatin structure-remodeling complex protein RSC 99.79
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 99.78
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.69
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.62
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.57
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.55
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.5
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.5
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.49
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.49
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.49
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.48
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.47
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.47
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.46
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.46
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.45
1tiq_A180 Protease synthase and sporulation negative regulat 99.45
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.45
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.45
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.45
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.45
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.45
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.44
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.44
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.44
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.43
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.43
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.43
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.41
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.41
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.41
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.41
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.4
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.4
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.4
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.39
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.39
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.38
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.38
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.38
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.37
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.37
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.37
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.36
3owc_A188 Probable acetyltransferase; structural genomics, P 99.36
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.36
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.36
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.36
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.36
1vkc_A158 Putative acetyl transferase; structural genomics, 99.36
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.35
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.35
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.34
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.34
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.34
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.33
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.33
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.33
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.33
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.33
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.32
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.32
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.32
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.32
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.32
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.31
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.31
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.31
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.31
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.3
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.3
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.3
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.3
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.29
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.29
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.29
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.29
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.29
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.29
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.28
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.27
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.27
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.27
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.26
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.26
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.25
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.25
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.25
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.25
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.25
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.25
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.25
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.25
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.24
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.24
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.24
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.24
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.23
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.22
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.22
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.22
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.22
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.22
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.22
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.22
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 99.21
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.21
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.2
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.19
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.19
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.18
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.18
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.18
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.16
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.16
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.15
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.15
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.14
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 99.14
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.12
2qml_A198 BH2621 protein; structural genomics, joint center 99.12
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.12
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.09
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.08
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.08
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.08
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.06
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.06
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.05
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.04
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.03
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.03
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.02
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.01
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.0
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.0
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 98.99
3r1k_A428 Enhanced intracellular surviVal protein; GNAT, ace 98.98
2i00_A406 Acetyltransferase, GNAT family; structural genomic 98.97
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 98.97
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 98.95
2hv2_A400 Hypothetical protein; PSI, protein structure initi 98.95
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 98.94
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 98.92
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 98.87
3sxn_A422 Enhanced intracellular surviVal protein; GNAT fold 98.86
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.81
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 98.69
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 98.62
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 98.58
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.57
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.55
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.54
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 98.52
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.51
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.38
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 98.28
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 97.62
1bob_A320 HAT1, histone acetyltransferase; histone modificat 97.3
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 97.12
1yle_A342 Arginine N-succinyltransferase, alpha chain; struc 96.33
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 94.26
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 94.09
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 92.7
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 92.45
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 90.21
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 88.04
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 86.85
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 86.4
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 86.26
1iyk_A392 Myristoyl-COA:protein N-myristoyltransferase; HET: 85.97
2ou2_A280 Histone acetyltransferase htatip; structural genom 84.48
1rxt_A496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 84.45
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 81.47
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 80.5
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 80.49
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
Probab=99.95  E-value=6.7e-27  Score=212.87  Aligned_cols=163  Identities=58%  Similarity=1.028  Sum_probs=146.7

Q ss_pred             CeEEEEeeCCChhhHHHHHHHHHHHHhhhCCCCcHHHHHHHhhcCCCcEE-EEEECCEEEEEEEEeeecCCceEEEEEEe
Q 008716          208 NLKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSV-MVIRGNVVVGGITYRPYVSQKFGEIAFCA  286 (556)
Q Consensus       208 ~i~f~~~~nd~~~~~~~~L~~lkniF~~qLp~MPkeYI~Rlv~D~~~~~~-vl~~~g~VIGGI~~r~f~~~~f~EI~flA  286 (556)
                      .|+|+.++|+..++.+.||..++++|..++|.|+++|+.++++++.+..+ ++..+|++||.+++..+......+|..++
T Consensus         1 ~i~~r~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~ivG~~~~~~~~~~~~~~i~~l~   80 (164)
T 1ygh_A            1 KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCA   80 (164)
T ss_dssp             CEEEEEECCSSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHCTTCEEEEEEETTTEEEEEEEEEEEGGGTEEEEEEEE
T ss_pred             CeeEEEecCCCchhhHHHHHHHHHHHHhhcccCCHHHHHHHhhCCCceEEEEECCCCEEEEEEEEEEcCCCCceEEEEEE
Confidence            58999999999999999999999999999999999999999999988774 44457899999988887655678999999


Q ss_pred             ecCCCcccChHHHHHHHHHHHHHhcCCceEEEEccCCcchhhhhhcCCccccccccceEeeeeccCCCceeEeeeeCCCC
Q 008716          287 ITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKL  366 (556)
Q Consensus       287 V~~~~QgKGyGs~LM~~lke~ar~~~gi~~llt~aD~~Ai~FYkKqGFtk~i~l~~~~w~G~IKdY~gatLM~C~l~p~i  366 (556)
                      |.|++||+|||+.||+++++++++..++..+.+.++|.|+.||+|+||+....++...|.|++++|+++++|+|.+.|.|
T Consensus        81 V~p~~rg~Gig~~ll~~~~~~a~~~~g~~~l~v~~~n~a~~~y~k~GF~~~~~~~~~~~~~~~~~~~~~~~m~~~l~~~~  160 (164)
T 1ygh_A           81 ISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRI  160 (164)
T ss_dssp             ECTTCCCTTHHHHHHHHHHHHHHHHSCCCEEEEEECGGGHHHHHHTTCBSSCCSCHHHHBTTBCCTTCCEEEEEECCCCC
T ss_pred             ECHHHcCCCHHHHHHHHHHHHHHhcCCceEEEEecCChHHHHHHHcCCEecceeccceEEEEEEEecCeEEEEeeccccC
Confidence            99999999999999999999998635666666677678899999999998888888899999999999999999999999


Q ss_pred             Cccc
Q 008716          367 PYTD  370 (556)
Q Consensus       367 ~y~~  370 (556)
                      +|++
T Consensus       161 ~~~~  164 (164)
T 1ygh_A          161 RYLD  164 (164)
T ss_dssp             CCCC
T ss_pred             cCCC
Confidence            9975
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 556
d1ygha_164 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 3e-57
d1z4ra1162 d.108.1.1 (A:497-658) Catalytic domain of GCN5 his 4e-55
d1qsra_162 d.108.1.1 (A:) Catalytic domain of GCN5 histone ac 1e-53
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 3e-29
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 1e-27
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 2e-27
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-27
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 2e-26
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 3e-25
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 1e-05
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 4e-05
d1cjwa_166 d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep 8e-05
d1y7ra1133 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S 2e-04
d1sqha_297 d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr 3e-04
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 5e-04
d2atra1137 d.108.1.1 (A:1-137) Probable acetyltransferase SP0 5e-04
d1y9wa1140 d.108.1.1 (A:1-140) Probable acetyltransferase BC2 0.002
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Catalytic domain of GCN5 histone acetyltransferase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  186 bits (474), Expect = 3e-57
 Identities = 96/163 (58%), Positives = 122/163 (74%), Gaps = 1/163 (0%)

Query: 209 LKFVCLSNDGIDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVI-RGNVVVG 267
           ++F  ++ND   E+M+ L GLKNIF +QLP MPKEYI RLV DRSH S+ VI +   VVG
Sbjct: 2   IEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVG 61

Query: 268 GITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVG 327
           GITYRP+  ++F EI FCAI++ EQV+GYG  LMNHLK + R+   + +FLTYADN A+G
Sbjct: 62  GITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIG 121

Query: 328 YFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKIDPKLPYTD 370
           YF KQGFTKEI L+K  W GYIKDY+GG LM+C + P++ Y D
Sbjct: 122 YFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD 164
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133 Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query556
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 100.0
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 100.0
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 100.0
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.93
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.93
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.93
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.92
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.92
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.67
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.56
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.56
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.52
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.49
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.49
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.45
d1tiqa_173 Protease synthase and sporulation negative regulat 99.45
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.44
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.43
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.42
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.42
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.42
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.41
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.41
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.4
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.4
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.39
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.39
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.38
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.37
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.36
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.36
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.34
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.33
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.32
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.31
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.31
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.27
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.25
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.24
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.19
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.19
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.16
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.16
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.15
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.13
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.13
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.1
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.03
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 98.91
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 98.91
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 98.9
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 98.89
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.86
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 98.8
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 98.69
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 98.63
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 98.61
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.59
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 98.56
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 98.52
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 97.98
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 97.75
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 97.72
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 97.15
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 96.8
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 96.63
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 96.46
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 96.35
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 95.69
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 95.27
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 92.87
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 82.25
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 81.66
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Catalytic domain of GCN5 histone acetyltransferase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.1e-45  Score=340.85  Aligned_cols=158  Identities=52%  Similarity=0.976  Sum_probs=153.6

Q ss_pred             CCeEEEEeeCCC----hhhHHHHHHHHHHHHhhhCCCCcHHHHHHHhhcCCCcEEEEEECCEEEEEEEEeeecCCceEEE
Q 008716          207 GNLKFVCLSNDG----IDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSVMVIRGNVVVGGITYRPYVSQKFGEI  282 (556)
Q Consensus       207 g~i~f~~~~nd~----~~~~~~~L~~lkniF~~qLp~MPkeYI~Rlv~D~~~~~~vl~~~g~VIGGI~~r~f~~~~f~EI  282 (556)
                      |+|+|+++.||.    +++.++||++++|+|++|||+||++||.|++||++|.+++++++|+|||+||++++.+.+++||
T Consensus         1 ~~i~~~~~~n~~~~~~~~~~~~~L~~~~~iF~~~lp~m~~~yi~r~~~d~~~~~~v~~~~~~iIG~i~~~~~~~~~~aeI   80 (162)
T d1z4ra1           1 GIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEI   80 (162)
T ss_dssp             CSEEEEEECCSSCTTSCHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHTCTTCEEEEEEETTEEEEEEEEEEETTTTEEEE
T ss_pred             CEEEEEEecCCCCCccCHHHHHHHHHHHHHHHHhCCCCcHHHHHHHhcCCCceEEEEEECCEEEEEEEEEEECCCCEEEE
Confidence            899999999974    5688999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeecCCCcccChHHHHHHHHHHHHHhcCCceEEEEccCCcchhhhhhcCCccccccccceEeeeeccCCCceeEeeee
Q 008716          283 AFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECKI  362 (556)
Q Consensus       283 ~flAV~~~~QgKGyGs~LM~~lke~ar~~~gi~~llt~aD~~Ai~FYkKqGFtk~i~l~~~~w~G~IKdY~gatLM~C~l  362 (556)
                      .+|||+++|||||||++||+++++++++ .|+.++++++++.|++||+|+||++++++|+.+|.||||||+|||||+|+|
T Consensus        81 ~~laV~~~~qgkGiG~~Lm~~l~~~~~~-~g~~~i~~~~~~~A~~fY~k~GF~~~~~~~~~~~~~~ikdy~~~~lm~~~~  159 (162)
T d1z4ra1          81 VFCAVTSNEQVKGYGTHLMNHLKEYHIK-HNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECEL  159 (162)
T ss_dssp             EEEEECGGGCSSSHHHHHHHHHHHHHHH-TTCCEEEEEECGGGHHHHHHTTEESCCCSCHHHHTTTSCCCTTCEEEEEEC
T ss_pred             EEEEEChhhhhhhHHHHHHHHHHHHHHH-CCCcEEEEecCcchHHHHHhCCCeEeccCchhHhcCCccCCCCeEEEEEec
Confidence            9999999999999999999999999998 999999999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q 008716          363 DPK  365 (556)
Q Consensus       363 ~p~  365 (556)
                      +|+
T Consensus       160 ~p~  162 (162)
T d1z4ra1         160 NPR  162 (162)
T ss_dssp             CCC
T ss_pred             CCC
Confidence            996
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure