Citrus Sinensis ID: 008720
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 556 | ||||||
| 283520948 | 634 | ethylene response sensor 1 [Citrus hybri | 1.0 | 0.876 | 1.0 | 0.0 | |
| 4092526 | 634 | putative ethylene receptor [Citrus sinen | 1.0 | 0.876 | 0.991 | 0.0 | |
| 224068380 | 636 | ethylene receptor 1 [Populus trichocarpa | 1.0 | 0.874 | 0.836 | 0.0 | |
| 237769861 | 636 | ethylene receptor [Dimocarpus longan] gi | 1.0 | 0.874 | 0.815 | 0.0 | |
| 225437449 | 636 | PREDICTED: ethylene receptor 2 [Vitis vi | 1.0 | 0.874 | 0.816 | 0.0 | |
| 163639425 | 629 | ethylene receptor ERS1b [Actinidia delic | 1.0 | 0.883 | 0.806 | 0.0 | |
| 82471111 | 632 | ERS type ethylene receptor [Ziziphus juj | 1.0 | 0.879 | 0.825 | 0.0 | |
| 255564264 | 636 | ethylene receptor, putative [Ricinus com | 1.0 | 0.874 | 0.818 | 0.0 | |
| 11935116 | 634 | ethylene receptor [Carica papaya] | 0.996 | 0.873 | 0.820 | 0.0 | |
| 44885996 | 633 | ethylene receptor [Diospyros kaki] | 1.0 | 0.878 | 0.808 | 0.0 |
| >gi|283520948|gb|ADB25216.1| ethylene response sensor 1 [Citrus hybrid cultivar] | Back alignment and taxonomy information |
|---|
Score = 1143 bits (2956), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 556/556 (100%), Positives = 556/556 (100%)
Query: 1 MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGS 60
MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGS
Sbjct: 1 MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGS 60
Query: 61 FIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTREL 120
FIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTREL
Sbjct: 61 FIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTREL 120
Query: 121 FLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECA 180
FLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECA
Sbjct: 121 FLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECA 180
Query: 181 LWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVG 240
LWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVG
Sbjct: 181 LWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVG 240
Query: 241 RYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVA 300
RYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVA
Sbjct: 241 RYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVA 300
Query: 301 DQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMH 360
DQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMH
Sbjct: 301 DQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMH 360
Query: 361 AIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQ 420
AIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQ
Sbjct: 361 AIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQ 420
Query: 421 IVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYV 480
IVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYV
Sbjct: 421 IVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYV 480
Query: 481 SIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSRGS 540
SIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSRGS
Sbjct: 481 SIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSRGS 540
Query: 541 SCQTPRAGLGLAICRR 556
SCQTPRAGLGLAICRR
Sbjct: 541 SCQTPRAGLGLAICRR 556
|
Source: Citrus hybrid cultivar Species: Citrus hybrid cultivar Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|4092526|gb|AAC99435.1| putative ethylene receptor [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|224068380|ref|XP_002302732.1| ethylene receptor 1 [Populus trichocarpa] gi|222844458|gb|EEE82005.1| ethylene receptor 1 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|237769861|gb|ACL81481.3| ethylene receptor [Dimocarpus longan] gi|264683475|gb|ACY72568.1| ethylene receptor [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
| >gi|225437449|ref|XP_002272649.1| PREDICTED: ethylene receptor 2 [Vitis vinifera] gi|297743925|emb|CBI36895.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|163639425|gb|ABY28263.1| ethylene receptor ERS1b [Actinidia deliciosa] | Back alignment and taxonomy information |
|---|
| >gi|82471111|gb|ABB77561.1| ERS type ethylene receptor [Ziziphus jujuba] | Back alignment and taxonomy information |
|---|
| >gi|255564264|ref|XP_002523129.1| ethylene receptor, putative [Ricinus communis] gi|223537691|gb|EEF39314.1| ethylene receptor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|11935116|gb|AAG41977.1|AF311942_1 ethylene receptor [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|44885996|dbj|BAD11810.1| ethylene receptor [Diospyros kaki] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 556 | ||||||
| TAIR|locus:2058500 | 613 | ERS1 "AT2G40940" [Arabidopsis | 1.0 | 0.907 | 0.741 | 2e-221 | |
| UNIPROTKB|Q41341 | 635 | Never-ripe "Ethylene receptor" | 0.998 | 0.874 | 0.730 | 2.2e-215 | |
| UNIPROTKB|Q41342 | 754 | ETR1 "Ethylene receptor 1" [So | 0.998 | 0.736 | 0.693 | 6.2e-204 | |
| TAIR|locus:2201552 | 738 | ETR1 "ETHYLENE RESPONSE 1" [Ar | 0.992 | 0.747 | 0.692 | 4.4e-203 | |
| TAIR|locus:2086208 | 773 | ETR2 "ethylene response 2" [Ar | 0.893 | 0.642 | 0.410 | 4e-90 | |
| TAIR|locus:2084968 | 766 | EIN4 "ETHYLENE INSENSITIVE 4" | 0.989 | 0.718 | 0.357 | 1.3e-82 | |
| TAIR|locus:2018259 | 645 | ERS2 "ethylene response sensor | 0.830 | 0.716 | 0.370 | 2.5e-74 | |
| UNIPROTKB|Q4K894 | 917 | gacS "Sensor protein GacS" [Ps | 0.408 | 0.247 | 0.340 | 2.2e-27 | |
| UNIPROTKB|P0AEC5 | 918 | barA [Escherichia coli K-12 (t | 0.404 | 0.245 | 0.355 | 4.9e-27 | |
| TIGR_CMR|GSU_2314 | 1025 | GSU_2314 "sensory box histidin | 0.442 | 0.24 | 0.327 | 1.7e-26 |
| TAIR|locus:2058500 ERS1 "AT2G40940" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2138 (757.7 bits), Expect = 2.0e-221, P = 2.0e-221
Identities = 413/557 (74%), Positives = 478/557 (85%)
Query: 1 MESCDCIDTQWPPDELLVRYQYISDILIALAYFSIPVELIYFVQKSAFFPYRWVLMQFGS 60
MESCDC +T D+LLV+YQYISD LIALAYFSIP+ELIYFVQKSAFFPY+WVLMQFG+
Sbjct: 1 MESCDCFETHVNQDDLLVKYQYISDALIALAYFSIPLELIYFVQKSAFFPYKWVLMQFGA 60
Query: 61 FIILCGLTHFISLWTFTVHSKAVAVVMTIAKMACAFVSCITALMLVHIIPDLLSVKTREL 120
FIILCG THFI+LW F +HSKAVA+VMTIAK++CA VSC TALMLVHIIPDLLSVK REL
Sbjct: 61 FIILCGATHFINLWMFFMHSKAVAIVMTIAKVSCAVVSCATALMLVHIIPDLLSVKNREL 120
Query: 121 FLKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECA 180
FLK +ADELDREMGLILTQEETGRHVRMLTH IR TLDRHTIL+TTLVELG+TL LEECA
Sbjct: 121 FLKKKADELDREMGLILTQEETGRHVRMLTHGIRRTLDRHTILRTTLVELGKTLCLEECA 180
Query: 181 LWMPSRTGLNLELSYTLNNQIQIGSSVPINLPIVTDVFNSAQAMRLPYNCPLARIRLLVG 240
LWMPS++GL L+LS+TL+++IQ+GSSVPINLPI+ ++FNSAQAM +P++CPLA+I VG
Sbjct: 181 LWMPSQSGLYLQLSHTLSHKIQVGSSVPINLPIINELFNSAQAMHIPHSCPLAKIGPPVG 240
Query: 241 RYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLMLPTDGGRKWRDHELELIDVVA 300
RY PP++V+VRVPLLHLSNFQ +DW +L K YA+MVL+LPTDG RKWRDHELEL++ VA
Sbjct: 241 RYSPPEVVSVRVPLLHLSNFQGSDWSDLSGKGYAIMVLILPTDGARKWRDHELELVENVA 300
Query: 301 DQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMH 360
DQVAVALSHAAILE+SM AR+QLMEQN ALD AR+EAE A+HARNDF AVMNHEMRT MH
Sbjct: 301 DQVAVALSHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMH 360
Query: 361 AIIALSSLLLETDLTPEQRVMIETVLKSSNXXXXXXXXXXXXSRLEDGSLELDNGPFNLQ 420
AII+LSSLLLET+L+PEQRVMIET+LKSSN SRLEDGSL L+N PF+LQ
Sbjct: 361 AIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFSLQ 420
Query: 421 IVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYV 480
+ EVI LIKP+AS KKLS LI++ +LPTYA+GDEKRLMQTILNI+GNAVKFTKEGY+
Sbjct: 421 AIFEEVISLIKPIASVKKLSTNLILSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYI 480
Query: 481 SIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSR-G 539
SIIAS+ KPESL + PEF+PV +D HFYL VQV D+GCG+ QDIPLLFTKF Q R G
Sbjct: 481 SIIASIMKPESLQELPSPEFFPVLSDSHFYLCVQVKDTGCGIHTQDIPLLFTKFVQPRTG 540
Query: 540 SSCQTPRAGLGLAICRR 556
+ GLGLA+C+R
Sbjct: 541 TQRNHSGGGLGLALCKR 557
|
|
| UNIPROTKB|Q41341 Never-ripe "Ethylene receptor" [Solanum lycopersicum (taxid:4081)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q41342 ETR1 "Ethylene receptor 1" [Solanum lycopersicum (taxid:4081)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201552 ETR1 "ETHYLENE RESPONSE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086208 ETR2 "ethylene response 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084968 EIN4 "ETHYLENE INSENSITIVE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018259 ERS2 "ethylene response sensor 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4K894 gacS "Sensor protein GacS" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AEC5 barA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2314 GSU_2314 "sensory box histidine kinase/response regulator" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 556 | |||
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 7e-41 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 4e-40 | |
| COG0642 | 336 | COG0642, BaeS, Signal transduction histidine kinas | 2e-32 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 1e-31 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 1e-28 | |
| PRK11091 | 779 | PRK11091, PRK11091, aerobic respiration control se | 2e-26 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 7e-21 | |
| TIGR02966 | 333 | TIGR02966, phoR_proteo, phosphate regulon sensor k | 5e-20 | |
| COG2205 | 890 | COG2205, KdpD, Osmosensitive K+ channel histidine | 2e-19 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 2e-18 | |
| pfam01590 | 143 | pfam01590, GAF, GAF domain | 2e-17 | |
| smart00387 | 111 | smart00387, HATPase_c, Histidine kinase-like ATPas | 2e-17 | |
| pfam02518 | 111 | pfam02518, HATPase_c, Histidine kinase-, DNA gyras | 4e-17 | |
| pfam00512 | 66 | pfam00512, HisKA, His Kinase A (phospho-acceptor) | 4e-15 | |
| smart00388 | 66 | smart00388, HisKA, His Kinase A (phosphoacceptor) | 1e-14 | |
| COG5002 | 459 | COG5002, VicK, Signal transduction histidine kinas | 5e-14 | |
| cd00075 | 103 | cd00075, HATPase_c, Histidine kinase-like ATPases; | 3e-13 | |
| PRK11100 | 475 | PRK11100, PRK11100, sensory histidine kinase CreC; | 3e-12 | |
| TIGR01386 | 457 | TIGR01386, cztS_silS_copS, heavy metal sensor kina | 5e-12 | |
| PRK11360 | 607 | PRK11360, PRK11360, sensory histidine kinase AtoS; | 1e-11 | |
| COG4251 | 750 | COG4251, COG4251, Bacteriophytochrome (light-regul | 2e-10 | |
| PRK11006 | 430 | PRK11006, phoR, phosphate regulon sensor protein; | 2e-10 | |
| cd00082 | 65 | cd00082, HisKA, Histidine Kinase A (dimerization/p | 6e-10 | |
| PRK10549 | 466 | PRK10549, PRK10549, signal transduction histidine- | 6e-10 | |
| smart00065 | 149 | smart00065, GAF, Domain present in phytochromes an | 4e-09 | |
| PRK10490 | 895 | PRK10490, PRK10490, sensor protein KdpD; Provision | 4e-09 | |
| PRK10618 | 894 | PRK10618, PRK10618, phosphotransfer intermediate p | 8e-09 | |
| PRK10364 | 457 | PRK10364, PRK10364, sensor protein ZraS; Provision | 4e-08 | |
| PRK09303 | 380 | PRK09303, PRK09303, adaptive-response sensory kina | 3e-06 | |
| PRK09835 | 482 | PRK09835, PRK09835, sensor kinase CusS; Provisiona | 1e-05 | |
| PRK09467 | 435 | PRK09467, envZ, osmolarity sensor protein; Provisi | 4e-05 | |
| pfam13492 | 129 | pfam13492, GAF_3, GAF domain | 5e-05 | |
| TIGR02916 | 679 | TIGR02916, PEP_his_kin, putative PEP-CTERM system | 8e-05 | |
| PRK13837 | 828 | PRK13837, PRK13837, two-component VirA-like sensor | 1e-04 | |
| COG4192 | 673 | COG4192, COG4192, Signal transduction histidine ki | 1e-04 | |
| COG3852 | 363 | COG3852, NtrB, Signal transduction histidine kinas | 1e-04 | |
| PRK10604 | 433 | PRK10604, PRK10604, sensor protein RstB; Provision | 2e-04 | |
| COG2203 | 175 | COG2203, FhlA, FOG: GAF domain [Signal transductio | 0.002 | |
| PRK09470 | 461 | PRK09470, cpxA, two-component sensor protein; Prov | 0.002 |
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
Score = 158 bits (400), Expect = 7e-41
Identities = 92/281 (32%), Positives = 143/281 (50%), Gaps = 35/281 (12%)
Query: 289 RDHELELIDVVADQVAVALS---HAAILEDSMRARNQ-LMEQNVALDS-------ARREA 337
RD + + AD+ VA H LE + R Q L E N L++ AR EA
Sbjct: 398 RDTAAHNLKLQADERQVAQELQEHKESLEQLVAQRTQELAETNERLNAEVKNHAKARAEA 457
Query: 338 EKAIHARNDFRAVMNHEMRTLMHAIIALSSLLLETDLTPEQRVMIETVLKSSNLLTTLVD 397
E+A A++ F A M+HE+RT ++ I+ LL +T LT +Q+ ++ + +S L +++
Sbjct: 458 EEANRAKSAFLATMSHEIRTPLNGILGTLELLGDTGLTSQQQQYLQVINRSGESLLDILN 517
Query: 398 DVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDE 457
D+LD S++E G L + PF+L +L +V L+ A K + + L + +LP + GD
Sbjct: 518 DILDYSKIEAGHLSISPRPFDLNALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNWWQGDG 577
Query: 458 KRLMQTILNIVGNAVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVND 517
R+ Q ++N+VGNA+KFT G V + VS + L +V D
Sbjct: 578 PRIRQVLINLVGNAIKFTDRGSVVL-------------------RVSLNDDSSLLFEVED 618
Query: 518 SGCGVPPQDIPLLFTKFAQS--RGSSCQTPRAGLGLAICRR 556
+GCG+ ++ LF F Q+ R S T GLGLAI +R
Sbjct: 619 TGCGIAEEEQATLFDAFTQADGRRRSGGT---GLGLAISQR 656
|
This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072) [Signal transduction, Two-component systems]. Length = 968 |
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236842 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234074 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >gnl|CDD|225115 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216590 pfam01590, GAF, GAF domain | Back alignment and domain information |
|---|
| >gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|215963 pfam00512, HisKA, His Kinase A (phospho-acceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214644 smart00388, HisKA, His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >gnl|CDD|227335 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236846 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233391 TIGR01386, cztS_silS_copS, heavy metal sensor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|236901 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226702 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214500 smart00065, GAF, Domain present in phytochromes and cGMP-specific phosphodiesterases | Back alignment and domain information |
|---|
| >gnl|CDD|236701 PRK10490, PRK10490, sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236726 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236674 PRK10364, PRK10364, sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236462 PRK09303, PRK09303, adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236531 PRK09467, envZ, osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222174 pfam13492, GAF_3, GAF domain | Back alignment and domain information |
|---|
| >gnl|CDD|234058 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|237526 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226655 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226370 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236724 PRK10604, PRK10604, sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225113 COG2203, FhlA, FOG: GAF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 556 | |||
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 100.0 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 100.0 | |
| COG3275 | 557 | LytS Putative regulator of cell autolysis [Signal | 100.0 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 100.0 | |
| TIGR02916 | 679 | PEP_his_kin putative PEP-CTERM system histidine ki | 100.0 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 100.0 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 99.97 | |
| PRK09303 | 380 | adaptive-response sensory kinase; Validated | 99.97 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 99.97 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 99.97 | |
| COG4251 | 750 | Bacteriophytochrome (light-regulated signal transd | 99.96 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 99.96 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 99.96 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 99.96 | |
| COG4191 | 603 | Signal transduction histidine kinase regulating C4 | 99.95 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 99.95 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 99.95 | |
| COG3852 | 363 | NtrB Signal transduction histidine kinase, nitroge | 99.95 | |
| PRK10364 | 457 | sensor protein ZraS; Provisional | 99.93 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 99.93 | |
| PRK10604 | 433 | sensor protein RstB; Provisional | 99.93 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 99.92 | |
| PRK10815 | 485 | sensor protein PhoQ; Provisional | 99.92 | |
| TIGR03785 | 703 | marine_sort_HK proteobacterial dedicated sortase s | 99.92 | |
| COG5000 | 712 | NtrY Signal transduction histidine kinase involved | 99.92 | |
| PRK10755 | 356 | sensor protein BasS/PmrB; Provisional | 99.91 | |
| PRK10549 | 466 | signal transduction histidine-protein kinase BaeS; | 99.91 | |
| TIGR01386 | 457 | cztS_silS_copS heavy metal sensor kinase. Members | 99.91 | |
| PRK10337 | 449 | sensor protein QseC; Provisional | 99.9 | |
| PRK09835 | 482 | sensor kinase CusS; Provisional | 99.9 | |
| TIGR02966 | 333 | phoR_proteo phosphate regulon sensor kinase PhoR. | 99.9 | |
| PRK11100 | 475 | sensory histidine kinase CreC; Provisional | 99.89 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 99.89 | |
| PRK09470 | 461 | cpxA two-component sensor protein; Provisional | 99.89 | |
| PRK09467 | 435 | envZ osmolarity sensor protein; Provisional | 99.88 | |
| COG4192 | 673 | Signal transduction histidine kinase regulating ph | 99.87 | |
| PRK10600 | 569 | nitrate/nitrite sensor protein NarX; Provisional | 99.86 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 99.85 | |
| COG0642 | 336 | BaeS Signal transduction histidine kinase [Signal | 99.84 | |
| PRK11644 | 495 | sensory histidine kinase UhpB; Provisional | 99.83 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.82 | |
| COG3850 | 574 | NarQ Signal transduction histidine kinase, nitrate | 99.81 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 99.78 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 99.77 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.73 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 99.72 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 99.69 | |
| PRK10935 | 565 | nitrate/nitrite sensor protein NarQ; Provisional | 99.63 | |
| COG3851 | 497 | UhpB Signal transduction histidine kinase, glucose | 99.56 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 99.54 | |
| PF02518 | 111 | HATPase_c: Histidine kinase-, DNA gyrase B-, and H | 99.44 | |
| COG4564 | 459 | Signal transduction histidine kinase [Signal trans | 99.36 | |
| COG4585 | 365 | Signal transduction histidine kinase [Signal trans | 99.33 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 99.32 | |
| PRK10547 | 670 | chemotaxis protein CheA; Provisional | 99.26 | |
| PRK11061 | 748 | fused phosphoenolpyruvate-protein phosphotransfera | 99.2 | |
| COG2972 | 456 | Predicted signal transduction protein with a C-ter | 99.19 | |
| COG3920 | 221 | Signal transduction histidine kinase [Signal trans | 99.17 | |
| PF00512 | 68 | HisKA: His Kinase A (phospho-acceptor) domain; Int | 99.16 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 99.06 | |
| PRK14868 | 795 | DNA topoisomerase VI subunit B; Provisional | 99.02 | |
| PF13492 | 129 | GAF_3: GAF domain; PDB: 3EEA_A 4DMZ_A 4DN0_A 1VHM_ | 98.98 | |
| PRK04184 | 535 | DNA topoisomerase VI subunit B; Validated | 98.94 | |
| TIGR01925 | 137 | spIIAB anti-sigma F factor. This model describes t | 98.89 | |
| TIGR01052 | 488 | top6b DNA topoisomerase VI, B subunit. This model | 98.85 | |
| COG0643 | 716 | CheA Chemotaxis protein histidine kinase and relat | 98.84 | |
| PF01590 | 154 | GAF: GAF domain; InterPro: IPR003018 This domain i | 98.8 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 98.79 | |
| smart00387 | 111 | HATPase_c Histidine kinase-like ATPases. Histidine | 98.72 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 98.7 | |
| PRK04069 | 161 | serine-protein kinase RsbW; Provisional | 98.69 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 98.69 | |
| PRK03660 | 146 | anti-sigma F factor; Provisional | 98.66 | |
| COG3605 | 756 | PtsP Signal transduction protein containing GAF an | 98.59 | |
| PRK14867 | 659 | DNA topoisomerase VI subunit B; Provisional | 98.59 | |
| smart00065 | 149 | GAF Domain present in phytochromes and cGMP-specif | 98.55 | |
| PF13185 | 148 | GAF_2: GAF domain; PDB: 2QYB_A 3KSG_B 3KSF_C 3KSI_ | 98.5 | |
| TIGR01924 | 159 | rsbW_low_gc serine-protein kinase RsbW. This model | 98.45 | |
| cd00075 | 103 | HATPase_c Histidine kinase-like ATPases; This fami | 98.45 | |
| smart00388 | 66 | HisKA His Kinase A (phosphoacceptor) domain. Dimer | 98.4 | |
| TIGR00585 | 312 | mutl DNA mismatch repair protein MutL. All protein | 98.15 | |
| KOG0787 | 414 | consensus Dehydrogenase kinase [Signal transductio | 98.13 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 98.06 | |
| cd00082 | 65 | HisKA Histidine Kinase A (dimerization/phosphoacce | 98.03 | |
| PF13581 | 125 | HATPase_c_2: Histidine kinase-like ATPase domain | 97.93 | |
| COG1389 | 538 | DNA topoisomerase VI, subunit B [DNA replication, | 97.89 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 97.82 | |
| COG2203 | 175 | FhlA FOG: GAF domain [Signal transduction mechanis | 97.77 | |
| TIGR02851 | 180 | spore_V_T stage V sporulation protein T. Members o | 97.61 | |
| COG2172 | 146 | RsbW Anti-sigma regulatory factor (Ser/Thr protein | 97.61 | |
| PRK00095 | 617 | mutL DNA mismatch repair protein; Reviewed | 97.34 | |
| PF13589 | 137 | HATPase_c_3: Histidine kinase-, DNA gyrase B-, and | 97.22 | |
| PF14501 | 100 | HATPase_c_5: GHKL domain | 96.98 | |
| COG0323 | 638 | MutL DNA mismatch repair enzyme (predicted ATPase) | 96.64 | |
| COG1956 | 163 | GAF domain-containing protein [Signal transduction | 96.49 | |
| PRK05559 | 631 | DNA topoisomerase IV subunit B; Reviewed | 96.46 | |
| PF11849 | 174 | DUF3369: Domain of unknown function (DUF3369); Int | 96.32 | |
| PF07568 | 76 | HisKA_2: Histidine kinase; InterPro: IPR011495 Two | 96.21 | |
| PRK05644 | 638 | gyrB DNA gyrase subunit B; Validated | 95.93 | |
| PRK14083 | 601 | HSP90 family protein; Provisional | 95.44 | |
| TIGR01059 | 654 | gyrB DNA gyrase, B subunit. This model describes t | 95.2 | |
| PRK05218 | 613 | heat shock protein 90; Provisional | 94.97 | |
| PF04340 | 225 | DUF484: Protein of unknown function, DUF484; Inter | 94.95 | |
| TIGR01055 | 625 | parE_Gneg DNA topoisomerase IV, B subunit, proteob | 94.95 | |
| PTZ00272 | 701 | heat shock protein 83 kDa (Hsp83); Provisional | 94.51 | |
| smart00433 | 594 | TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras | 94.23 | |
| TIGR01058 | 637 | parE_Gpos DNA topoisomerase IV, B subunit, Gram-po | 94.05 | |
| COG0326 | 623 | HtpG Molecular chaperone, HSP90 family [Posttransl | 94.04 | |
| PRK14939 | 756 | gyrB DNA gyrase subunit B; Provisional | 93.77 | |
| COG5381 | 184 | Uncharacterized protein conserved in bacteria [Fun | 93.38 | |
| PHA02569 | 602 | 39 DNA topoisomerase II large subunit; Provisional | 93.25 | |
| PLN03128 | 1135 | DNA topoisomerase 2; Provisional | 92.89 | |
| PF06580 | 82 | His_kinase: Histidine kinase; InterPro: IPR010559 | 92.71 | |
| PLN03237 | 1465 | DNA topoisomerase 2; Provisional | 91.82 | |
| PTZ00108 | 1388 | DNA topoisomerase 2-like protein; Provisional | 91.71 | |
| COG0187 | 635 | GyrB Type IIA topoisomerase (DNA gyrase/topo II, t | 91.37 | |
| PTZ00109 | 903 | DNA gyrase subunit b; Provisional | 91.2 | |
| PTZ00130 | 814 | heat shock protein 90; Provisional | 90.81 | |
| KOG1978 | 672 | consensus DNA mismatch repair protein - MLH2/PMS1/ | 90.76 | |
| PF14689 | 62 | SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do | 90.25 | |
| KOG1979 | 694 | consensus DNA mismatch repair protein - MLH1 famil | 90.12 | |
| PF06018 | 177 | CodY: CodY GAF-like domain; InterPro: IPR010312 Th | 89.41 | |
| KOG1977 | 1142 | consensus DNA mismatch repair protein - MLH3 famil | 88.13 | |
| COG5385 | 214 | Uncharacterized protein conserved in bacteria [Fun | 87.29 | |
| PRK10963 | 223 | hypothetical protein; Provisional | 85.64 | |
| COG4465 | 261 | CodY Pleiotropic transcriptional repressor [Transc | 85.11 | |
| PRK04158 | 256 | transcriptional repressor CodY; Validated | 82.43 |
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.8e-42 Score=346.34 Aligned_cols=360 Identities=22% Similarity=0.328 Sum_probs=283.8
Q ss_pred HHHHHHHHHHHHHHhhhHHHHhHHHHHHHHHHHccCChHHHHHHHHHHHHhhhCCceeEEEccCCCCCeeEEEEeecccc
Q 008720 122 LKNRADELDREMGLILTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECALWMPSRTGLNLELSYTLNNQI 201 (556)
Q Consensus 122 ~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~il~~~~~~l~~~l~~~~~~i~l~~~~~~~~~~~~~~~~~~ 201 (556)
.++++.+++++....++++++.+.++++++.|..+.+.++++..+.+.+.++++. ++.++++++++....+ .....
T Consensus 488 t~~Lt~~vr~Qa~~ar~r~~rT~~Lye~s~~L~~a~t~~~vl~~~~~qi~~~~~~-~v~i~l~~~~~~~~~~--~~~~~- 563 (890)
T COG2205 488 TGNLTARVREQARAARRREQRTELLYEFSKKLAGARTREDILAAAGQQIASLLNQ-RVVILLPDDNGKLQPL--GNPDG- 563 (890)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhCC-ceEEEEecCCcccccc--cCCcc-
Confidence 3558899999999999999999999999999999999999999999999999998 6777888866544111 11100
Q ss_pred cccccccc-CChhHHHHhcccCceEccCCCchhhhhhcccCCCCCcceeeeeccccccCccccCCCCCCcccceEEEEEe
Q 008720 202 QIGSSVPI-NLPIVTDVFNSAQAMRLPYNCPLARIRLLVGRYVPPDIVAVRVPLLHLSNFQINDWPELPAKSYAVMVLML 280 (556)
Q Consensus 202 ~~~~~~~~-~~~~~~~v~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~pl~~~~~~~~~~~~~l~~~~~~~~vl~~ 280 (556)
+.. +......++.++++-- .+.-..|....+..| +..++...|++.+
T Consensus 564 -----l~~~d~aaa~W~~~~~~~AG-------------~gTdTlpg~~~~~lP--------------l~~~~~~~gvlgv 611 (890)
T COG2205 564 -----LSADDRAAAQWAFENGKPAG-------------AGTDTLPGAKYLYLP--------------LKSGGKVLGVLGV 611 (890)
T ss_pred -----ccHHHHHHhhchhhCCCccc-------------cCCCCCCCCceeEee--------------cccCCceEEEEEe
Confidence 000 1112233333332210 122234555555666 7777888999999
Q ss_pred ccCCCCccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcHHH
Q 008720 281 PTDGGRKWRDHELELIDVVADQVAVALSHAAILEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMH 360 (556)
Q Consensus 281 ~~~~~~~~~~~e~~ll~~~a~~~~~al~~a~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~l~~~i~Hel~~pL~ 360 (556)
........++++..++..++++++.|+++..+.++..+.+- ..+.++.+++|++.+||||||||+
T Consensus 612 ~~~~~~ll~p~~~rlL~a~~~q~AlAler~~L~~~~~~a~l---------------~~e~E~lRsaLL~sISHDLRTPLt 676 (890)
T COG2205 612 EPGLSPLLAPEQRRLLDAVLTQIALALERVTLAEEAEQARL---------------AAERERLRSALLASISHDLRTPLT 676 (890)
T ss_pred cCCCCccCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------HHHHHHHHHHHHHHhhccccCcHH
Confidence 98877779999999999999999999988877665443321 122345578999999999999999
Q ss_pred HHHHHHHHHhcC--CC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhcCCccccccceeHHHHHHHHHHHHHHhhhcC
Q 008720 361 AIIALSSLLLET--DL-TPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIKPVASCK 437 (556)
Q Consensus 361 ~I~~~~~~l~~~--~~-~~~~~~~l~~i~~~~~~l~~li~~l~~~~~~~~~~~~l~~~~~~l~~ll~~~~~~~~~~~~~~ 437 (556)
+|.|.++.|... .. +++..+.+..+.+.++++..++++++++.|+++|.++++.++..+.+++.+++..+.......
T Consensus 677 ~i~Gaa~tL~~~~~~l~~~~~aeLl~~I~ees~~L~rlV~NLLdmTRi~sG~~~l~~~~~~veEvVg~Al~r~~k~~~~~ 756 (890)
T COG2205 677 AIMGAAETLLLDGEALSPEDRAELLSSIREESERLTRLVTNLLDMTRLQSGGVNLKLDWVLVEEVVGEALQRLRKRFTGH 756 (890)
T ss_pred HHhhhHHHhhhcccccCcHhHHHHHHHHHHHHHHHHHHHHHHHhHHHHhcCCcccccchhhHHHHHHHHHHHhhhhcCCc
Confidence 999999999865 33 445778999999999999999999999999999999999999999999999999888776544
Q ss_pred CceEEEEeCCCCCceEEccHHHHHHHHHHHHHHHhhcCCCCeEEEEEEeecCCCCCCCCCCCCCCCCCCCceEEEEEEEe
Q 008720 438 KLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVND 517 (556)
Q Consensus 438 ~i~i~~~~~~~~~~~~~~d~~~l~~vl~nLl~NAik~~~~g~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~i~V~D 517 (556)
. +.++++.+++ ++..|...+.||+-||++||+||++++..+-+....+.+ .++++|.|
T Consensus 757 ~--i~v~~~~dl~-li~~D~~LieQVLiNLleNA~Kyap~~s~I~I~~~~~~~-------------------~v~~~V~D 814 (890)
T COG2205 757 K--IVVSVPVDLP-LIHVDSPLIEQVLINLLENALKYAPPGSEIRINAGVERE-------------------NVVFSVID 814 (890)
T ss_pred e--EEEecCCCCc-eEecCHHHHHHHHHHHHHHHHhhCCCCCeEEEEEEEecc-------------------eEEEEEEe
Confidence 4 6666677766 477899999999999999999999987744444444333 39999999
Q ss_pred cCCCCCCCChhhhhccCcccCCCCCCCCCCceeeeccc
Q 008720 518 SGCGVPPQDIPLLFTKFAQSRGSSCQTPRAGLGLAICR 555 (556)
Q Consensus 518 nG~Gi~~e~~~~iF~~f~~~~~~~~~~~G~GlGL~i~k 555 (556)
+|+|||++..++|||+||+...... ..|+||||+|||
T Consensus 815 eGpGIP~~~~~~IFD~F~r~~~~~~-~~G~GLGLsIc~ 851 (890)
T COG2205 815 EGPGIPEGELERIFDKFYRGNKESA-TRGVGLGLAICR 851 (890)
T ss_pred CCCCCChhHHHHhhhhhhcCCCCCC-CCCccccHHHHH
Confidence 9999999999999999999776443 679999999997
|
|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PRK09303 adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10364 sensor protein ZraS; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10604 sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >PRK10815 sensor protein PhoQ; Provisional | Back alignment and domain information |
|---|
| >TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase | Back alignment and domain information |
|---|
| >COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10755 sensor protein BasS/PmrB; Provisional | Back alignment and domain information |
|---|
| >PRK10549 signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
| >TIGR01386 cztS_silS_copS heavy metal sensor kinase | Back alignment and domain information |
|---|
| >PRK10337 sensor protein QseC; Provisional | Back alignment and domain information |
|---|
| >PRK09835 sensor kinase CusS; Provisional | Back alignment and domain information |
|---|
| >TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >PRK11100 sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >PRK09470 cpxA two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK09467 envZ osmolarity sensor protein; Provisional | Back alignment and domain information |
|---|
| >COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10600 nitrate/nitrite sensor protein NarX; Provisional | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11644 sensory histidine kinase UhpB; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >PRK10935 nitrate/nitrite sensor protein NarQ; Provisional | Back alignment and domain information |
|---|
| >COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PRK10547 chemotaxis protein CheA; Provisional | Back alignment and domain information |
|---|
| >PRK11061 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional | Back alignment and domain information |
|---|
| >COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00512 HisKA: His Kinase A (phospho-acceptor) domain; InterPro: IPR003661 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK14868 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >PF13492 GAF_3: GAF domain; PDB: 3EEA_A 4DMZ_A 4DN0_A 1VHM_A | Back alignment and domain information |
|---|
| >PRK04184 DNA topoisomerase VI subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01925 spIIAB anti-sigma F factor | Back alignment and domain information |
|---|
| >TIGR01052 top6b DNA topoisomerase VI, B subunit | Back alignment and domain information |
|---|
| >COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01590 GAF: GAF domain; InterPro: IPR003018 This domain is present in phytochromes and cGMP-specific phosphodiesterases | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >smart00387 HATPase_c Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04069 serine-protein kinase RsbW; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK03660 anti-sigma F factor; Provisional | Back alignment and domain information |
|---|
| >COG3605 PtsP Signal transduction protein containing GAF and PtsI domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14867 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >smart00065 GAF Domain present in phytochromes and cGMP-specific phosphodiesterases | Back alignment and domain information |
|---|
| >PF13185 GAF_2: GAF domain; PDB: 2QYB_A 3KSG_B 3KSF_C 3KSI_A 3KSH_A 3MMH_A 3RFB_B 1F5M_A 3KO6_B 3HCY_A | Back alignment and domain information |
|---|
| >TIGR01924 rsbW_low_gc serine-protein kinase RsbW | Back alignment and domain information |
|---|
| >cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >smart00388 HisKA His Kinase A (phosphoacceptor) domain | Back alignment and domain information |
|---|
| >TIGR00585 mutl DNA mismatch repair protein MutL | Back alignment and domain information |
|---|
| >KOG0787 consensus Dehydrogenase kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase | Back alignment and domain information |
|---|
| >PF13581 HATPase_c_2: Histidine kinase-like ATPase domain | Back alignment and domain information |
|---|
| >COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >COG2203 FhlA FOG: GAF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02851 spore_V_T stage V sporulation protein T | Back alignment and domain information |
|---|
| >COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00095 mutL DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B | Back alignment and domain information |
|---|
| >PF14501 HATPase_c_5: GHKL domain | Back alignment and domain information |
|---|
| >COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1956 GAF domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05559 DNA topoisomerase IV subunit B; Reviewed | Back alignment and domain information |
|---|
| >PF11849 DUF3369: Domain of unknown function (DUF3369); InterPro: IPR021800 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF07568 HisKA_2: Histidine kinase; InterPro: IPR011495 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK05644 gyrB DNA gyrase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14083 HSP90 family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01059 gyrB DNA gyrase, B subunit | Back alignment and domain information |
|---|
| >PRK05218 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PF04340 DUF484: Protein of unknown function, DUF484; InterPro: IPR007435 This family consists of several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial | Back alignment and domain information |
|---|
| >PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >smart00433 TOP2c TopoisomeraseII | Back alignment and domain information |
|---|
| >TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive | Back alignment and domain information |
|---|
| >COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14939 gyrB DNA gyrase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG5381 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PHA02569 39 DNA topoisomerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03128 DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >PF06580 His_kinase: Histidine kinase; InterPro: IPR010559 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PLN03237 DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >PTZ00108 DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00109 DNA gyrase subunit b; Provisional | Back alignment and domain information |
|---|
| >PTZ00130 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >KOG1978 consensus DNA mismatch repair protein - MLH2/PMS1/Pms2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B | Back alignment and domain information |
|---|
| >KOG1979 consensus DNA mismatch repair protein - MLH1 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06018 CodY: CodY GAF-like domain; InterPro: IPR010312 This family consists of several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins | Back alignment and domain information |
|---|
| >KOG1977 consensus DNA mismatch repair protein - MLH3 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5385 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10963 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4465 CodY Pleiotropic transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PRK04158 transcriptional repressor CodY; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 556 | ||||
| 3dge_A | 258 | Structure Of A Histidine Kinase-response Regulator | 2e-10 | ||
| 2c2a_A | 258 | Structure Of The Entire Cytoplasmic Portion Of A Se | 2e-10 | ||
| 3sl2_A | 177 | Atp Forms A Stable Complex With The Essential Histi | 7e-05 | ||
| 3a0r_A | 349 | Crystal Structure Of Histidine Kinase Thka (Tm1359) | 7e-04 |
| >pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 258 | Back alignment and structure |
|
| >pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 | Back alignment and structure |
| >pdb|3SL2|A Chain A, Atp Forms A Stable Complex With The Essential Histidine Kinase Walk (yycg) Domain Length = 177 | Back alignment and structure |
| >pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 556 | |||
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 1e-56 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 4e-49 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 3e-24 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 8e-22 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 3e-21 | |
| 3p01_A | 184 | Two-component response regulator; PSI-2, midwest c | 6e-19 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 4e-18 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 5e-17 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 3e-16 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 4e-16 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 4e-16 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 3e-14 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 3e-14 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 4e-14 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 7e-14 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 9e-14 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 2e-13 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 2e-12 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 7e-10 | |
| 3o5y_A | 165 | Sensor protein; GAF domain, histidine, kinase, PSI | 3e-09 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 3e-09 | |
| 3k2n_A | 177 | Sigma-54-dependent transcriptional regulator; PSI- | 7e-09 | |
| 2qyb_A | 181 | Membrane protein, putative; GAF domain, domain of | 2e-06 | |
| 4fmt_A | 228 | CHPT protein; A phosphotransfer protein, A two-com | 3e-06 | |
| 3trc_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; si | 3e-06 | |
| 3e0y_A | 181 | Conserved domain protein; APC87688.2, geobacter su | 5e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-05 | |
| 3ci6_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; PE | 4e-05 | |
| 3oov_A | 169 | Methyl-accepting chemotaxis protein, putative; str | 7e-04 |
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Length = 268 | Back alignment and structure |
|---|
Score = 190 bits (484), Expect = 1e-56
Identities = 57/248 (22%), Positives = 106/248 (42%), Gaps = 34/248 (13%)
Query: 313 LEDSMRARNQLMEQNVALDSARREAEKAIHARNDFRAVMNHEMRTLMHAIIALSSLLLET 372
+ + +++ AL +A + DF +++E+RT + II S LL
Sbjct: 11 SSGLVPRGSHMLQS--ALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERA 68
Query: 373 D-LTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELDNGPFNLQIVLREVIKLIK 431
D ++ R + V ++ L +DDVLD+++++ G + L+ + +L +
Sbjct: 69 DGISERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERAL 128
Query: 432 PVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKE-GYVSIIASVAKPE 490
A +++ + ++ GD KRL QT+ ++V NA++ T G V++ A A E
Sbjct: 129 KDAQLGGVTLAVECEEDVGL-IRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGE 187
Query: 491 SLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSR--GSSCQTPRAG 548
+R+ V+D+G GVP +F +F G G
Sbjct: 188 --------------------VRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGP-------G 220
Query: 549 LGLAICRR 556
LGLA+ +
Sbjct: 221 LGLALVKA 228
|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Length = 258 | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Length = 222 | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Length = 388 | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 | Back alignment and structure |
|---|
| >3p01_A Two-component response regulator; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, signali protein; 2.65A {Nostoc SP} Length = 184 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Length = 177 | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Length = 394 | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Length = 394 | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Length = 150 | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Length = 407 | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Length = 419 | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Length = 152 | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Length = 161 | Back alignment and structure |
|---|
| >3o5y_A Sensor protein; GAF domain, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics, protein S initiative; 2.45A {Bacillus halodurans} Length = 165 | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Length = 160 | Back alignment and structure |
|---|
| >3k2n_A Sigma-54-dependent transcriptional regulator; PSI-2, protein structure initiative, structural genomics; 2.50A {Chlorobium tepidum tls} Length = 177 | Back alignment and structure |
|---|
| >2qyb_A Membrane protein, putative; GAF domain, domain of putative membrane protein, PSI-2, MCSG structural genomics; 2.40A {Geobacter sulfurreducens pca} Length = 181 | Back alignment and structure |
|---|
| >4fmt_A CHPT protein; A phosphotransfer protein, A two-component signaling pathway structural genomics, joint center for structural genomics; 2.30A {Caulobacter crescentus} Length = 228 | Back alignment and structure |
|---|
| >3trc_A Phosphoenolpyruvate-protein phosphotransferase; signal transduction; HET: MSE; 1.65A {Coxiella burnetii} Length = 171 | Back alignment and structure |
|---|
| >3e0y_A Conserved domain protein; APC87688.2, geobacter sulfurreducens PCA, structural genomics, PSI-2, midwest center for structural G MCSG; 3.10A {Geobacter sulfurreducens} Length = 181 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3ci6_A Phosphoenolpyruvate-protein phosphotransferase; PEP-phosphotransferase, GAF domain, structura genomics, PSI-2, protein structure initiative; HET: MSE P4G; 1.55A {Acinetobacter SP} Length = 171 | Back alignment and structure |
|---|
| >3oov_A Methyl-accepting chemotaxis protein, putative; structural genomics, PSI-2, protein structure initiative; 2.20A {Geobacter sulfurreducens} Length = 169 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 556 | |||
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 99.97 | |
| 4ew8_A | 268 | Sensor protein DIVL; signal transduction, two-comp | 99.96 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 99.94 | |
| 1gkz_A | 388 | [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] | 99.93 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 99.93 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 99.92 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 99.92 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 99.92 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 99.92 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 99.9 | |
| 4fpp_A | 247 | Phosphotransferase; four helix bundle, bergerat fo | 99.9 | |
| 1b3q_A | 379 | Protein (chemotaxis protein CHEA); histine kinase, | 99.82 | |
| 3ehh_A | 218 | Sensor kinase (YOCF protein); four-helix bundle, G | 99.82 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 99.74 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 99.74 | |
| 1ysr_A | 150 | Sensor-type histidine kinase PRRB; ATP-binding dom | 99.73 | |
| 1bxd_A | 161 | ENVZ(290-450), protein (osmolarity sensor protein | 99.71 | |
| 1r62_A | 160 | Nitrogen regulation protein NR(II); PII, histidine | 99.7 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 99.69 | |
| 1i58_A | 189 | Chemotaxis protein CHEA; beta-alpha sandwich, sign | 99.65 | |
| 3p01_A | 184 | Two-component response regulator; PSI-2, midwest c | 99.56 | |
| 3ehg_A | 128 | Sensor kinase (YOCF protein); GHL ATPase domain, t | 99.5 | |
| 3e0y_A | 181 | Conserved domain protein; APC87688.2, geobacter su | 99.45 | |
| 3trc_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; si | 99.44 | |
| 2e4s_A | 189 | CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphod | 99.43 | |
| 3k2n_A | 177 | Sigma-54-dependent transcriptional regulator; PSI- | 99.4 | |
| 2zmf_A | 189 | CAMP and CAMP-inhibited CGMP 3',5'-cyclic phospho | 99.4 | |
| 4glq_A | 171 | Methyl-accepting chemotaxis protein; chromophore, | 99.38 | |
| 3zxo_A | 129 | Redox sensor histidine kinase response regulator; | 99.36 | |
| 3ci6_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; PE | 99.33 | |
| 3o5y_A | 165 | Sensor protein; GAF domain, histidine, kinase, PSI | 99.32 | |
| 1th8_A | 145 | Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s | 99.32 | |
| 3oov_A | 169 | Methyl-accepting chemotaxis protein, putative; str | 99.28 | |
| 2lb5_A | 208 | Sensor histidine kinase; PCB, transferase, GAF dom | 99.26 | |
| 3zxq_A | 124 | Hypoxia sensor histidine kinase response regulato; | 99.24 | |
| 2vjw_A | 149 | GAF-B, GAF family protein; histidine kinase, hypox | 99.18 | |
| 1ykd_A | 398 | Adenylate cyclase; GAF domain, bound cyclic AMP li | 99.18 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 99.16 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 99.15 | |
| 3ibj_A | 691 | CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE | 99.12 | |
| 3dba_A | 180 | CONE CGMP-specific 3',5'-cyclic phosphodiesterase | 99.12 | |
| 3mmh_A | 167 | FRMSR, methionine-R-sulfoxide reductase; oxidoredu | 99.11 | |
| 2qyb_A | 181 | Membrane protein, putative; GAF domain, domain of | 99.11 | |
| 1mc0_A | 368 | 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF | 99.1 | |
| 1mc0_A | 368 | 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF | 99.1 | |
| 2w3g_A | 153 | DOSS, two component sensor histidine kinase DEVS ( | 99.05 | |
| 3hcy_A | 151 | Putative two-component sensor histidine kinase PR; | 99.03 | |
| 1ykd_A | 398 | Adenylate cyclase; GAF domain, bound cyclic AMP li | 99.0 | |
| 1vhm_A | 195 | Protein YEBR; structural genomics, unknown functio | 98.98 | |
| 3ibj_A | 691 | CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE | 98.96 | |
| 3cit_A | 160 | Sensor histidine kinase; MEGA: 3.30.450.40, struct | 98.94 | |
| 2q2e_B | 621 | Type 2 DNA topoisomerase 6 subunit B; DNA-binding, | 98.93 | |
| 2k2n_A | 172 | Sensor protein, SYB-CPH1(GAF); phytochrome, GAF do | 98.88 | |
| 2ool_A | 337 | Sensor protein; bacteriophytochrome, photoconversi | 98.87 | |
| 3nhq_A | 505 | Bacteriophytochrome; photoreceptor, PAS, signaling | 98.86 | |
| 4e04_A | 327 | Bacteriophytochrome (light-regulated signal trans | 98.85 | |
| 3s7o_A | 343 | Bacteriophytochrome; biliverdin, PAS, GAF, photore | 98.82 | |
| 3zq5_A | 520 | Phytochrome-like protein CPH1; arginine finger, ta | 98.82 | |
| 1f5m_A | 180 | GAF; CGMP binding, signaling protein; 1.90A {Sacch | 98.75 | |
| 3rfb_A | 171 | Putative uncharacterized protein; FRMSR, GAF, oxid | 98.73 | |
| 3ksh_A | 160 | Putative uncharacterized protein; FRMSR, free-Met- | 98.67 | |
| 3eea_A | 162 | GAF domain/HD domain protein; structural genomics, | 98.59 | |
| 1b63_A | 333 | MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A | 98.53 | |
| 3bjc_A | 878 | CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5 | 98.49 | |
| 3na3_A | 348 | DNA mismatch repair protein MLH1; MUTL protein hom | 98.44 | |
| 3bjc_A | 878 | CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5 | 98.44 | |
| 1h7s_A | 365 | PMS1 protein homolog 2; DNA repair, GHL ATPase, mi | 98.43 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 98.41 | |
| 1ixm_A | 192 | SPO0B, protein (sporulation response regulatory pr | 98.37 | |
| 1kij_A | 390 | DNA gyrase subunit B; topoisomerase, gyrase B-coum | 98.23 | |
| 3h4l_A | 367 | DNA mismatch repair protein PMS1; ATP binding, DNA | 98.16 | |
| 3zcc_A | 114 | HAMP, osmolarity sensor protein ENVZ; signaling pr | 98.11 | |
| 3ke6_A | 399 | Protein RV1364C/MT1410; anti-sigma factor, anti-si | 97.83 | |
| 3zrx_A | 115 | AF1503 protein, osmolarity sensor protein ENVZ; si | 97.53 | |
| 1s16_A | 390 | Topoisomerase IV subunit B; two-domain protein com | 97.44 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 97.44 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 97.26 | |
| 1ei1_A | 391 | DNA gyrase B, GYRB; ATPase domain, dimer, isomeras | 97.25 | |
| 2w1r_A | 123 | Spovt, stage V sporulation protein T; regulatory G | 97.22 | |
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 97.07 | |
| 3fv5_A | 201 | DNA topoisomerase 4 subunit B; topoisomerase IV B | 96.77 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 96.6 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 96.56 | |
| 1zxm_A | 400 | TOPO IIA ATPase, DNA topoisomerase II, alpha isozy | 96.46 | |
| 3cwv_A | 369 | DNA gyrase, B subunit, truncated; structural genom | 96.43 | |
| 4duh_A | 220 | DNA gyrase subunit B; structure-based drug design, | 96.4 | |
| 3ttz_A | 198 | DNA gyrase subunit B; protein-inhibitor complex, A | 96.38 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 96.18 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 96.15 | |
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 96.13 | |
| 1pvg_A | 418 | DNA topoisomerase II; GHKL ATPase domain; HET: DNA | 96.09 | |
| 4emv_A | 226 | DNA topoisomerase IV, B subunit; protein-inhibitor | 96.02 | |
| 4eu0_A | 298 | PELD; C-DI-GMP, signaling protein; HET: C2E; 1.70A | 95.82 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 95.7 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 95.2 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 94.91 | |
| 3lnu_A | 408 | Topoisomerase IV subunit B; PARE, ATP-binding, nuc | 94.7 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 94.32 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 93.81 | |
| 3ied_A | 272 | Heat shock protein; HSP90, chaperone, structural g | 92.77 | |
| 3e98_A | 252 | GAF domain of unknown function; structural genomic | 91.9 | |
| 4gfh_A | 1177 | DNA topoisomerase 2; topoisomerase, protein-DNA co | 91.12 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 88.4 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 88.3 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 82.52 |
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=4.5e-30 Score=245.46 Aligned_cols=200 Identities=28% Similarity=0.448 Sum_probs=163.2
Q ss_pred HHHHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHhcC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhcCCcccc
Q 008720 337 AEKAIHARNDFRAVMNHEMRTLMHAIIALSSLLLET---DLTPEQRVMIETVLKSSNLLTTLVDDVLDLSRLEDGSLELD 413 (556)
Q Consensus 337 ~~~~~~~~~~l~~~i~Hel~~pL~~I~~~~~~l~~~---~~~~~~~~~l~~i~~~~~~l~~li~~l~~~~~~~~~~~~l~ 413 (556)
+++..+.+.+|++.++|||||||++|.++++.+... ...+..+++++.+.+.++++..++++++++++.+.+...+.
T Consensus 13 l~~~~~~~~~~~~~isHelrtPL~~i~~~~~~l~~~~~~~~~~~~~~~l~~i~~~~~~l~~li~~ll~~~~~~~~~~~~~ 92 (258)
T 2c2a_A 13 LKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQIN 92 (258)
T ss_dssp HHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTGGGCCTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCC
T ss_pred HHHHHHHHHHHHHHhhhhhcCCHHHHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCccCc
Confidence 444556678999999999999999999999998753 23345678899999999999999999999999998888888
Q ss_pred ccceeHHHHHHHHHHHHHHhhhcCCceEEEEeCCCCCceEEccHHHHHHHHHHHHHHHhhcCCCC----eEEEEEEeecC
Q 008720 414 NGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEG----YVSIIASVAKP 489 (556)
Q Consensus 414 ~~~~~l~~ll~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~d~~~l~~vl~nLl~NAik~~~~g----~~~i~~~~~~~ 489 (556)
.+++++.+++++++..+...+..+++.+.++.+...+..+.+|+..+.+++.||+.||+||++.+ .+.+..... +
T Consensus 93 ~~~~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~d~~~l~~il~NLl~NAik~~~~~~~~~~i~i~~~~~-~ 171 (258)
T 2c2a_A 93 REKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEK-D 171 (258)
T ss_dssp CEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEEE-T
T ss_pred cceecHHHHHHHHHHHHHHHHHHcCcEEEeecCCCCCceEEeCHHHHHHHHHHHHHHHHhcCcCCCCceeEEEEEecC-C
Confidence 89999999999999999999888999998877645455577899999999999999999999754 233333322 2
Q ss_pred CCCCCCCCCCCCCCCCCCceEEEEEEEecCCCCCCCChhhhhccCcccCCCCC-CCCCCceeeecccC
Q 008720 490 ESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSRGSSC-QTPRAGLGLAICRR 556 (556)
Q Consensus 490 ~~~~~~~~~~~~~~~~~~~~~v~i~V~DnG~Gi~~e~~~~iF~~f~~~~~~~~-~~~G~GlGL~i~k~ 556 (556)
+ .+.|+|.|||+|||++.++++|+|||+++...+ ...|+||||++||+
T Consensus 172 ~-------------------~~~i~V~D~G~Gi~~~~~~~if~~f~~~~~~~~~~~~G~GLGL~i~~~ 220 (258)
T 2c2a_A 172 G-------------------GVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKE 220 (258)
T ss_dssp T-------------------EEEEEEEECSSCCCGGGTTGGGSTTCCCC---------CCCTHHHHHH
T ss_pred C-------------------eEEEEEEecCCCCCHHHHHhhccccccCCCCCCCCCCCcchHHHHHHH
Confidence 2 389999999999999999999999998776533 23599999999984
|
| >4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* | Back alignment and structure |
|---|
| >4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A | Back alignment and structure |
|---|
| >1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A | Back alignment and structure |
|---|
| >3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A | Back alignment and structure |
|---|
| >1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A | Back alignment and structure |
|---|
| >1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* | Back alignment and structure |
|---|
| >3p01_A Two-component response regulator; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, signali protein; 2.65A {Nostoc SP} | Back alignment and structure |
|---|
| >3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3e0y_A Conserved domain protein; APC87688.2, geobacter sulfurreducens PCA, structural genomics, PSI-2, midwest center for structural G MCSG; 3.10A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3trc_A Phosphoenolpyruvate-protein phosphotransferase; signal transduction; HET: MSE; 1.65A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3k2n_A Sigma-54-dependent transcriptional regulator; PSI-2, protein structure initiative, structural genomics; 2.50A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2zmf_A CAMP and CAMP-inhibited CGMP 3',5'-cyclic phospho 10A; GAF domain, phosphodiesterase, CGMP-binding, HYD nucleotide-binding, structural genomics; HET: MSE CMP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4glq_A Methyl-accepting chemotaxis protein; chromophore, phytochrome, cyanobacteriochrome, phycoviolobil bilin, BILI-protein; HET: PVN; 1.77A {Thermosynechococcus elongatus} PDB: 4fof_A* | Back alignment and structure |
|---|
| >3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ci6_A Phosphoenolpyruvate-protein phosphotransferase; PEP-phosphotransferase, GAF domain, structura genomics, PSI-2, protein structure initiative; HET: MSE P4G; 1.55A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3o5y_A Sensor protein; GAF domain, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics, protein S initiative; 2.45A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* | Back alignment and structure |
|---|
| >3oov_A Methyl-accepting chemotaxis protein, putative; structural genomics, PSI-2, protein structure initiative; 2.20A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2lb5_A Sensor histidine kinase; PCB, transferase, GAF domain, phosphoprotein; HET: CYC; NMR {Synechococcus SP} PDB: 2lb9_A* | Back alignment and structure |
|---|
| >3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vjw_A GAF-B, GAF family protein; histidine kinase, hypoxia sensing, hydrolase; HET: MSE; 2.0A {Mycobacterium smegmatis} PDB: 2vks_A | Back alignment and structure |
|---|
| >1ykd_A Adenylate cyclase; GAF domain, bound cyclic AMP ligand, lyase; HET: CMP; 1.90A {Anabaena SP} | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} | Back alignment and structure |
|---|
| >3ibj_A CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE2A, GAF-domains, allosteric regulation hydrolase, membrane; 3.02A {Homo sapiens} | Back alignment and structure |
|---|
| >3dba_A CONE CGMP-specific 3',5'-cyclic phosphodiesterase alpha'; 3', GAF domain, cyclic nucleotide phosphodiesterase hydrolase, lipoprotein, membrane; HET: 35G; 2.57A {Gallus gallus} | Back alignment and structure |
|---|
| >3mmh_A FRMSR, methionine-R-sulfoxide reductase; oxidoreductase; HET: SME MRD; 1.25A {Neisseria meningitidis} SCOP: d.110.2.0 | Back alignment and structure |
|---|
| >2qyb_A Membrane protein, putative; GAF domain, domain of putative membrane protein, PSI-2, MCSG structural genomics; 2.40A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1mc0_A 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF domain, 3',5' guanosine monophosphate, hydrolase; HET: PCG; 2.86A {Mus musculus} SCOP: d.110.2.1 d.110.2.1 | Back alignment and structure |
|---|
| >1mc0_A 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF domain, 3',5' guanosine monophosphate, hydrolase; HET: PCG; 2.86A {Mus musculus} SCOP: d.110.2.1 d.110.2.1 | Back alignment and structure |
|---|
| >2w3g_A DOSS, two component sensor histidine kinase DEVS (GAF family protein); redox sensor, heme, hypoxia, GAF domain, transferase; HET: HEM; 1.40A {Mycobacterium tuberculosis} PDB: 2w3d_A* 2w3f_A* 2w3e_A* 2w3h_A* 2y79_A* 2y8h_A* 2vzw_A* | Back alignment and structure |
|---|
| >3hcy_A Putative two-component sensor histidine kinase PR; two-component sensor histidine kinase protein, structural GE PSI, MCSG; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ykd_A Adenylate cyclase; GAF domain, bound cyclic AMP ligand, lyase; HET: CMP; 1.90A {Anabaena SP} | Back alignment and structure |
|---|
| >1vhm_A Protein YEBR; structural genomics, unknown function; HET: MES; 2.10A {Escherichia coli} SCOP: d.110.2.1 | Back alignment and structure |
|---|
| >3ibj_A CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE2A, GAF-domains, allosteric regulation hydrolase, membrane; 3.02A {Homo sapiens} | Back alignment and structure |
|---|
| >3cit_A Sensor histidine kinase; MEGA: 3.30.450.40, structural genomics, sensor histidine KIN pseudomonas syringae, PSI-2; HET: MSE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2k2n_A Sensor protein, SYB-CPH1(GAF); phytochrome, GAF domain, phycocyanobilin, PCB, bacteriophytochrome, cyanobacterial phytochrome, kinase; HET: CYC; NMR {Synechococcus SP} SCOP: d.110.2.1 PDB: 2kli_A* 2koi_A* | Back alignment and structure |
|---|
| >2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 | Back alignment and structure |
|---|
| >3nhq_A Bacteriophytochrome; photoreceptor, PAS, signaling, signaling protei; HET: BLA; 2.55A {Pseudomonas aeruginosa} PDB: 3c2w_A* 3nop_C* 3not_C* 3nou_C* 3g6o_A* 3ibr_A* | Back alignment and structure |
|---|
| >4e04_A Bacteriophytochrome (light-regulated signal trans histidine kinase), PHYB1; bacteriophytochrome chromophore binding domain; HET: LBV; 1.79A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3s7o_A Bacteriophytochrome; biliverdin, PAS, GAF, photoreceptor, fluorescent protein; HET: LBV GOL; 1.24A {Deinococcus radiodurans} PDB: 3s7n_A* 3s7p_A* 3s7q_A* 2o9c_A* 2o9b_A* 1ztu_A* | Back alignment and structure |
|---|
| >3zq5_A Phytochrome-like protein CPH1; arginine finger, tandem GAF domain, receptor, PAS domain, chromophore, sensory transduction; HET: CYC; 1.95A {Synechocystis SP} PDB: 2vea_A* | Back alignment and structure |
|---|
| >1f5m_A GAF; CGMP binding, signaling protein; 1.90A {Saccharomyces cerevisiae} SCOP: d.110.2.1 PDB: 3ko6_A* | Back alignment and structure |
|---|
| >3rfb_A Putative uncharacterized protein; FRMSR, GAF, oxidoreductase, SME; HET: SME; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3ksh_A Putative uncharacterized protein; FRMSR, free-Met-R-SO, oxidoreductase; 1.50A {Staphylococcus aureus} SCOP: d.110.2.0 PDB: 3ksf_A 3ksi_A 3ksg_A* | Back alignment and structure |
|---|
| >3eea_A GAF domain/HD domain protein; structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomics; HET: PG6; 1.80A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* | Back alignment and structure |
|---|
| >3bjc_A CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5, erectIle dysfunction, inhibitor design, allosteric enzyme, alternative splicing, CGMP binding; HET: WAN; 2.00A {Homo sapiens} SCOP: a.211.1.2 PDB: 3mf0_A 3lfv_A 2xss_A 2k31_A* | Back alignment and structure |
|---|
| >3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bjc_A CGMP-specific 3',5'-cyclic phosphodiesterase; PDE5, erectIle dysfunction, inhibitor design, allosteric enzyme, alternative splicing, CGMP binding; HET: WAN; 2.00A {Homo sapiens} SCOP: a.211.1.2 PDB: 3mf0_A 3lfv_A 2xss_A 2k31_A* | Back alignment and structure |
|---|
| >1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* | Back alignment and structure |
|---|
| >1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A | Back alignment and structure |
|---|
| >1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zcc_A HAMP, osmolarity sensor protein ENVZ; signaling protein, signal transduction, membrane protein, signalling, chimera; 1.25A {Archaeoglobus fulgidus} PDB: 3zrw_A 3zrv_A 3zrx_A 3zrw_B 2lfr_A 2lfs_A 1joy_A 2l7h_A 2l7i_A 2y20_A 2y21_A 2y0q_A 2y0t_A | Back alignment and structure |
|---|
| >3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3zrx_A AF1503 protein, osmolarity sensor protein ENVZ; signaling protein, osmoregulation, OMPR, OMPC; 1.25A {Archaeoglobus fulgidus} PDB: 3zrv_A 3zrw_A 3zrw_B 2lfs_A 2lfr_A 1joy_A 2l7i_A 2y20_A 2l7h_A 2y21_A 2y0t_A 2y0q_A | Back alignment and structure |
|---|
| >1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >2w1r_A Spovt, stage V sporulation protein T; regulatory GAF domain of spovt, transcription, transcription regulation, repressor, activator; 1.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* | Back alignment and structure |
|---|
| >3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... | Back alignment and structure |
|---|
| >1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* | Back alignment and structure |
|---|
| >3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* | Back alignment and structure |
|---|
| >3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* | Back alignment and structure |
|---|
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A | Back alignment and structure |
|---|
| >1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* | Back alignment and structure |
|---|
| >4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* | Back alignment and structure |
|---|
| >4eu0_A PELD; C-DI-GMP, signaling protein; HET: C2E; 1.70A {Pseudomonas aeruginosa} PDB: 4euv_A* 4etz_A* 4etx_A 4dmz_A 4dn0_A* | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* | Back alignment and structure |
|---|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A | Back alignment and structure |
|---|
| >3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* | Back alignment and structure |
|---|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A | Back alignment and structure |
|---|
| >3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3e98_A GAF domain of unknown function; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 2.43A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 556 | ||||
| d2c2aa2 | 161 | d.122.1.3 (A:321-481) Sensor histidine kinase TM08 | 1e-23 | |
| d1ysra1 | 148 | d.122.1.3 (A:299-446) Sensor-type histidine kinase | 3e-18 | |
| d1jm6a2 | 190 | d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin | 4e-17 | |
| d1bxda_ | 161 | d.122.1.3 (A:) Histidine kinase domain of the osmo | 1e-16 | |
| d1id0a_ | 146 | d.122.1.3 (A:) Histidine kinase PhoQ domain {Esche | 9e-16 | |
| d1gkza2 | 193 | d.122.1.4 (A:186-378) Branched-chain alpha-ketoaci | 6e-11 | |
| d2hkja3 | 219 | d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A | 2e-10 | |
| d1r62a_ | 156 | d.122.1.3 (A:) Nitrogen regulation protein NtrB, C | 5e-10 | |
| d2c2aa1 | 89 | a.30.2.1 (A:232-320) Sensor histidine kinase TM085 | 9e-09 | |
| d1joya_ | 67 | a.30.2.1 (A:) EnvZ histidine kinase {Escherichia c | 1e-07 | |
| d1y8oa2 | 125 | d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinas | 6e-07 | |
| d1mc0a2 | 154 | d.110.2.1 (A:402-555) 3',5'-cyclic nucleotide phos | 7e-05 | |
| d2k2na1 | 170 | d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synec | 6e-04 | |
| d1i58a_ | 189 | d.122.1.3 (A:) Histidine kinase CheA {Thermotoga m | 0.003 |
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Histidine kinase domain: Sensor histidine kinase TM0853 species: Thermotoga maritima [TaxId: 2336]
Score = 95.4 bits (237), Expect = 1e-23
Identities = 31/147 (21%), Positives = 59/147 (40%), Gaps = 17/147 (11%)
Query: 411 ELDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGN 470
+++ +L ++ + IK AS +++ P A D R+ Q +LN++ N
Sbjct: 1 QINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNN 60
Query: 471 AVKFTKEGYVSIIASVAKPESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLL 530
VK++K+ + + + V D+G G+P +
Sbjct: 61 GVKYSKKDAPDKYVK---------------VILDEKDG-GVLIIVEDNGIGIPDHAKDRI 104
Query: 531 FTKFAQSRGS-SCQTPRAGLGLAICRR 556
F +F + S + + P GLGLAI +
Sbjct: 105 FEQFYRVDSSLTYEVPGTGLGLAITKE 131
|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 193 | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 156 | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Length = 89 | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Length = 67 | Back information, alignment and structure |
|---|
| >d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1mc0a2 d.110.2.1 (A:402-555) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]} Length = 170 | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 556 | |||
| d2c2aa2 | 161 | Sensor histidine kinase TM0853 {Thermotoga maritim | 99.91 | |
| d1id0a_ | 146 | Histidine kinase PhoQ domain {Escherichia coli [Ta | 99.88 | |
| d1ysra1 | 148 | Sensor-type histidine kinase PrrB {Mycobacterium t | 99.87 | |
| d1bxda_ | 161 | Histidine kinase domain of the osmosensor EnvZ {Es | 99.85 | |
| d1r62a_ | 156 | Nitrogen regulation protein NtrB, C-terminal domai | 99.81 | |
| d1ixma_ | 179 | Sporulation response regulatory protein Spo0B {Bac | 99.77 | |
| d1gkza2 | 193 | Branched-chain alpha-ketoacid dehydrogenase kinase | 99.77 | |
| d1jm6a2 | 190 | Pyruvate dehydrogenase kinase {Rat (Rattus norvegi | 99.75 | |
| d1mc0a1 | 187 | 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF | 99.41 | |
| d2c2aa1 | 89 | Sensor histidine kinase TM0853 {Thermotoga maritim | 99.3 | |
| d1y8oa2 | 125 | Pyruvate dehydrogenase kinase {Human (Homo sapiens | 99.28 | |
| d1mc0a2 | 154 | 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF | 99.21 | |
| d2hkja3 | 219 | Topoisomerase VI-B subunit {Archaeon Sulfolobus sh | 99.19 | |
| d1th8a_ | 139 | Anti-sigma factor spoIIab {Bacillus stearothermoph | 99.11 | |
| d2k2na1 | 170 | Sensor protein CYB2465 {Synechococcus sp. [TaxId: | 98.98 | |
| d1vhma_ | 159 | Hypothetical protein YebR {Escherichia coli [TaxId | 98.87 | |
| d2o9ca1 | 187 | Bacteriophytochrome BphP {Deinococcus radiodurans | 98.84 | |
| d2oola1 | 194 | Sensor protein PhyB2 {Rhodopseudomonas palustris [ | 98.84 | |
| d1joya_ | 67 | EnvZ histidine kinase {Escherichia coli [TaxId: 56 | 98.82 | |
| d3c2wa1 | 192 | Bacteriophytochrome BphP {Pseudomonas aeruginosa [ | 98.7 | |
| d2veaa1 | 196 | Phytochrome-like protein Cph1 {Synechocystis sp. p | 98.62 | |
| d1f5ma_ | 176 | Hypothetical protein ykl069wp {Baker's yeast (Sacc | 98.52 | |
| d1i58a_ | 189 | Histidine kinase CheA {Thermotoga maritima [TaxId: | 97.87 | |
| d1h7sa2 | 203 | DNA mismatch repair protein PMS2 {Human (Homo sapi | 97.77 | |
| d1b63a2 | 218 | DNA mismatch repair protein MutL {Escherichia coli | 97.73 | |
| d1pvga2 | 239 | DNA topoisomerase II {Baker's yeast (Saccharomyces | 96.36 | |
| d1kija2 | 212 | DNA gyrase B {Thermus thermophilus [TaxId: 274]} | 96.17 | |
| d1ei1a2 | 219 | DNA gyrase B {Escherichia coli [TaxId: 562]} | 95.79 | |
| d2iwxa1 | 213 | HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.55 | |
| d1s14a_ | 168 | Topoisomerase IV subunit B {Escherichia coli [TaxI | 95.35 | |
| d1uyla_ | 208 | HSP90 {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
| d2gqpa1 | 227 | HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | 94.38 |
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Histidine kinase domain: Sensor histidine kinase TM0853 species: Thermotoga maritima [TaxId: 2336]
Probab=99.91 E-value=1.2e-24 Score=188.02 Aligned_cols=127 Identities=24% Similarity=0.399 Sum_probs=101.3
Q ss_pred ccccceeHHHHHHHHHHHHHHhhhcCCceEEEEeCCCCCceEEccHHHHHHHHHHHHHHHhhcCCCCeE--EEEEEeecC
Q 008720 412 LDNGPFNLQIVLREVIKLIKPVASCKKLSMTLIMAPELPTYAVGDEKRLMQTILNIVGNAVKFTKEGYV--SIIASVAKP 489 (556)
Q Consensus 412 l~~~~~~l~~ll~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~d~~~l~~vl~nLl~NAik~~~~g~~--~i~~~~~~~ 489 (556)
++.+++|+.++++++++.++..+..+++.+.++.+.+.+..+.+|+.+|.||+.||++||+||+++|+. .+.+.....
T Consensus 2 l~~e~v~l~~li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~~ 81 (161)
T d2c2aa2 2 INREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEK 81 (161)
T ss_dssp CCCEEEEHHHHHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEEE
T ss_pred CccEEECHHHHHHHHHHHHHHHHHHCCCEEEEEeCCCCCEEEEECHHHHHHHHHHHHHHHHHhhhcCCCcceeeEEEEec
Confidence 567799999999999999999999999999998876666668889999999999999999999987652 222222222
Q ss_pred CCCCCCCCCCCCCCCCCCceEEEEEEEecCCCCCCCChhhhhccCcccCCCCC-CCCCCceeeecccC
Q 008720 490 ESLSDWRPPEFYPVSTDGHFYLRVQVNDSGCGVPPQDIPLLFTKFAQSRGSSC-QTPRAGLGLAICRR 556 (556)
Q Consensus 490 ~~~~~~~~~~~~~~~~~~~~~v~i~V~DnG~Gi~~e~~~~iF~~f~~~~~~~~-~~~G~GlGL~i~k~ 556 (556)
+. ++.|+|+|||+|||++.+++||+|||+.+...+ ...|+||||++||+
T Consensus 82 ~~------------------~~~i~V~D~G~GI~~~~~~~iF~~F~~~~~~~~~~~~G~GLGL~i~k~ 131 (161)
T d2c2aa2 82 DG------------------GVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKE 131 (161)
T ss_dssp TT------------------EEEEEEEECSSCCCGGGTTGGGSTTCCCC---------CCCTHHHHHH
T ss_pred CC------------------EEEEEEEEcCCCCCHHHHHHhhCCcEEcCCCCCCCCCcccHHHHHHHH
Confidence 21 499999999999999999999999999876543 34599999999984
|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mc0a1 d.110.2.1 (A:215-401) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mc0a2 d.110.2.1 (A:402-555) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|
| >d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d1vhma_ d.110.2.1 (A:) Hypothetical protein YebR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o9ca1 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2oola1 d.110.2.1 (A:140-333) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c2wa1 d.110.2.1 (A:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2veaa1 d.110.2.1 (A:131-326) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1f5ma_ d.110.2.1 (A:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|