Citrus Sinensis ID: 008791

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550---
MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGPQKGSSNSNYQNLLNNQFKNMMNFEHGGKGGGGKDNNKSQKGGGNNNNNQSHQFPKGGQQQQQQLQQLQQLQQLQAQQMMQQQFKAGSKDMNMMKMAQHNKDQKHGKFNTIEDDFDDEEFDDDFDEDDFDDYDDEDDEEFGHGHHLPNKNNGKGPHGPHSMMMMNGPMMDFKKGGGGNSKKGGAIDMPFEMMGGKESKDGKNGKDGKKGSKENNKGGKKKDEGSRKDKNGGKSGGGGFFGFGKKKGGEDKKNGKSSGGFLGFGKKDKGSGDSGNKNGKNGSGAGGKNKGNGPKKGGGKNEYDGVLDMKKMKDDVFDFDVPKANHGGKGGKANGHGGGAKNMGPMGPMSQMGPMSQMGPMRSMGQMGNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPYNQQQYMGMMMNQQQMNGGNEMYHPMMYARQPPPFNYGAPPPMLGPAAGDHYTHYFSDENANSCSIM
cccccccccccEEEEEEEccHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEccHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccEEEEEEEccHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEcccccccccccccccccccccccccccEEccccccccccc
MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDgvystnvdveqgkvtvtgnvdpAILIKKLEKLGKhaelwgpqkgssnsnYQNLLNNQFKNMmnfehggkggggkdnnksqkgggnnnnnqshqfpkggQQQQQQLQQLQQLQQLQAQQMMQQQFKAGSKDMNMMKMAQhnkdqkhgkfntieddfddeefdddfdeddfddyddeddeefghghhlpnknngkgphgphsmmmmngpmmdfkkggggnskkggaidmpfemmggkeskdgkngkdgkkgskennkggkkkdegsrkdknggksggggffgfgkkkggedkkngkssggflgfgkkdkgsgdsgnkngkngsgaggknkgngpkkgggkneydgvldmkkmkddvfdfdvpkanhggkggkanghgggaknmgpmgpmsqmgpmsqmgpmrsmgqmgnypmgqmgnyptgqmggfpavqglpaspamngayygamgpgtnpynqqQYMGMMMNQqqmnggnemyhpmmyarqpppfnygapppmlgpaagdhythyfsdenanscsim
mnkqdfmklqqSCVLrvnvdcdgckQKVKKvlrkidgvystnvdveqgkvtvtgnvdpAILIKKLEKLGKHAELwgpqkgssnSNYQNLLNNQFKNMMNFEHGGKGGGGKDNNKSQKGGGNNNNNQSHQFPKGGQQQQQQLQQLQQLQQLQAQQMMQQQFKAGSKDMNMMKMAQhnkdqkhgkfNTIEDDFDDEEFDDDFDEDDFDDYDDEDDEefghghhlpnknnGKGPHGPHSMMMMNGPMMDFKKGGGGNSKKGGAIDMPFEMMGgkeskdgkngkdgkkgskennkggkkkdegsrkdknggksggggffgfgkkkggedkkngkssggflgfgkkdkgsgdsgnkngkngsgaggknkgngpkkgggkNEYDGVLDMKKMKDDVFDFDVPKanhggkggkanghgGGAKNMGPMGPMSQMGPMSQMGPMRSMGQMGNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPYNQQQYMGMMMNQQQMNGGNEMYHPMMYARQPPPFNYGAPPPMLGPAAGDHYTHYFSDENANSCSIM
MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGPQKGssnsnyqnllnnqFKNMMNFEHggkggggkdnnksqkgggnnnnnQSHQFPKGGqqqqqqlqqlqqlqqlqaqqmmqqqFKAGSKDMNMMKMAQHNKDQKHGKFNTIeddfddeefdddfdeddfddyddeddeefGHGHHLPNKNNGKgphgphsmmmmngpmmDFkkggggnskkggAIDMPFEMMggkeskdgkngkdgkkgskennkggkkkdegsRkdknggksggggffgfgkkkggedkkngkssggflgfgkkdkgsgdsgnkngkngsgaggknkgngpkkgggknEYDGVLdmkkmkddvfdfdvpkanhggkggkanghgggaknmgpmgpmsqmgpmsqmgpmrsmgqmgNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPynqqqymgmmmnqqqmnggnemyHPMMYARQPPPFNYgapppmlgpaagDHYTHYFSDENANSCSIM
********LQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELW****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YY****************************************************************************
**********QSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWG*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YTHYFSDENANSC*IM
MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGPQKGSSNSNYQNLLNNQFKNMMNFEHGGKGGGGKDNNKSQKGGGNNNNNQSH**********************************GSKDMNMMKMAQHNKDQKHGKFNTIEDDFDDEEFDDDFDEDDFDDYDDEDDEEFGHGHHLPNKNNGKGPHGPHSMMMMNGPMMDFKKGGGGNSKKGGAIDMPFEMMGG***********************************GGKSGGGGFFGFGKKKGGEDKKNGKSSGGFLGFGKKDKGSGDSGNKNGKNGSGAGGKNKGNGPKKGGGKNEYDGVLDMKKMKDDVFDFDVPKANHGGKGGKANGHGGGAKNMGPMGPMSQMGPMSQMGPMRSMGQMGNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPYNQQQYMGMMMNQQQMNGGNEMYHPMMYARQPPPFNYGAPPPMLGPAAGDHYTHYFSDE********
*****FMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGPQ***************************************************************Q****LQ**QAQQMMQQQF***SKDMNMMK***********KFN******DDEEFDDDFDEDDFDDYDDEDDEEFGHGHHLPNKNNGKGPHGPHSMMMMNGPMMDFKK*****SKKGGAIDMPFEMMG***************************************SGGGGFFGFGKK******************************************************NEYDGVLDMKKMKDDVFDFDVPKANH*********************************P*RSMGQMGNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPYNQQQYMGMMMNQQQMNGGNEMYHPMMYARQPPPFNYGAPPPMLGPAAGDHYTHYFSD*****C***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGPQKGSSNSNYQNLLNNQFKNMMNFEHGGKGGGGKDNNKSQKGGGNNNNNQSHQFPKGGQQQQQQLQQLQQLQQLQAQQMMQQQFKAGSKDMNMMKMAQHNKDQKHGKFNTIEDDFDDEEFDDDFDEDDFDDYDDEDDEEFGHGHHLPNKNNGKGPHGPHSMMMMNGPMMDFKKGGGGNSKKGGAIDMPFEMMGGKESKDGKNGKDGKKGSKENNKGGKKKDEGSRKDKNGGKSGGGGFFGFGKKKGGEDKKNGKSSGGFLGFGKKDKGSGDSGNKNGKNGSGAGGKNKGNGPKKGGGKNEYDGVLDMKKMKDDVFDFDVPKANHGGKGGKANGHGGGAKNMGPMGPMSQMGPMSQMGPMRSMGQMGNYPMGQMGNYPTGQMGGFPAVQGLPASPAMNGAYYGAMGPGTNPYNQQQYMGMMMNQQQMNGGNEMYHPMMYARQPPPFNYGAPPPMLGPAAGDHYTHYFSDENANSCSIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
356504058467 PREDICTED: uncharacterized protein LOC10 0.799 0.946 0.389 2e-48
356571127456 PREDICTED: uncharacterized protein LOC10 0.430 0.521 0.424 5e-39
255542572537 chloroplast-targeted copper chaperone, p 0.195 0.201 0.644 1e-31
255552225526 chloroplast-targeted copper chaperone, p 0.168 0.176 0.659 5e-30
297833356445 hypothetical protein ARALYDRAFT_477915 [ 0.171 0.213 0.639 7e-29
18397481473 heavy-metal-associated domain-containing 0.171 0.200 0.639 1e-28
334185123349 heavy-metal-associated domain-containing 0.171 0.272 0.639 2e-28
15239643587 heavy metal transport/detoxification dom 0.173 0.163 0.653 2e-28
30687142465 heavy metal transport/detoxification dom 0.173 0.206 0.653 2e-28
356563547499 PREDICTED: uncharacterized protein LOC10 0.216 0.240 0.574 8e-28
>gi|356504058|ref|XP_003520816.1| PREDICTED: uncharacterized protein LOC100783289 [Glycine max] Back     alignment and taxonomy information
 Score =  200 bits (509), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 225/578 (38%), Positives = 268/578 (46%), Gaps = 136/578 (23%)

Query: 1   MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAI 60
           M+KQD +K+Q SCVL+VN+ CDGC+QKVKK+L+KIDGVYS  VD ++GKV V G+VDPA 
Sbjct: 1   MSKQDLLKVQ-SCVLKVNIHCDGCEQKVKKLLQKIDGVYSVRVDADEGKVVVAGDVDPAK 59

Query: 61  LIKKLEKLGKHAELWGPQKGSSNSN-YQNL-LNNQFKNMMNFEHGGKGGGGKDNNKSQKG 118
           L+KKL++ GKHAE+   QKG    N  QN  +N QF+NM        G GGKDNN + KG
Sbjct: 60  LVKKLKRGGKHAEICQNQKGEMMCNQIQNYPINPQFQNMQ------LGIGGKDNNNNHKG 113

Query: 119 GGNNNNNQSHQFPKGGQQQQQQLQQLQQLQQLQAQQMMQQQFKAGSKDMNMMKMAQHNKD 178
                     Q  KG      QL     L+              G +D+ +       K+
Sbjct: 114 ----------QKEKGTAAAAGQLAHFPILK--------------GVQDLKVPA-----KE 144

Query: 179 QKHGKFNTIEDDFDDEEFDDDFDEDDFDDYDDEDDEE-FGHGHHLPNKNNGKGPHGPHSM 237
           QK  KFN  E             ED+FD  DD  DE+  GHGH + NK            
Sbjct: 145 QKSVKFNLPE-------------EDEFDASDDGYDEDGLGHGHPMQNKI---------MP 182

Query: 238 MMMNGPMMDFKKGG---GGNSKKGGAID--MPFEMMGGKESKDGKNGKDGKKGSKENNKG 292
           MM+N    D   G     G+ KK   ID  M F+  GG   +   +   GKKGS      
Sbjct: 183 MMINHNHKDNSGGSRNINGSVKKADVIDQAMLFKGKGGNFDEAEADNDGGKKGS------ 236

Query: 293 GKKKDEGSRKDKNGGKSGGGGFFGFGKKKGGEDKKNGKSSGG----FLGFGKKDKG---- 344
             +KDE  + D +  K+ G   F          KKNGKS  G    FLGFGKK K     
Sbjct: 237 SSQKDEIKKGDLDKPKAVGEVDF--------HKKKNGKSENGLLGRFLGFGKKSKKGELE 288

Query: 345 SGDSGNKNGKNGSGAGGKNKGNGPKKGGGKNEYDGVLDMKKMKDDVFDF-DVPKANHGGK 403
                NK+    SGA  K    G  +  G N++           D  D+ D P     GK
Sbjct: 289 ETTYTNKSKNQNSGAENKKGKEGKLEDHGNNDF-----------DFHDYDDTPPHPKNGK 337

Query: 404 GGKANGHGGGAKNMGPMGPMSQMGPMSQMGPMRSMGQMGNYPMGQMGNYPTGQMGGFPAV 463
            GK      G+ N+       QMGP   MG         N PM         QM    AV
Sbjct: 338 SGK------GSNNVKE----GQMGPGPIMG--------NNLPMRH-------QMENIQAV 372

Query: 464 QGLPASPAMN--GAYYGAMGPGTNPYN--QQQYMGMMMNQ---QQMNGGNEMY-HPMMYA 515
           QGL   PAMN  G YY  +     PYN  QQ YMGMMMNQ   QQ N  N MY  PMMY 
Sbjct: 373 QGL---PAMNGDGGYYQGVQMQHAPYNNLQQHYMGMMMNQHQHQQANMNNNMYPTPMMYG 429

Query: 516 RQPPPFNYGAPPPMLGPAAGDHYTHYFSDENANSCSIM 553
           R  P  NY  PPPM      D  TH FSDEN  SCSIM
Sbjct: 430 RPHPSMNYMPPPPMPSHPIADPITHTFSDENVESCSIM 467

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356571127|ref|XP_003553732.1| PREDICTED: uncharacterized protein LOC100811813 [Glycine max] Back     alignment and taxonomy information
>gi|255542572|ref|XP_002512349.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223548310|gb|EEF49801.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255552225|ref|XP_002517157.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223543792|gb|EEF45320.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297833356|ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] gi|297330400|gb|EFH60819.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18397481|ref|NP_566273.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|6862917|gb|AAF30306.1|AC018907_6 hypothetical protein [Arabidopsis thaliana] gi|11908104|gb|AAG41481.1|AF326899_1 unknown protein [Arabidopsis thaliana] gi|13194808|gb|AAK15566.1|AF349519_1 unknown protein [Arabidopsis thaliana] gi|15010768|gb|AAK74043.1| AT3g06130/F28L1_7 [Arabidopsis thaliana] gi|23506209|gb|AAN31116.1| At3g06130/F28L1_7 [Arabidopsis thaliana] gi|332640827|gb|AEE74348.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185123|ref|NP_001189822.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332640828|gb|AEE74349.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15239643|ref|NP_197410.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005267|gb|AED92650.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30687142|ref|NP_850851.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|238481311|ref|NP_001154719.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005268|gb|AED92651.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005269|gb|AED92652.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356563547|ref|XP_003550023.1| PREDICTED: uncharacterized protein LOC100777182 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query553
TAIR|locus:2179604587 AT5G19090 [Arabidopsis thalian 0.142 0.134 0.675 1.6e-38
TAIR|locus:2096204577 AT3G05220 [Arabidopsis thalian 0.135 0.129 0.723 7.9e-37
TAIR|locus:2082425473 AT3G06130 [Arabidopsis thalian 0.142 0.167 0.675 7.7e-36
TAIR|locus:2180265352 AT5G27690 [Arabidopsis thalian 0.112 0.176 0.693 1e-20
TAIR|locus:2017709358 AT1G23000 "AT1G23000" [Arabido 0.139 0.215 0.544 9.2e-20
TAIR|locus:2011841364 AT1G56210 [Arabidopsis thalian 0.113 0.173 0.555 5.6e-19
TAIR|locus:2153794262 AT5G37860 "AT5G37860" [Arabido 0.108 0.229 0.633 3.2e-17
TAIR|locus:2133544150 AT4G08570 "AT4G08570" [Arabido 0.132 0.486 0.432 3.7e-17
TAIR|locus:2026336152 HIPP20 "heavy metal associated 0.122 0.447 0.411 6e-17
TAIR|locus:2202265159 AT1G06330 "AT1G06330" [Arabido 0.117 0.408 0.461 2.5e-16
TAIR|locus:2179604 AT5G19090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 306 (112.8 bits), Expect = 1.6e-38, Sum P(4) = 1.6e-38
 Identities = 54/80 (67%), Positives = 71/80 (88%)

Query:     1 MNKQDFMKLQQSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAI 60
             M+K++FMK+Q +CVL+VN+ CDGCKQKVKK+L+KI+GV++T +D E GKVTV+GNVDP++
Sbjct:     1 MSKEEFMKIQ-TCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDAELGKVTVSGNVDPSV 59

Query:    61 LIKKLEKLGKHAELWGPQKG 80
             LIKKL K GKHAE+WG  KG
Sbjct:    60 LIKKLLKSGKHAEIWGAPKG 79
GO:0005576 "extracellular region" evidence=ISM
GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082425 AT3G06130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180265 AT5G27690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017709 AT1G23000 "AT1G23000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011841 AT1G56210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153794 AT5G37860 "AT5G37860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202265 AT1G06330 "AT1G06330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
cd0037163 cd00371, HMA, Heavy-metal-associated domain (HMA) 1e-15
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 6e-15
COG260871 COG2608, CopZ, Copper chaperone [Inorganic ion tra 1e-07
PRK02363129 PRK02363, PRK02363, DNA-directed RNA polymerase su 4e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-04
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 6e-04
pfam08430137 pfam08430, Fork_head_N, Forkhead N-terminal region 6e-04
pfam13779820 pfam13779, DUF4175, Domain of unknown function (DU 7e-04
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 8e-04
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 9e-04
PRK02363129 PRK02363, PRK02363, DNA-directed RNA polymerase su 0.002
PRK10671 834 PRK10671, copA, copper exporting ATPase; Provision 0.003
pfam13779820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.004
>gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information 
 Score = 70.7 bits (174), Expect = 1e-15
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 14 VLRV-NVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGN--VDPAILIKKLEKLGK 70
           L V  + C GC  K++K L K+ GV S  VD+E GK TV  +  V P  L++ +E  G 
Sbjct: 1  ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAGY 60

Query: 71 HAE 73
           A 
Sbjct: 61 KAR 63

HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
>gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|219837 pfam08430, Fork_head_N, Forkhead N-terminal region Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 553
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.19
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.13
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.92
KOG4656247 consensus Copper chaperone for superoxide dismutas 98.68
PLN02957238 copper, zinc superoxide dismutase 98.18
PRK10671 834 copA copper exporting ATPase; Provisional 98.01
TIGR0000368 copper ion binding protein. This model describes a 97.83
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.78
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.62
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 97.15
PRK10671 834 copA copper exporting ATPase; Provisional 96.86
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.4
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 94.49
TIGR0205292 MerP mercuric transport protein periplasmic compon 94.4
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 93.33
PRK13748561 putative mercuric reductase; Provisional 92.89
cd0037163 HMA Heavy-metal-associated domain (HMA) is a conse 91.74
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 90.34
COG188897 Uncharacterized protein conserved in archaea [Func 87.81
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 85.65
PF05764240 YL1: YL1 nuclear protein; InterPro: IPR008895 The 85.36
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 80.47
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information 
Probab=99.19  E-value=1.1e-10  Score=92.57  Aligned_cols=58  Identities=40%  Similarity=0.647  Sum_probs=53.5

Q ss_pred             EEEEe-ccchhHHHHHHHHHhcCCCeeEEEEecCCcEEEEEec---CCHHHHHHHHHHcCCc
Q 008791           14 VLRVN-VDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGN---VDPAILIKKLEKLGKH   71 (553)
Q Consensus        14 ~LkVe-M~C~sCa~KIEKaL~kl~GV~sV~VDlatgkVtV~g~---id~eeIikaI~kaGy~   71 (553)
                      +|+|. |+|.+|+.+|+++|++++||.++.||+.+++|+|+..   +++++|+++|+++||+
T Consensus         1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~   62 (62)
T PF00403_consen    1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE   62 (62)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred             CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence            58897 9999999999999999999999999999999999843   5679999999999995

These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>PF05764 YL1: YL1 nuclear protein; InterPro: IPR008895 The proteins in this family are designated YL1 [] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
2roe_A66 Solution Structure Of Thermus Thermophilus Hb8 Ttha 9e-05
1jk9_B249 Heterodimer Between H48f-Ysod1 And Yccs Length = 24 4e-04
1qup_A222 Crystal Structure Of The Copper Chaperone For Super 5e-04
>pdb|2ROE|A Chain A, Solution Structure Of Thermus Thermophilus Hb8 Ttha1718 Protein In Vitro Length = 66 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%)
Query: 21 CDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAEL 74
          C+ C   V K L+K+ GV    V +E+G+  V G  DP  L++ +E+ G  AE+
Sbjct: 11 CNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEV 64
>pdb|1JK9|B Chain B, Heterodimer Between H48f-Ysod1 And Yccs Length = 249 Back     alignment and structure
>pdb|1QUP|A Chain A, Crystal Structure Of The Copper Chaperone For Superoxide Dismutase Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query553
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 2e-22
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 2e-21
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 5e-18
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 8e-17
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 3e-14
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 2e-13
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 2e-11
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 2e-10
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 2e-10
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 6e-10
1yg0_A66 COP associated protein; open-faced beta-sandwich, 2e-09
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 9e-09
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 9e-09
2kkh_A95 Putative heavy metal transporter; zinc transport, 1e-08
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 1e-08
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 2e-08
2l3m_A71 Copper-ION-binding protein; structural genomics, c 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 4e-08
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 4e-08
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 5e-08
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 5e-08
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 9e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-06
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 6e-08
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 6e-08
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 6e-08
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 1e-07
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 2e-07
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 2e-07
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 6e-06
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 3e-07
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 3e-07
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 4e-07
1opz_A76 Potential copper-transporting ATPase; mutation, fo 2e-06
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 2e-06
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 4e-06
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 6e-06
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 6e-06
2kyz_A67 Heavy metal binding protein; structural genomics, 6e-06
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 8e-06
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 3e-05
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 3e-05
1twf_F155 ABC23, DNA-directed RNA polymerases I, II, and III 8e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
 Score = 91.1 bits (226), Expect = 2e-22
 Identities = 19/71 (26%), Positives = 27/71 (38%), Gaps = 1/71 (1%)

Query: 15 LRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAEL 74
            V + C  C   V+K L+ + GV    V +E   V V   +    +   LE  G+ A L
Sbjct: 23 FAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVL 82

Query: 75 WGPQKGSSNSN 85
           G        N
Sbjct: 83 KG-MGSGQLQN 92
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>1twf_F ABC23, DNA-directed RNA polymerases I, II, and III 23 KD polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.143.1.2 PDB: 1i3q_F 1i6h_F 1k83_F* 1nik_F 1nt9_F 1pqv_F 1r5u_F 1r9s_F* 1r9t_F* 1sfo_F* 1twa_F* 1twc_F* 1i50_F* 1twg_F* 1twh_F* 1wcm_F 1y1v_F 1y1w_F 1y1y_F 1y77_F* ... Length = 155 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.36
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.29
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.29
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.29
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.22
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.2
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.12
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.08
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.08
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.08
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.08
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.07
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.06
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.06
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.06
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.04
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.04
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.03
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.01
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.01
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.01
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.01
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.0
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.0
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.99
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.99
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.98
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.95
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.93
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.91
2kyz_A67 Heavy metal binding protein; structural genomics, 98.9
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.9
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.88
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.87
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.8
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.78
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.76
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.7
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.45
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.38
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.26
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 85.13
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 84.48
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 82.99
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.36  E-value=1.9e-12  Score=102.09  Aligned_cols=66  Identities=29%  Similarity=0.546  Sum_probs=62.0

Q ss_pred             eEEEEEEeccchhHHHHHHHHHhcCCCeeEEEEecCCcEEEEEecCCHHHHHHHHHHcCCceEEcCC
Q 008791           11 QSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWGP   77 (553)
Q Consensus        11 qtv~LkVeM~C~sCa~KIEKaL~kl~GV~sV~VDlatgkVtV~g~id~eeIikaI~kaGy~Ael~~~   77 (553)
                      .+++|+|.|+|.+|+.+|+++|++++|| +++||+.+++++|+..+++++|+++|+++||++++|++
T Consensus         2 ~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            2 PKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             ceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            5778888889999999999999999999 99999999999999888999999999999999998864
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 553
d1qupa272 d.58.17.1 (A:2-73) Copper chaperone for superoxide 8e-21
d1fe0a_66 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 8e-18
d1cc8a_72 d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX 6e-17
d1osda_72 d.58.17.1 (A:) Mercuric ion binding protein MerP { 1e-15
d2ggpb172 d.58.17.1 (B:1-72) Copper transporter domain ccc2a 4e-15
d2aw0a_72 d.58.17.1 (A:) Menkes copper-transporting ATPase { 8e-14
d1p6ta279 d.58.17.1 (A:73-151) Potential copper-translocatin 1e-13
d1cpza_68 d.58.17.1 (A:) Copper chaperone {Enterococcus hira 5e-13
d1sb6a_64 d.58.17.1 (A:) Copper chaperone {Synechocystis sp. 6e-13
d1p6ta172 d.58.17.1 (A:1-72) Potential copper-translocating 1e-12
d1kvja_79 d.58.17.1 (A:) Menkes copper-transporting ATPase { 4e-12
d1mwza_73 d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, 1e-11
d2qifa169 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt 4e-11
d1q8la_84 d.58.17.1 (A:) Menkes copper-transporting ATPase { 2e-08
d1qkla_127 a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 1e-04
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 84.1 bits (208), Expect = 8e-21
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 14 VLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAE 73
             + + C+ C   +K  L+ + G+ S N D+EQ  ++V  +V P+ +I  L   GK A 
Sbjct: 9  TYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAI 68

Query: 74 LWG 76
          + G
Sbjct: 69 IRG 71
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query553
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.48
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.47
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.46
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.41
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.4
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.4
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.39
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.36
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.36
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.36
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.33
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.33
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.31
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.29
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 88.8
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 86.57
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.48  E-value=5.1e-14  Score=113.41  Aligned_cols=66  Identities=29%  Similarity=0.587  Sum_probs=62.7

Q ss_pred             eEEEEEEeccchhHHHHHHHHHhcCCCeeEEEEecCCcEEEEEecCCHHHHHHHHHHcCCceEEcC
Q 008791           11 QSCVLRVNVDCDGCKQKVKKVLRKIDGVYSTNVDVEQGKVTVTGNVDPAILIKKLEKLGKHAELWG   76 (553)
Q Consensus        11 qtv~LkVeM~C~sCa~KIEKaL~kl~GV~sV~VDlatgkVtV~g~id~eeIikaI~kaGy~Ael~~   76 (553)
                      .+++|+|+|+|.+|+.+|+++|++++||.+|.||+++++|+|+..+++++|+++|+++||+|.++.
T Consensus         6 ~~~~f~V~M~C~~C~~~Iek~l~~~~gV~~v~vdl~~~~v~V~~~~~~~~i~~~I~~~G~~A~l~g   71 (72)
T d1qupa2           6 YEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRG   71 (72)
T ss_dssp             EEEEEECCCCSTTHHHHHHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHHTTCCCEEEC
T ss_pred             EEEEEEEccCCHHHHHHHHHHHhcCCCeeEEEEECCCCEEEEEeeCCHHHHHHHHHHhCCCEEEec
Confidence            366899999999999999999999999999999999999999999999999999999999999865
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure