Citrus Sinensis ID: 008824

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--
MDATSPNSERRPFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELTSEKVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDPEGGDDDEESGEGEGNEDELESKMKNLEVKQDD
cccccccccccccEEEEccccHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHccccccccccccccccccccc
ccccccccccccEEEEEccccHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHcccccEEEccccccccccHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHcccccccEEEccccccEHHHHHHHHHHHHHcccccEEEccccEcHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHccccccccEEEcccccccHHHcccccccccccHHHHHcccccEcccc
mdatspnserrpfsiklwppsqnTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEhyekerdgdgssAVQLYARECSKLLLEALkrgprtkeygevpsfekteDVTEELTsekvstadvtLFDISKGQRAFIEAEEAEEILrplkepgnsytkicfsnrsfgleaarVAEPILVSINSqlkevdlsdfvagrpeAEALEVMAIFSAALEGSVlkslnlsdnalgeKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHnnmtgdegAQAISDvvkhsplledfrcsstrigseggTALSEALESCthlkkldlrdnmFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELagnditveaAPVISACVAAKQHLTKLNLaenelkddgAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQkpgfkqlnidaniiseegIDEVKEIFKNSPDMLEsleendpeggdddeesgegegnedELESKMKNLEVKQDD
mdatspnserrpfsiklwppsqntRQMLVERMrnnlttksifTQRYGVLTQEEAEENAKKIEDVAFSSANEHYekerdgdgssAVQLYARECSKLLLEalkrgprtkeygevpsfektedvteeltsekvstadvtlfdISKGQRAFIEAEEAEEIlrplkepgnsyTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVViqkpgfkqlnidaNIISEEGIDEVKEIFKNSPDMLESLEENdpeggdddeesgegegnedeleskmknlevkqdd
MDATSPNSERRPFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELTSEKVSTADVTLFDISKGQRAFieaeeaeeiLRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGAllesqssleelylMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESleendpeggdddeesgegegnedelesKMKNLEVKQDD
***********************************LTTKSIFTQRYGVL************************************QLYARECSKLLLEA*********************************ADVTLFDISKGQRAFIEAE**EEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRI*****TALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVK**************************************************
****************LWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPR*****E*P*FEKTEDVTEELTSEKVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDPEGGDDDEESGEGEGNEDELESKMKNLEVK***
***********PFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSAN*************AVQLYARECSKLLLEALKRGPRTKEYGEVPS***************VSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLE***************************SKMKNLEVKQDD
**********RPFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELTSEKVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDPEGGDDDEE***********ES***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDATSPNSERRPFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELTSEKVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDPEGGDDDEESGEGEGNEDELESKMKNLEVKQDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query552 2.2.26 [Sep-21-2011]
Q9M651545 RAN GTPase-activating pro yes no 0.960 0.972 0.685 0.0
Q9LE82535 RAN GTPase-activating pro no no 0.903 0.932 0.640 0.0
Q0VAA2488 Uncharacterized protein C yes no 0.548 0.620 0.273 1e-20
Q7RTR21065 Protein NLRC3 OS=Homo sap no no 0.503 0.261 0.308 4e-20
O13066 580 Ran GTPase-activating pro N/A no 0.539 0.513 0.299 4e-20
Q5DU561064 Protein NLRC3 OS=Mus musc yes no 0.463 0.240 0.299 9e-19
P46060 587 Ran GTPase-activating pro no no 0.554 0.521 0.287 4e-18
C3VPR61915 Protein NLRC5 OS=Mus musc no no 0.490 0.141 0.261 7e-18
P46061 589 Ran GTPase-activating pro no no 0.539 0.505 0.289 1e-17
Q14BP6391 Leucine-rich repeat-conta no no 0.442 0.624 0.276 5e-14
>sp|Q9M651|RAGP2_ARATH RAN GTPase-activating protein 2 OS=Arabidopsis thaliana GN=RANGAP2 PE=1 SV=2 Back     alignment and function desciption
 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/550 (68%), Positives = 448/550 (81%), Gaps = 20/550 (3%)

Query: 11  RP--FSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSS 68
           RP  FSIKLWPPS  TR+ L+ER+ NN ++K+IFT++YG LT+++A ENAK+IED+AFS+
Sbjct: 8   RPHAFSIKLWPPSLPTRKALIERITNNFSSKTIFTEKYGSLTKDQATENAKRIEDIAFST 67

Query: 69  ANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELTSE 128
           AN+ +E+E DGDG SAVQLYA+ECSKL+LE LK+GP  K                EL SE
Sbjct: 68  ANQQFEREPDGDGGSAVQLYAKECSKLILEVLKKGPVAKV------------AARELISE 115

Query: 129 KVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPI 188
              +   T FDISKG+RAFIEAEEAEE+L+PLKEPGN+YTKICFSNRSFGL AARVAEPI
Sbjct: 116 DSVSPRETFFDISKGKRAFIEAEEAEELLKPLKEPGNAYTKICFSNRSFGLGAARVAEPI 175

Query: 189 LVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFG 248
           L S+  QLKEVDLSDFVAGRPE EALEVM IFS AL+GS+L SLNLSDNALGEKGVRAFG
Sbjct: 176 LASLKDQLKEVDLSDFVAGRPELEALEVMNIFSDALQGSILSSLNLSDNALGEKGVRAFG 235

Query: 249 ALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVK 308
           ALL+S SSLEELYLMNDGISKEAA+AV ELIPSTE LRVL FHNNMTGDEGA AI++VVK
Sbjct: 236 ALLKSLSSLEELYLMNDGISKEAAQAVSELIPSTENLRVLHFHNNMTGDEGALAIAEVVK 295

Query: 309 HSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYAD 368
            SPLLE+FRCSSTR+GS+GG ALSEALE CTH++KLDLRDNMFG EAGV+LSK LS++  
Sbjct: 296 RSPLLENFRCSSTRVGSKGGIALSEALEHCTHMEKLDLRDNMFGTEAGVSLSKTLSSFKH 355

Query: 369 LTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTK 428
           +TE+YLSYLNLED+G +AI NALK SA  +EVLE+AGNDITVEAA  I+ACVAAKQ L K
Sbjct: 356 MTELYLSYLNLEDEGAIAIVNALKESASPIEVLEMAGNDITVEAASAIAACVAAKQDLNK 415

Query: 429 LNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNI 488
           LNL+ENELKD+G +QI+  +E+GH +L+ +DMS+N+IRRAGAR LA VV++K  FK LNI
Sbjct: 416 LNLSENELKDEGCVQIANCIEEGHSKLQYIDMSTNYIRRAGARALAHVVVKKEAFKLLNI 475

Query: 489 DANIISEEGIDEVKEIFKNSPDMLESL------EENDPEGGDDDEESGEGEGNEDELESK 542
           D NIISEEGI+E+KEIFK SP++L +L       E D +  +D+E+         ELESK
Sbjct: 476 DGNIISEEGIEELKEIFKKSPELLGALDENDPDGEEDDDDEEDEEDEENEGNGNGELESK 535

Query: 543 MKNLEVKQDD 552
           +KNLEV Q+D
Sbjct: 536 LKNLEVNQED 545
GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q0VAA2|CN16B_HUMAN Uncharacterized protein C14orf166B OS=Homo sapiens GN=C14orf166B PE=2 SV=2 Back     alignment and function description
>sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 Back     alignment and function description
>sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 Back     alignment and function description
>sp|Q5DU56|NLRC3_MOUSE Protein NLRC3 OS=Mus musculus GN=Nlrc3 PE=2 SV=2 Back     alignment and function description
>sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 Back     alignment and function description
>sp|C3VPR6|NLRC5_MOUSE Protein NLRC5 OS=Mus musculus GN=Nlrc5 PE=1 SV=2 Back     alignment and function description
>sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 Back     alignment and function description
>sp|Q14BP6|YV012_MOUSE Leucine-rich repeat-containing protein LOC400891 homolog OS=Mus musculus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
255552321549 leucine rich repeat-containing protein, 0.994 1.0 0.759 0.0
224108087540 predicted protein [Populus trichocarpa] 0.920 0.940 0.784 0.0
225436920541 PREDICTED: RAN GTPase-activating protein 0.976 0.996 0.717 0.0
147789790541 hypothetical protein VITISV_039541 [Viti 0.976 0.996 0.716 0.0
225432584539 PREDICTED: RAN GTPase-activating protein 0.976 1.0 0.760 0.0
356575811532 PREDICTED: RAN GTPase-activating protein 0.954 0.990 0.736 0.0
147790061539 hypothetical protein VITISV_012187 [Viti 0.976 1.0 0.760 0.0
449458432539 PREDICTED: RAN GTPase-activating protein 0.976 1.0 0.692 0.0
399498060553 Ran GTPase activating protein 2 [Solanum 0.972 0.971 0.695 0.0
156229388553 Ran GTPase-activating protein 2 [Solanum 0.972 0.971 0.691 0.0
>gi|255552321|ref|XP_002517205.1| leucine rich repeat-containing protein, putative [Ricinus communis] gi|223543840|gb|EEF45368.1| leucine rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/552 (75%), Positives = 478/552 (86%), Gaps = 3/552 (0%)

Query: 1   MDATSPNSERRPFSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKK 60
           MDAT   S+R PFSIKLWPPSQNTRQMLV R+ +NLT+KSIFTQ+YG L++EEAEENAK+
Sbjct: 1   MDATILKSQR-PFSIKLWPPSQNTRQMLVTRITDNLTSKSIFTQKYGSLSKEEAEENAKR 59

Query: 61  IEDVAFSSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTED 120
           IEDVAF +ANEHYE E DGDG SAVQ YA+ECSKL+LE LKRGP  KE GE+ + ++ + 
Sbjct: 60  IEDVAFVAANEHYENEPDGDGGSAVQFYAKECSKLILEVLKRGPARKEGGEILASKQVD- 118

Query: 121 VTEELTSEKVSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLE 180
             E L S++V+ +   +FDISKG RAFIEA+EAE+IL PLKEPGNSYTKICFSNRSFGLE
Sbjct: 119 -GEALASKEVAVSRDIVFDISKGPRAFIEAKEAEDILSPLKEPGNSYTKICFSNRSFGLE 177

Query: 181 AARVAEPILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALG 240
           AARVAEPIL SI  QLKEVDLSDF+AGRPE EAL+VM IFSAALEGS+LKSL+LS+NALG
Sbjct: 178 AARVAEPILASIKDQLKEVDLSDFIAGRPEEEALDVMNIFSAALEGSILKSLDLSNNALG 237

Query: 241 EKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGA 300
           EKGVRAFGALL SQS LEELYLMNDGIS+EAARAVCELIPSTEKLR+L FHNNMTGD GA
Sbjct: 238 EKGVRAFGALLRSQSCLEELYLMNDGISEEAARAVCELIPSTEKLRILHFHNNMTGDPGA 297

Query: 301 QAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALS 360
            AI++V+K S LLEDFRCSSTRIG+EGG ALSEALE+C+HLKKLDLRDN+FGVEAGVALS
Sbjct: 298 LAIAEVLKRSALLEDFRCSSTRIGAEGGIALSEALETCSHLKKLDLRDNVFGVEAGVALS 357

Query: 361 KALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACV 420
           K L  +A LTEVYLSYLNLED+G +AI NALK SAP LEVL++AGNDIT EAAPV+SACV
Sbjct: 358 KVLPKHAGLTEVYLSYLNLEDEGAIAIANALKESAPALEVLDMAGNDITAEAAPVVSACV 417

Query: 421 AAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQK 480
             KQ+L KLNLAENELKD+GAIQISKALE+GH QLK VDMS+N I R GAR LAQV++QK
Sbjct: 418 ELKQNLIKLNLAENELKDEGAIQISKALEEGHVQLKEVDMSTNSIGRVGARVLAQVMVQK 477

Query: 481 PGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDPEGGDDDEESGEGEGNEDELE 540
           P FK LNI+ N IS+EGIDEVKEIFK  P+ML  L+EN+PEG DDDEESGEG+ N+ +LE
Sbjct: 478 PEFKLLNINENCISDEGIDEVKEIFKKCPEMLGPLDENNPEGPDDDEESGEGDDNQHDLE 537

Query: 541 SKMKNLEVKQDD 552
           SK+KNLEV  +D
Sbjct: 538 SKLKNLEVTGED 549

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224108087|ref|XP_002314715.1| predicted protein [Populus trichocarpa] gi|222863755|gb|EEF00886.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225436920|ref|XP_002275003.1| PREDICTED: RAN GTPase-activating protein 1 isoform 2 [Vitis vinifera] gi|225436922|ref|XP_002274973.1| PREDICTED: RAN GTPase-activating protein 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789790|emb|CAN73875.1| hypothetical protein VITISV_039541 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432584|ref|XP_002281311.1| PREDICTED: RAN GTPase-activating protein 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575811|ref|XP_003556030.1| PREDICTED: RAN GTPase-activating protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|147790061|emb|CAN75983.1| hypothetical protein VITISV_012187 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458432|ref|XP_004146951.1| PREDICTED: RAN GTPase-activating protein 1-like [Cucumis sativus] gi|449517201|ref|XP_004165634.1| PREDICTED: RAN GTPase-activating protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|399498060|emb|CCG20358.1| Ran GTPase activating protein 2 [Solanum tuberosum] gi|399498088|emb|CCG20372.1| Ran GTPase activating protein 2 [Solanum tuberosum] gi|399498108|emb|CCG20382.1| Ran GTPase activating protein 2 [Solanum vernei] gi|399498118|emb|CCG20387.1| Ran GTPase activating protein 2 [Solanum vernei] Back     alignment and taxonomy information
>gi|156229388|emb|CAL69642.1| Ran GTPase-activating protein 2 [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
TAIR|locus:2150285545 RANGAP2 "AT5G19320" [Arabidops 0.891 0.902 0.673 4.1e-175
TAIR|locus:2099207535 RANGAP1 "AT3G63130" [Arabidops 0.702 0.725 0.658 4.8e-126
TAIR|locus:2083028211 AT3G06000 [Arabidopsis thalian 0.298 0.781 0.513 1.4e-41
UNIPROTKB|Q7RTR21065 NLRC3 "Protein NLRC3" [Homo sa 0.528 0.274 0.296 2.3e-22
TAIR|locus:2194604605 emb2004 "embryo defective 2004 0.501 0.457 0.255 2.9e-21
MGI|MGI:24440701064 Nlrc3 "NLR family, CARD domain 0.469 0.243 0.275 4e-19
RGD|1310380431 Rangap1 "RAN GTPase activating 0.490 0.628 0.304 1.8e-18
UNIPROTKB|P46060 587 RANGAP1 "Ran GTPase-activating 0.534 0.502 0.286 4.8e-18
MGI|MGI:103071 589 Rangap1 "RAN GTPase activating 0.490 0.460 0.300 6.3e-18
UNIPROTKB|F1PVY6 628 RANGAP1 "Uncharacterized prote 0.505 0.444 0.298 1.6e-17
TAIR|locus:2150285 RANGAP2 "AT5G19320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1701 (603.8 bits), Expect = 4.1e-175, P = 4.1e-175
 Identities = 341/506 (67%), Positives = 404/506 (79%)

Query:     9 ERRP--FSIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAF 66
             + RP  FSIKLWPPS  TR+ L+ER+ NN ++K+IFT++YG LT+++A ENAK+IED+AF
Sbjct:     6 DSRPHAFSIKLWPPSLPTRKALIERITNNFSSKTIFTEKYGSLTKDQATENAKRIEDIAF 65

Query:    67 SSANEHYEKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVPSFEKTEDVTEELT 126
             S+AN+ +E+E DGDG SAVQLYA+ECSKL+LE LK+GP  K                EL 
Sbjct:    66 STANQQFEREPDGDGGSAVQLYAKECSKLILEVLKKGPVAKV------------AARELI 113

Query:   127 SEKVSTADVTLFDISKGQRAFXXXXXXXXXLRPLKEPGNSYTKICFSNRSFGLEAARVAE 186
             SE   +   T FDISKG+RAF         L+PLKEPGN+YTKICFSNRSFGL AARVAE
Sbjct:   114 SEDSVSPRETFFDISKGKRAFIEAEEAEELLKPLKEPGNAYTKICFSNRSFGLGAARVAE 173

Query:   187 PILVSINSQLKEVDLSDFVAGRPEAEALEVMAIFSAALEGSVLKSLNLSDNALGEKGVRA 246
             PIL S+  QLKEVDLSDFVAGRPE EALEVM IFS AL+GS+L SLNLSDNALGEKGVRA
Sbjct:   174 PILASLKDQLKEVDLSDFVAGRPELEALEVMNIFSDALQGSILSSLNLSDNALGEKGVRA 233

Query:   247 FGAXXXXXXXXXXXXXMNDGISKEAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDV 306
             FGA             MNDGISKEAA+AV ELIPSTE LRVL FHNNMTGDEGA AI++V
Sbjct:   234 FGALLKSLSSLEELYLMNDGISKEAAQAVSELIPSTENLRVLHFHNNMTGDEGALAIAEV 293

Query:   307 VKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNY 366
             VK SPLLE+FRCSSTR+GS+GG ALSEALE CTH++KLDLRDNMFG EAGV+LSK LS++
Sbjct:   294 VKRSPLLENFRCSSTRVGSKGGIALSEALEHCTHMEKLDLRDNMFGTEAGVSLSKTLSSF 353

Query:   367 ADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHL 426
               +TE+YLSYLNLED+G +AI NALK SA  +EVLE+AGNDITVEAA  I+ACVAAKQ L
Sbjct:   354 KHMTELYLSYLNLEDEGAIAIVNALKESASPIEVLEMAGNDITVEAASAIAACVAAKQDL 413

Query:   427 TKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQL 486
              KLNL+ENELKD+G +QI+  +E+GH +L+ +DMS+N+IRRAGAR LA VV++K  FK L
Sbjct:   414 NKLNLSENELKDEGCVQIANCIEEGHSKLQYIDMSTNYIRRAGARALAHVVVKKEAFKLL 473

Query:   487 NIDANIISEEGIDEVKEIFKNSPDML 512
             NID NIISEEGI+E+KEIFK SP++L
Sbjct:   474 NIDGNIISEEGIEELKEIFKKSPELL 499
GO:0005098 "Ran GTPase activator activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005635 "nuclear envelope" evidence=IDA
GO:0006913 "nucleocytoplasmic transport" evidence=RCA;TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0048527 "lateral root development" evidence=RCA
TAIR|locus:2099207 RANGAP1 "AT3G63130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083028 AT3G06000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7RTR2 NLRC3 "Protein NLRC3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2194604 emb2004 "embryo defective 2004" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2444070 Nlrc3 "NLR family, CARD domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310380 Rangap1 "RAN GTPase activating protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46060 RANGAP1 "Ran GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:103071 Rangap1 "RAN GTPase activating protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVY6 RANGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M651RAGP2_ARATHNo assigned EC number0.68540.96010.9724yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.6002.1
hypothetical protein (524 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
pfam13943100 pfam13943, WPP, WPP domain 2e-47
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-33
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-27
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 4e-12
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 8e-10
>gnl|CDD|206114 pfam13943, WPP, WPP domain Back     alignment and domain information 
 Score =  159 bits (405), Expect = 2e-47
 Identities = 59/100 (59%), Positives = 74/100 (74%)

Query: 14  SIKLWPPSQNTRQMLVERMRNNLTTKSIFTQRYGVLTQEEAEENAKKIEDVAFSSANEHY 73
           S KLWPPSQ TR  +VER+   L+T SI ++RYG+L++EEAEE AK IE+ AF++AN H 
Sbjct: 1   SFKLWPPSQRTRDAVVERLTETLSTPSILSKRYGLLSKEEAEEAAKAIEEEAFAAANAHA 60

Query: 74  EKERDGDGSSAVQLYARECSKLLLEALKRGPRTKEYGEVP 113
            KE DGDG SA+QLY++E SK +LE LKR PR  E  E P
Sbjct: 61  SKEPDGDGISALQLYSKEISKRMLEVLKRRPRAAEAPEEP 100

Length = 100
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 552
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 100.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.96
PF1394399 WPP: WPP domain 99.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
KOG4308478 consensus LRR-containing protein [Function unknown 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG4308478 consensus LRR-containing protein [Function unknown 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.54
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
KOG4341483 consensus F-box protein containing LRR [General fu 99.42
KOG4341483 consensus F-box protein containing LRR [General fu 99.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.37
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.37
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.36
KOG4237498 consensus Extracellular matrix protein slit, conta 99.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.32
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.32
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG0617264 consensus Ras suppressor protein (contains leucine 99.13
KOG0617264 consensus Ras suppressor protein (contains leucine 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.73
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.56
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.55
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.21
PLN03150623 hypothetical protein; Provisional 98.08
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.98
PLN03150623 hypothetical protein; Provisional 97.94
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.85
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.76
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.64
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.48
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.46
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.46
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.33
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 97.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.18
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 97.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.14
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.92
PRK15386426 type III secretion protein GogB; Provisional 96.48
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.09
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.85
PRK15386 426 type III secretion protein GogB; Provisional 95.33
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.71
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.99
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.38
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 84.38
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 80.47
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-40  Score=314.07  Aligned_cols=368  Identities=43%  Similarity=0.623  Sum_probs=338.4

Q ss_pred             cEeecccCccccccHHHHHHHHhhhhCCCCCceEEEecCCCCCHHHHHHHHHHHHhhccCccEEEeccccCCCchHHHHH
Q 008824          136 TLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAEALE  215 (552)
Q Consensus       136 ~~ldl~~~~~~~~~~~~~~~~l~~l~~~~~~l~~L~ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~~~~~~~~~~~l~  215 (552)
                      ..+.+.++..++.+.++.+.+...+... ..+++|+||||.|+.+++++++..|.+. +.|+..++|+.+.|++..+.++
T Consensus         2 ~~~s~~gk~lkl~t~ed~~~v~~~~~~~-~s~~~l~lsgnt~G~EAa~~i~~~L~~~-~~L~~v~~sd~ftGR~~~Ei~e   79 (382)
T KOG1909|consen    2 QFFSIGGKSLKLETEEDEKDVEEELEPM-DSLTKLDLSGNTFGTEAARAIAKVLASK-KELREVNLSDMFTGRLKDEIPE   79 (382)
T ss_pred             ceeccCCeeeeeehHhhhhhHHHHhccc-CceEEEeccCCchhHHHHHHHHHHHhhc-ccceeeehHhhhcCCcHHHHHH
Confidence            3467778888888777777777766666 8999999999999999999999999995 6999999999999999999999


Q ss_pred             HHHHHHHHhcCC-CccEEEcCCCCCCHHHHHHHHHHHhcCCCccEEEeeCCCCCHHHHHHHHH---------hcCCCCCc
Q 008824          216 VMAIFSAALEGS-VLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCE---------LIPSTEKL  285 (552)
Q Consensus       216 ~l~~~~~~l~~~-~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~---------~l~~~~~L  285 (552)
                      .|.+++.++..+ +|++||||+|.|+..+++.|..+|+++..|++|+|.||+++..+...++.         .+.+.+.|
T Consensus        80 ~L~~l~~aL~~~~~L~~ldLSDNA~G~~g~~~l~~ll~s~~~L~eL~L~N~Glg~~ag~~l~~al~~l~~~kk~~~~~~L  159 (382)
T KOG1909|consen   80 ALKMLSKALLGCPKLQKLDLSDNAFGPKGIRGLEELLSSCTDLEELYLNNCGLGPEAGGRLGRALFELAVNKKAASKPKL  159 (382)
T ss_pred             HHHHHHHHHhcCCceeEeeccccccCccchHHHHHHHHhccCHHHHhhhcCCCChhHHHHHHHHHHHHHHHhccCCCcce
Confidence            999999999865 99999999999999999999999999999999999999999998888555         34567899


Q ss_pred             cEEEcccCCCChHHHHHHHHHhhcCCCccEEEeeCCCCChHHHHHHHHHhhcCCCCCEEecCCCCCChHHHHHHHHHHcc
Q 008824          286 RVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSN  365 (552)
Q Consensus       286 ~~L~Ls~n~l~~~g~~~l~~~l~~~~~L~~L~ls~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~L~~~l~~  365 (552)
                      +++..++|++.+.|+..++..++..+.|+.++++.|.|...|+..+..++.+|++|+.|||++|.|+.++...+.+.++.
T Consensus       160 rv~i~~rNrlen~ga~~~A~~~~~~~~leevr~~qN~I~~eG~~al~eal~~~~~LevLdl~DNtft~egs~~LakaL~s  239 (382)
T KOG1909|consen  160 RVFICGRNRLENGGATALAEAFQSHPTLEEVRLSQNGIRPEGVTALAEALEHCPHLEVLDLRDNTFTLEGSVALAKALSS  239 (382)
T ss_pred             EEEEeeccccccccHHHHHHHHHhccccceEEEecccccCchhHHHHHHHHhCCcceeeecccchhhhHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccEEecCCCCCCchHHHHHHHHHhcCCCCccEEEccCCCCCcchHHHHHHHhhcCCCcCEEEccCCCC--CchHHHH
Q 008824          366 YADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENEL--KDDGAIQ  443 (552)
Q Consensus       366 ~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l--~d~g~~~  443 (552)
                      +++|+.|++++|.+...|...+..++....+.|++|.|.+|.++..+...++.++...|.|..|+|++|.+  .|.++..
T Consensus       240 ~~~L~El~l~dcll~~~Ga~a~~~al~~~~p~L~vl~l~gNeIt~da~~~la~~~~ek~dL~kLnLngN~l~e~de~i~e  319 (382)
T KOG1909|consen  240 WPHLRELNLGDCLLENEGAIAFVDALKESAPSLEVLELAGNEITRDAALALAACMAEKPDLEKLNLNGNRLGEKDEGIDE  319 (382)
T ss_pred             cchheeecccccccccccHHHHHHHHhccCCCCceeccCcchhHHHHHHHHHHHHhcchhhHHhcCCcccccccchhHHH
Confidence            99999999999999999999999999988999999999999999999999999999999999999999999  8899999


Q ss_pred             HHHHHhhCCCCccEEEccCCCCCHHHHHHHHHHHhcCCCccEEEecCCCCCHHHHHHHHHHH
Q 008824          444 ISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIF  505 (552)
Q Consensus       444 l~~~L~~~~~~L~~L~Ls~n~i~~~g~~~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l  505 (552)
                      ++..+......+...+.+.+.+.+.|.....+.......-+.++..++.|.+++++++.+++
T Consensus       320 i~~~~~~~~~~~~~~~~s~e~l~~eg~e~e~~~~~~~~t~~e~~ed~e~ie~e~~ee~~e~~  381 (382)
T KOG1909|consen  320 IASKFDTAHVLLEDIDDSEEELEREGEEDEEEEVEKKETFKELNEDGEVIEEEGIEELKEIF  381 (382)
T ss_pred             HHHhcccccccchhhchhHHHHHhhhhhHHHHHHHhcCcchhhcccccccchhHHHHhhhhc
Confidence            99877534566777888889999999999888888888889999999999999998887754

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13943 WPP: WPP domain Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
2bnh_A457 Porcine Ribonuclease Inhibitor Length = 457 2e-11
2bnh_A 457 Porcine Ribonuclease Inhibitor Length = 457 3e-09
3tsr_E457 X-Ray Structure Of Mouse Ribonuclease Inhibitor Com 3e-11
1a4y_A 460 Ribonuclease Inhibitor-Angiogenin Complex Length = 6e-10
1z7x_W 461 X-Ray Structure Of Human Ribonuclease Inhibitor Com 7e-10
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 1e-06
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 5e-05
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 1e-06
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 6e-05
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure 
Iteration: 1

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 117/280 (41%), Gaps = 30/280 (10%)
Query: 228 VLKSLNLSDNALGEKGVRAFGAXXXXXXXXXXXXXMNDGISKEAARAVCE-LIPSTEKLR 286
            L+ L+LSDN LG+ G+R                              CE L+     L 
Sbjct: 110 TLRELHLSDNPLGDAGLRLL----------------------------CEGLLDPQCHLE 141
Query: 287 VLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEAL-ESCTHLKKLD 345
            LQ           + ++ V++ +  L++   S+  IG  G   L + L +S   L+ L 
Sbjct: 142 KLQLEYCRLTAASCEPLASVLRATRALKELTVSNNDIGEAGARVLGQGLADSACQLETLR 201
Query: 346 LRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAG 405
           L +          L   +++ A L E+ L    L D G   +   L   A  L+ L L  
Sbjct: 202 LENCGLTPANCKDLCGIVASQASLRELDLGSNGLGDAGIAELCPGLLSPASRLKTLWLWE 261
Query: 406 NDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFI 465
            DIT      +   + AK+ L +L+LA N+L D+GA  + ++L Q   QL+ + + S  +
Sbjct: 262 CDITASGCRDLCRVLQAKETLKELSLAGNKLGDEGARLLCESLLQPGCQLESLWVKSCSL 321
Query: 466 RRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIF 505
             A  + ++ ++ Q     +L + +N + + GI E+ +  
Sbjct: 322 TAACCQHVSLMLTQNKHLLELQLSSNKLGDSGIQELCQAL 361
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure
>pdb|3TSR|E Chain E, X-Ray Structure Of Mouse Ribonuclease Inhibitor Complexed With Mouse Ribonuclease 1 Length = 457 Back     alignment and structure
>pdb|1A4Y|A Chain A, Ribonuclease Inhibitor-Angiogenin Complex Length = 460 Back     alignment and structure
>pdb|1Z7X|W Chain W, X-Ray Structure Of Human Ribonuclease Inhibitor Complexed With Ribonuclease I Length = 461 Back     alignment and structure
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-77
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-63
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-40
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-30
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 9e-09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-24
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 5e-19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-13
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-13
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-10
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-04
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
 Score =  250 bits (640), Expect = 3e-77
 Identities = 74/372 (19%), Positives = 146/372 (39%), Gaps = 11/372 (2%)

Query: 148 IEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAG 207
           +       +L+ L+ P     K+   N         V    L +    L+E+ LSD + G
Sbjct: 68  LGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRT-LPTLQELHLSDNLLG 126

Query: 208 RPEAEALEVMAIFSAALE--GSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMND 265
               + L         L      L+ L L   +L         ++L ++   +EL + N+
Sbjct: 127 DAGLQLL------CEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNN 180

Query: 266 GISKEAARAVCE-LIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIG 324
            I++   R +C+ L  S  +L  L+  +     +  + +  +V     L +    S ++G
Sbjct: 181 DINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLG 240

Query: 325 SEGGTALSEALESC-THLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDG 383
             G   L   L    + L+ L + +     +    L + L     L E+ L+   L D+G
Sbjct: 241 DVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG 300

Query: 384 TVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQ 443
              +   L      LE L +     T       S+ +A  + L +L ++ N L+D G  +
Sbjct: 301 ARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRE 360

Query: 444 ISKALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKE 503
           + + L Q    L+V+ ++   +  +    LA  ++     ++L++  N + + GI ++ E
Sbjct: 361 LCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVE 420

Query: 504 IFKNSPDMLESL 515
             +    +LE L
Sbjct: 421 SVRQPGCLLEQL 432
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.69
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.69
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.52
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.48
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.46
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.45
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.3
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.29
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.21
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.03
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.95
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.87
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.78
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.13
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.89
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 83.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 80.43
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
Probab=100.00  E-value=8.2e-38  Score=329.65  Aligned_cols=380  Identities=19%  Similarity=0.296  Sum_probs=332.9

Q ss_pred             cccCCccEeecccCccccccHHHHHHHHhhhhCCCCCceEEEecCCCCCHHHHHHHHHHHHhhccCccEEEeccccCCCc
Q 008824          130 VSTADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRP  209 (552)
Q Consensus       130 ~~~~~l~~ldl~~~~~~~~~~~~~~~~l~~l~~~~~~l~~L~ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~~~~~~~  209 (552)
                      ...+.++++|+++..   ++...+..+...+....+++++|++++|.++..++..+...+.. .++|++|+|++|.++..
T Consensus        53 ~~~~~L~~L~Ls~n~---l~~~~~~~l~~~l~~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~-~~~L~~L~Ls~n~i~~~  128 (461)
T 1z7x_W           53 RVNPALAELNLRSNE---LGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRT-LPTLQELHLSDNLLGDA  128 (461)
T ss_dssp             HTCTTCCEEECTTCC---CHHHHHHHHHHTTCSTTCCCCEEECTTSCCBGGGHHHHHHHTTS-CTTCCEEECCSSBCHHH
T ss_pred             HhCCCcCEEeCCCCc---CChHHHHHHHHHHhhCCCceeEEEccCCCCCHHHHHHHHHHHcc-CCceeEEECCCCcCchH
Confidence            344678999999865   44566667777776654589999999999998887777777766 47999999999988654


Q ss_pred             hHHHHHHHHHHHHHhc--CCCccEEEcCCCCCCHHHHHHHHHHHhcCCCccEEEeeCCCCCHHHHHHHHHhcC-CCCCcc
Q 008824          210 EAEALEVMAIFSAALE--GSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIP-STEKLR  286 (552)
Q Consensus       210 ~~~~l~~l~~~~~~l~--~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~-~~~~L~  286 (552)
                      ....      +...+.  .++|++|+|++|.++..++..++..+..+++|++|++++|.+++.+...+...+. ..++|+
T Consensus       129 ~~~~------l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~~L~  202 (461)
T 1z7x_W          129 GLQL------LCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLE  202 (461)
T ss_dssp             HHHH------HHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHHHSCCCCC
T ss_pred             HHHH------HHHHHhcCCCcceEEECCCCCCCHHHHHHHHHHHhhCCCCCEEECcCCCcchHHHHHHHHHHhcCCCCce
Confidence            3332      222222  3589999999999999999999999999999999999999999988888887664 356999


Q ss_pred             EEEcccCCCChHHHHHHHHHhhcCCCccEEEeeCCCCChHHHHHHHHHhh-cCCCCCEEecCCCCCChHHHHHHHHHHcc
Q 008824          287 VLQFHNNMTGDEGAQAISDVVKHSPLLEDFRCSSTRIGSEGGTALSEALE-SCTHLKKLDLRDNMFGVEAGVALSKALSN  365 (552)
Q Consensus       287 ~L~Ls~n~l~~~g~~~l~~~l~~~~~L~~L~ls~n~l~~~~~~~l~~~l~-~~~~L~~L~Ls~n~l~~~~~~~L~~~l~~  365 (552)
                      +|++++|.++..++..++..+..+++|++|++++|.+++.+...++..+. .+++|+.|++++|.++..++..++..+..
T Consensus       203 ~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~  282 (461)
T 1z7x_W          203 ALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRA  282 (461)
T ss_dssp             EEECTTSCCBTTHHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHH
T ss_pred             EEEccCCCCcHHHHHHHHHHHHhCCCccEEeccCCcCChHHHHHHHHHHhcCCCCceEEECcCCCCCHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999888887776 57899999999999999999999999999


Q ss_pred             CCcccEEecCCCCCCchHHHHHHHHHhcCCCCccEEEccCCCCCcchHHHHHHHhhcCCCcCEEEccCCCCCchHHHHHH
Q 008824          366 YADLTEVYLSYLNLEDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQIS  445 (552)
Q Consensus       366 ~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~d~g~~~l~  445 (552)
                      +++|++|++++|.+++.++..++..+..+.++|++|++++|.++..+...++..+..+++|++|+|++|.+++.|+..++
T Consensus       283 ~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~  362 (461)
T 1z7x_W          283 KESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELC  362 (461)
T ss_dssp             CTTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHH
T ss_pred             CCCcceEECCCCCCchHHHHHHHHHhccCCccceeeEcCCCCCchHHHHHHHHHHhhCCCccEEEccCCccccccHHHHH
Confidence            99999999999999999999999988777789999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCccEEEccCCCCCHHHHHHHHHHHhcCCCccEEEecCCCCCHHHHHHHHHHHhcCccccccccccC
Q 008824          446 KALEQGHDQLKVVDMSSNFIRRAGARQLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEEND  519 (552)
Q Consensus       446 ~~L~~~~~~L~~L~Ls~n~i~~~g~~~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l~~~~~~l~~l~~~~  519 (552)
                      +++...+++|++|++++|.|++.|+..++.++..+++|+.|++++|+|++.|+..+.+.+++....+..+...+
T Consensus       363 ~~l~~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~l~~N~i~~~~~~~l~~~l~~~~~~L~~L~~~~  436 (461)
T 1z7x_W          363 QGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYD  436 (461)
T ss_dssp             HHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEECTT
T ss_pred             HHHcCCCCceEEEECCCCCCChhhHHHHHHHHHhCCCccEEECCCCCCCHHHHHHHHHHhccCCcchhheeecc
Confidence            99884488999999999999999999999999999999999999999999999999999998766666665443
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 552
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-18
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-11
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-18
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-17
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-14
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-14
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-14
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-13
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-13
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-13
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-12
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 2e-11
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 0.001
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 7e-06
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Rna1p (RanGAP1), N-terminal domain
domain: Rna1p (RanGAP1), N-terminal domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score = 82.6 bits (202), Expect = 9e-18
 Identities = 65/333 (19%), Positives = 128/333 (38%), Gaps = 26/333 (7%)

Query: 215 EVMAIFSAALEGSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISK----- 269
           +  ++F+  LE   +K + LS N +G +  R     + S+  LE     +    +     
Sbjct: 19  DEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKDLEIAEFSDIFTGRVKDEI 78

Query: 270 -EAARAVCELIPSTEKLRVLQFHNNMTGDEGAQAISDVVKHSPLLEDFR---------CS 319
            EA R + + +    KL  ++  +N  G    + + D +     LE              
Sbjct: 79  PEALRLLLQALLKCPKLHTVRLSDNAFGPTAQEPLIDFLSKHTPLEHLYLHNNGLGPQAG 138

Query: 320 STRIGSEGGTALSEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNL 379
           +    +    A+++  ++   L+ +    N     +    +K   ++  L  V +    +
Sbjct: 139 AKIARALQELAVNKKAKNAPPLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKMVQNGI 198

Query: 380 EDDGTVAITNALKGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDD 439
             +G   +          L+VL+L  N  T   +  ++  + +  +L +L L +  L   
Sbjct: 199 RPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAIALKSWPNLRELGLNDCLLSAR 258

Query: 440 GAIQISKALEQG-HDQLKVVDMSSNFIRRAGARQLAQVVIQK-PGFKQLNIDANIISEEG 497
           GA  +  A  +  +  L+ + +  N I     R L  V+ +K P    L ++ N  SEE 
Sbjct: 259 GAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTVIDEKMPDLLFLELNGNRFSEED 318

Query: 498 --IDEVKEIFKNSPDMLESLEENDPEGGDDDEE 528
             +DE++E+F         L+E      DD EE
Sbjct: 319 DVVDEIREVFSTRG--RGELDEL-----DDMEE 344
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.53
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.49
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.18
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.98
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.85
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.13
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.5e-33  Score=287.88  Aligned_cols=374  Identities=20%  Similarity=0.289  Sum_probs=306.4

Q ss_pred             CCccEeecccCccccccHHHHHHHHhhhhCCCCCceEEEecCCCCCHHHHHHHHHHHHhhccCccEEEeccccCCCchHH
Q 008824          133 ADVTLFDISKGQRAFIEAEEAEEILRPLKEPGNSYTKICFSNRSFGLEAARVAEPILVSINSQLKEVDLSDFVAGRPEAE  212 (552)
Q Consensus       133 ~~l~~ldl~~~~~~~~~~~~~~~~l~~l~~~~~~l~~L~ls~~~l~~~~~~~l~~~l~~~~~~L~~L~Ls~~~~~~~~~~  212 (552)
                      ..++.+|++...   ++..++..++..+    +++++|+|++|+++..++..++.++.. .++|++|+|++|.+++.+. 
T Consensus         2 ~~l~~ld~~~~~---i~~~~~~~l~~~l----~~l~~L~L~~~~i~~~~~~~l~~~L~~-~~~L~~LdLs~N~i~~~~~-   72 (460)
T d1z7xw1           2 LDIQSLDIQCEE---LSDARWAELLPLL----QQCQVVRLDDCGLTEARCKDISSALRV-NPALAELNLRSNELGDVGV-   72 (460)
T ss_dssp             EEEEEEEEESCC---CCHHHHHHHHHHH----TTCSEEEEESSCCCHHHHHHHHHHHHT-CTTCCEEECTTCCCHHHHH-
T ss_pred             CCCCEEEeeCCc---CChHHHHHHHHhC----CCCCEEEeCCCCCCHHHHHHHHHHHhc-CCCCCEEECcCCcCChHHH-
Confidence            456889998875   5577777777777    678899999999999999999888877 4789999999998864322 


Q ss_pred             HHHHHHHHHHHhc--CCCccEEEcCCCCCCHHHHHHHHHHHhcCCCccEEEeeCCCCCHHHHHHHHHhcC----------
Q 008824          213 ALEVMAIFSAALE--GSVLKSLNLSDNALGEKGVRAFGALLESQSSLEELYLMNDGISKEAARAVCELIP----------  280 (552)
Q Consensus       213 ~l~~l~~~~~~l~--~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~----------  280 (552)
                           ..+...+.  .++|++|+|++|.+++.++..++..+..+++|++|+|++|.|++.++..+...+.          
T Consensus        73 -----~~l~~~l~~~~~~L~~L~L~~n~it~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~~~~~l~~~l~~~~~~~~~~~  147 (460)
T d1z7xw1          73 -----HCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQ  147 (460)
T ss_dssp             -----HHHHHTTCSTTCCCCEEECTTSCCBGGGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEE
T ss_pred             -----HHHHHHHhcCCCCCCEEECCCCCccccccccccchhhccccccccccccccchhhhhhhhhhccccccccccccc
Confidence                 23344443  3589999999999999999999999999999999999999998877666655432          


Q ss_pred             -------------------CCCCccEEEcccCCCChHHHH-----------------------------HHHHHhhcCCC
Q 008824          281 -------------------STEKLRVLQFHNNMTGDEGAQ-----------------------------AISDVVKHSPL  312 (552)
Q Consensus       281 -------------------~~~~L~~L~Ls~n~l~~~g~~-----------------------------~l~~~l~~~~~  312 (552)
                                         ....++.+.++++.+.+.+..                             .+...+..++.
T Consensus       148 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~ls~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~  227 (460)
T d1z7xw1         148 LEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKAS  227 (460)
T ss_dssp             CTTSCCBGGGHHHHHHHHHHCTTCCEEECCSSBCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHHHCTT
T ss_pred             ccccccchhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhccccccccccc
Confidence                               124455555555554444433                             34444555667


Q ss_pred             ccEEEeeCCCCChHHHHHH-HHHhhcCCCCCEEecCCCCCChHHHHHHHHHHccCCcccEEecCCCCCCchHHHHHHHHH
Q 008824          313 LEDFRCSSTRIGSEGGTAL-SEALESCTHLKKLDLRDNMFGVEAGVALSKALSNYADLTEVYLSYLNLEDDGTVAITNAL  391 (552)
Q Consensus       313 L~~L~ls~n~l~~~~~~~l-~~~l~~~~~L~~L~Ls~n~l~~~~~~~L~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~~l  391 (552)
                      ++.+++++|.+...+.... .........++.|++++|.+.......+...+..++.++.+++++|.+++.++..++..+
T Consensus       228 ~~~l~~~~n~~~~~~~~~~~~~~~~~~~~l~~l~l~~n~i~~~~~~~~~~~l~~~~~l~~l~l~~n~i~~~~~~~l~~~l  307 (460)
T d1z7xw1         228 LRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETL  307 (460)
T ss_dssp             CCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCTTCCEEECTTCCCHHHHHHHHHHHH
T ss_pred             ccccchhhccccccccchhhcccccccccccccccccccccccccccccccccccccccccccccccccccccchhhccc
Confidence            7777777777766655433 333444678999999999999888888888888999999999999999999999999888


Q ss_pred             hcCCCCccEEEccCCCCCcchHHHHHHHhhcCCCcCEEEccCCCCCchHHHHHHHHHhhCCCCccEEEccCCCCCHHHHH
Q 008824          392 KGSAPLLEVLELAGNDITVEAAPVISACVAAKQHLTKLNLAENELKDDGAIQISKALEQGHDQLKVVDMSSNFIRRAGAR  471 (552)
Q Consensus       392 ~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~d~g~~~l~~~L~~~~~~L~~L~Ls~n~i~~~g~~  471 (552)
                      ....+.|+.+++++|.++..+...++.++..+++|++|+|++|.|++.|+..+++++...++.|++|+|++|.|++.|+.
T Consensus       308 ~~~~~~L~~l~l~~~~l~~~~~~~l~~~~~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~L~Ls~n~i~~~~~~  387 (460)
T d1z7xw1         308 LEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCS  387 (460)
T ss_dssp             TSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHHHHH
T ss_pred             cccccccccccccccchhhhhhhhcccccccccchhhhheeeecccCcccchhhhhhhcccCCCCEEECCCCCCChHHHH
Confidence            77678999999999999999999999999999999999999999999999999999974578899999999999999999


Q ss_pred             HHHHHHhcCCCccEEEecCCCCCHHHHHHHHHHHhcCccccccccccCC
Q 008824          472 QLAQVVIQKPGFKQLNIDANIISEEGIDEVKEIFKNSPDMLESLEENDP  520 (552)
Q Consensus       472 ~l~~~l~~~~~L~~L~L~~N~i~~~g~~~l~~~l~~~~~~l~~l~~~~~  520 (552)
                      ++++++..+++|++|+|++|+|+++|+..+.+.++.+...+..+...+.
T Consensus       388 ~l~~~l~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~l~l~~~  436 (460)
T d1z7xw1         388 SLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDI  436 (460)
T ss_dssp             HHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEECTTC
T ss_pred             HHHHHHhcCCCCCEEECCCCcCCHHHHHHHHHHHHhCCCccCEEECCCC
Confidence            9999999999999999999999999999999999988777877776543
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure