Citrus Sinensis ID: 008850

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MHYSAAFSQAATSATAVPTISGSRHVGALHSSSSSSCTLLIPSKPINLRFCGLRREAFGFSPSAFTRCSNSQRVQLPSRRRFKGSNVSASLGDNGIPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYMTFVSWFLCLVYALQKY
ccHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHcccEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHHHHHHHHHcHHHHHHHHccEEEEEEEEEEEcccEEEEccEEEEEcccEEEcccccccccccccccccEEEcccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHccccccEEEEEEEEEEccccEEEEEEEcccccccEEEEEcEEEEEEccccccccccccccccccccccEEcccccccccccccccccEEEEcccccHHHHHHHHcHHHHHHHHHHccccccccccccccEEEcccccccccccHHHHHHHHHHcccEEEEEEEccccccHHHccccccccEEEEEcccccccEEEEEEEcccHHHHHHHHHHHHHHccHHHHHHHHHHHcc
cccHHcccHcHcccccccccccccccHHHccccccccccccccccccccEccccHHHccccccccccccHHcccccccccccHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHcccccEEEEEcccccHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccEEEEccEEEEccccEEEcccEEEccccccccccccEEEHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEcccccEEEEEEEEEEEEEccccccccccHHHcccEccccEEEccccEEEEEccccccccEEEcHHHccccccHHHHHHHHHHHHHHHccccccccHHHccEEEccccEEEEEEccHHHHHHcHHHcccEEEEEEEccccccHHHHccccccEEEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHcccHHHHHHHHHcc
MHYSAAfsqaatsatavptisgsrhvgalhssssssctllipskpinlrfcglrreafgfspsaftrcsnsqrvqlpsrrrfkgsnvsaslgdngipksfdydlIIIGAGVGGHGAALHAVEKGLKTAIIEGdvvggtcvnrgcvpskALLAVSGRMRELQSEHHMKALGLQVhaagydrqgvaDHANNLATKIRNNLTNSMKALGVDILtgvgtilgpqkvkfgtdnivTAKDIIiatgsvpfvpkgievdgktvitsdhalklefvpdWIAIVGSGYIGLEFSDVYTALGSEVTFIEALdqlmpgfdpeIGKLAQRVLinprkidyhtgvfatkdgkpvTIELIdaktkepkdtLEVDAALIAtgrapftnglgleninvvtqrgfvpvderMRVIdangnlvphLYCIGDANGKMMLAHAASAQGISVVEQVtgrdhvlnhlsipaacfthpeismvgltepqareKAEKEGFEVSVAKTSFKANTKALAENegeglakgvprnfassertnqhsdrpskpnLVKKLADVYMTFVSWFLCLVYALQKY
MHYSAAfsqaatsatavptISGSRHVGALHSSSSSSCTLLIPSKPINLRFCGLRREAFgfspsaftrcsnsqrvqlpsrrrfkgsnvsaslgdngipKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIiatgsvpfvpkgIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDyhtgvfatkdgkpvTIELIdaktkepkdtLEVDAALIAtgrapftnglgleninvVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAekegfevsvaktsfKANTKALaenegeglakgvPRNFAssertnqhsdrpskpnlVKKLADVYMTFVSWFLCLVYALQKY
MHYsaafsqaatsataVPTISGSRHVGALHssssssCTLLIPSKPINLRFCGLRREAFGFSPSAFTRCSNSQRVQLPSRRRFKGSNVSASLGDNGIPKSFDYDliiigagvgghgaalhavEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYMTFVSWFLCLVYALQKY
************************************CTLLIPSKPINLRFCGLRREAFGFSPSAFT****************************GIPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVG****************************************************************LVKKLADVYMTFVSWFLCLVYAL***
***************************ALH*SSS***********INLRFCGLR********************************************SFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFA************D*KTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYMTFVSWFLCLVYALQK*
****************VPTISGS*************CTLLIPSKPINLRFCGLRREAFGFSPSAFTRCSNSQRVQLPSRRRFKGSNVSASLGDNGIPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQ**********EVSVAKTSFKANTKALAENEGEGLAKGVPRNFA*************KPNLVKKLADVYMTFVSWFLCLVYALQKY
***********************************SCTLLIPSKPINLRFCGLRREAFGFSPSAF*****************************GIPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYMTFVSWFLCLVYALQKY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHYSAAFSQAATSATAVPTISGSRHVGALHSSSSSSCTLLIPSKPINLRFCGLRREAFGFSPSAFTRCSNSQRVQLPSRRRFKGSNVSASLGDNGIPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYMTFVSWFLCLVYALQKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
P72740474 Dihydrolipoyl dehydrogena N/A no 0.745 0.867 0.624 1e-138
Q9Z773461 Dihydrolipoyl dehydrogena yes no 0.676 0.809 0.351 2e-57
O17953495 Dihydrolipoyl dehydrogena yes no 0.700 0.779 0.360 3e-56
Q5UYG6472 Dihydrolipoyl dehydrogena yes no 0.695 0.811 0.334 7e-54
P18925477 Dihydrolipoyl dehydrogena yes no 0.764 0.882 0.334 1e-53
P14218478 Dihydrolipoyl dehydrogena no no 0.749 0.864 0.342 1e-53
P21880470 Dihydrolipoyl dehydrogena yes no 0.704 0.825 0.331 2e-53
Q9I3D1478 Dihydrolipoamide dehydrog yes no 0.747 0.861 0.345 2e-53
P31052478 Dihydrolipoamide dehydrog yes no 0.756 0.872 0.338 3e-53
Q9M5K3507 Dihydrolipoyl dehydrogena no no 0.762 0.828 0.344 4e-53
>sp|P72740|DLDH_SYNY3 Dihydrolipoyl dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lpdA PE=1 SV=3 Back     alignment and function desciption
 Score =  491 bits (1263), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 320/418 (76%), Gaps = 7/418 (1%)

Query: 96  IPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSG 155
           + + FDYDL+IIGAGVGGHGAALHAV+ GLKTAIIE   +GGTCVNRGC+PSKALLA SG
Sbjct: 1   MSQDFDYDLVIIGAGVGGHGAALHAVKCGLKTAIIEAKDMGGTCVNRGCIPSKALLAASG 60

Query: 156 RMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGT 215
           R+RE+  + H++ LG+Q++   + R+ +A HAN+L +KI+++LTNS+  L VD + G G 
Sbjct: 61  RVREMSDQDHLQQLGIQINGVTFTREAIAAHANDLVSKIQSDLTNSLTRLKVDTIRGWGK 120

Query: 216 ILGPQKVKFGTDN---IVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWI 272
           + GPQ+V    DN   I+ AK+I++  GSVPFVP GIE+D KTV TSD A+KLE +P WI
Sbjct: 121 VSGPQEVTVIGDNETRILKAKEIMLCPGSVPFVPPGIEIDHKTVFTSDEAVKLETLPQWI 180

Query: 273 AIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGV 332
           AI+GSGYIGLEFSDVYTALG EVT IEAL  LMPGFDPEI K+A+RVLI  R I+ +TGV
Sbjct: 181 AIIGSGYIGLEFSDVYTALGCEVTMIEALPDLMPGFDPEIAKIAERVLIKSRDIETYTGV 240

Query: 333 FAT--KDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVT-QRGFV 389
           FAT  K G PV IEL DAKTKE  DTLEVDA L+ATGR P T  LGLE + V T +RGF+
Sbjct: 241 FATKIKAGSPVEIELTDAKTKEVIDTLEVDACLVATGRIPATKNLGLETVGVETDRRGFI 300

Query: 390 PVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPA 449
            V+++M+VI  +G  VPHL+ +GDA GKMMLAHAAS QG+  VE + GR   +++ +IPA
Sbjct: 301 EVNDQMQVI-KDGKPVPHLWAVGDATGKMMLAHAASGQGVVAVENICGRKTEVDYRAIPA 359

Query: 450 ACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPRN 507
           A FTHPEIS VGLTE QA+E  EKEGF VS AKT FK N+KALAE E +G+AK V R 
Sbjct: 360 AAFTHPEISYVGLTEAQAKELGEKEGFVVSTAKTYFKGNSKALAEKETDGIAKVVYRQ 417
Lipoamide dehydrogenase is a component of the alpha-ketoacid dehydrogenase complexes.
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 4
>sp|Q9Z773|DLDH_CHLPN Dihydrolipoyl dehydrogenase OS=Chlamydia pneumoniae GN=lpdA PE=3 SV=1 Back     alignment and function description
>sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=2 SV=2 Back     alignment and function description
>sp|Q5UYG6|DLDH2_HALMA Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 Back     alignment and function description
>sp|P18925|DLDH_AZOVI Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 Back     alignment and function description
>sp|P14218|DLDH_PSEFL Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 Back     alignment and function description
>sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 Back     alignment and function description
>sp|Q9I3D1|DLDH2_PSEAE Dihydrolipoamide dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 Back     alignment and function description
>sp|P31052|DLDH2_PSEPU Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 Back     alignment and function description
>sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
225431914571 PREDICTED: dihydrolipoyl dehydrogenase [ 0.854 0.824 0.868 0.0
255556334566 dihydrolipoamide dehydrogenase, putative 0.834 0.812 0.890 0.0
297834594615 hypothetical protein ARALYDRAFT_479163 [ 0.840 0.752 0.876 0.0
449460949562 PREDICTED: dihydrolipoyl dehydrogenase-l 0.825 0.809 0.885 0.0
18401311570 lipoamide dehydrogenase 1 [Arabidopsis t 0.840 0.812 0.861 0.0
145332599623 lipoamide dehydrogenase 1 [Arabidopsis t 0.840 0.743 0.861 0.0
297800544568 plastidic dihydrolipoamide dehydrogenase 0.834 0.809 0.874 0.0
222423462623 AT3G16950 [Arabidopsis thaliana] 0.840 0.743 0.859 0.0
224111924562 precursor of dehydrogenase dihydrolipoam 0.894 0.877 0.813 0.0
240255914630 dihydrolipoyl dehydrogenase [Arabidopsis 0.834 0.730 0.872 0.0
>gi|225431914|ref|XP_002276853.1| PREDICTED: dihydrolipoyl dehydrogenase [Vitis vinifera] gi|296083267|emb|CBI22903.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/486 (86%), Positives = 445/486 (91%), Gaps = 15/486 (3%)

Query: 31  SSSSSSCTLLIPSKPINLRFCGLRREAFGFSPSAFTRCSNSQRVQLPSRRRFKGSNVSAS 90
           S  SS  +   P  P+NLRFCGLRREA GFS     + ++S RV + SR RFK   VSAS
Sbjct: 18  SGHSSELSCAAPPSPLNLRFCGLRREALGFSSP---KRNDSCRVIVSSRGRFK--KVSAS 72

Query: 91  LGDNG-IPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKA 149
           + DNG  PK+FDYDL+IIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKA
Sbjct: 73  VSDNGSAPKAFDYDLVIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKA 132

Query: 150 LLAVSGRMRELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDI 209
           LLAVSGRMRELQSEHH+KALGLQV AAGYDRQGVADHANNLA+KIRNNLTNSMKALGVDI
Sbjct: 133 LLAVSGRMRELQSEHHLKALGLQVSAAGYDRQGVADHANNLASKIRNNLTNSMKALGVDI 192

Query: 210 LTGVGTILGPQKVKFG----TDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKL 265
           LTGVGTILGPQKVK+G    ++N++TAK+IIIATGSVPFVPKGIEVDGKTVITSDHALKL
Sbjct: 193 LTGVGTILGPQKVKYGKVGFSENVITAKNIIIATGSVPFVPKGIEVDGKTVITSDHALKL 252

Query: 266 EFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRK 325
           E VPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRK
Sbjct: 253 ESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRK 312

Query: 326 IDYHTGVFATK-----DGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENI 380
           IDYHTGVFA+K     DGKPV IELIDAKTKEPKD LEVDAALIATGRAPFTNGLGLENI
Sbjct: 313 IDYHTGVFASKITPAKDGKPVRIELIDAKTKEPKDALEVDAALIATGRAPFTNGLGLENI 372

Query: 381 NVVTQRGFVPVDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDH 440
           +VVTQRGF+PVDERMRVIDA+GNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTG+DH
Sbjct: 373 SVVTQRGFIPVDERMRVIDADGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGKDH 432

Query: 441 VLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGL 500
           VLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGL
Sbjct: 433 VLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGL 492

Query: 501 AKGVPR 506
           AK + R
Sbjct: 493 AKLIYR 498

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255556334|ref|XP_002519201.1| dihydrolipoamide dehydrogenase, putative [Ricinus communis] gi|223541516|gb|EEF43065.1| dihydrolipoamide dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297834594|ref|XP_002885179.1| hypothetical protein ARALYDRAFT_479163 [Arabidopsis lyrata subsp. lyrata] gi|297331019|gb|EFH61438.1| hypothetical protein ARALYDRAFT_479163 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449460949|ref|XP_004148206.1| PREDICTED: dihydrolipoyl dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18401311|ref|NP_566562.1| lipoamide dehydrogenase 1 [Arabidopsis thaliana] gi|7159282|gb|AAF37698.1|AF228637_1 lipoamide dehydrogenase [Arabidopsis thaliana] gi|15215696|gb|AAK91394.1| AT3g16950/K14A17_7 [Arabidopsis thaliana] gi|21464567|gb|AAM52238.1| AT3g16950/K14A17_7 [Arabidopsis thaliana] gi|332642366|gb|AEE75887.1| lipoamide dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145332599|ref|NP_001078165.1| lipoamide dehydrogenase 1 [Arabidopsis thaliana] gi|332642367|gb|AEE75888.1| lipoamide dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297800544|ref|XP_002868156.1| plastidic dihydrolipoamide dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] gi|297313992|gb|EFH44415.1| plastidic dihydrolipoamide dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|222423462|dbj|BAH19701.1| AT3G16950 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224111924|ref|XP_002316024.1| precursor of dehydrogenase dihydrolipoamide dehydrogenase 4 [Populus trichocarpa] gi|222865064|gb|EEF02195.1| precursor of dehydrogenase dihydrolipoamide dehydrogenase 4 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|240255914|ref|NP_567487.4| dihydrolipoyl dehydrogenase [Arabidopsis thaliana] gi|332658304|gb|AEE83704.1| dihydrolipoyl dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
TAIR|locus:505006477630 AT4G16155 [Arabidopsis thalian 0.833 0.728 0.838 3.5e-201
TAIR|locus:2086177623 LPD1 "lipoamide dehydrogenase 0.840 0.743 0.823 1.5e-200
TIGR_CMR|CHY_0713456 CHY_0713 "alpha keto acid dehy 0.702 0.848 0.347 1.1e-55
TIGR_CMR|SPO_0340462 SPO_0340 "2-oxoglutarate dehyd 0.656 0.783 0.378 2.3e-55
GENEDB_PFALCIPARUM|PF08_0066666 PF08_0066 "lipoamide dehydroge 0.462 0.382 0.369 5.2e-55
UNIPROTKB|Q8IAZ6666 PF08_0066 "Lipoamide dehydroge 0.462 0.382 0.369 5.2e-55
FB|FBgn0036762504 CG7430 [Drosophila melanogaste 0.711 0.777 0.345 2.1e-54
UNIPROTKB|G4N7G5508 MGG_17072 "Dihydrolipoyl dehyd 0.660 0.716 0.357 6.3e-53
TAIR|locus:2023782507 mtLPD1 "mitochondrial lipoamid 0.658 0.715 0.371 2.1e-52
CGD|CAL0005984491 LPD1 [Candida albicans (taxid: 0.660 0.741 0.358 9.2e-52
TAIR|locus:505006477 AT4G16155 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1947 (690.4 bits), Expect = 3.5e-201, P = 3.5e-201
 Identities = 396/472 (83%), Positives = 410/472 (86%)

Query:    42 PSKPINLRFCGLRREAFGFSPSA-FTRCSNSQRVQLPSRRRFKGSNVSASLGDNGIP-KS 99
             PS P NLRFCGLRREAF FSPS   T C    R  + SRR    +  S+S G NG P KS
Sbjct:    91 PSTPRNLRFCGLRREAFCFSPSKQLTSC----RFHIQSRRIEVSAAASSSAG-NGAPSKS 145

Query:   100 FDYDXXXXXXXXXXXXXXXXXXEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRE 159
             FDYD                  EKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRE
Sbjct:   146 FDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRE 205

Query:   160 LQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGP 219
             LQ+EHHMKA GLQV AAGYDRQGVADHA+NLATKIRNNLTNSMKALGVDILTG G +LGP
Sbjct:   206 LQNEHHMKAFGLQVSAAGYDRQGVADHASNLATKIRNNLTNSMKALGVDILTGFGAVLGP 265

Query:   220 QKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGY 279
             QKVK+G DNI+T KDIIIATGSVPFVPKGIEVDGKTVITSDHALKLE VPDWIAIVGSGY
Sbjct:   266 QKVKYG-DNIITGKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLESVPDWIAIVGSGY 324

Query:   280 IGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATK--- 336
             IGLEFSDVYTALGSEVTFIEALDQLMPGFDPEI KLAQRVLIN RKIDYHTGVFA+K   
Sbjct:   325 IGLEFSDVYTALGSEVTFIEALDQLMPGFDPEISKLAQRVLINTRKIDYHTGVFASKITP 384

Query:   337 --DGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVPVDER 394
               DGKPV IELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINV TQRGF+PVDER
Sbjct:   385 AKDGKPVLIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVTTQRGFIPVDER 444

Query:   395 MRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTH 454
             MRVID NG LVPHLYCIGDANGK+MLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTH
Sbjct:   445 MRVIDGNGKLVPHLYCIGDANGKLMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTH 504

Query:   455 PEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAKGVPR 506
             PEISMVGLTEPQAREKAEKEGF+VS+AKTSFKANTKALAENEGEGLAK + R
Sbjct:   505 PEISMVGLTEPQAREKAEKEGFKVSIAKTSFKANTKALAENEGEGLAKMIYR 556
GO:0004148 "dihydrolipoyl dehydrogenase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016668 "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2086177 LPD1 "lipoamide dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0713 CHY_0713 "alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0340 SPO_0340 "2-oxoglutarate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0066 PF08_0066 "lipoamide dehydrogenase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IAZ6 PF08_0066 "Lipoamide dehydrogenase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0036762 CG7430 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4N7G5 MGG_17072 "Dihydrolipoyl dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2023782 mtLPD1 "mitochondrial lipoamide dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0005984 LPD1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.8.1.40.914
3rd Layer1.8.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033119001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (566 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00018534001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (973 aa)
•  •••• 0.977
GSVIVG00016525001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (434 aa)
••   •• 0.963
GSVIVG00010806001
SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (552 aa)
•••  •• 0.956
GSVIVG00027295001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (225 aa)
•    •• 0.953
GSVIVG00018004001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (334 aa)
•    •• 0.949
GSVIVG00006965001
SubName- Full=Chromosome chr1 scaffold_180, whole genome shotgun sequence; (334 aa)
•    •• 0.949
GSVIVG00033027001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (469 aa)
••   •• 0.948
GSVIVG00006034001
SubName- Full=Chromosome chr4 scaffold_162, whole genome shotgun sequence; (372 aa)
•    •• 0.947
GSVIVG00031806001
SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (428 aa)
•• • •• 0.947
GSVIVG00014349001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (385 aa)
•    •• 0.945

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 0.0
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-130
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 1e-128
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 1e-112
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-111
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 4e-96
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 1e-91
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 4e-87
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 1e-73
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 3e-73
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-71
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 1e-69
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 2e-69
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 4e-64
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 2e-59
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 4e-56
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-54
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 1e-50
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 3e-50
PLN02546558 PLN02546, PLN02546, glutathione reductase 3e-46
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 3e-45
PLN02507499 PLN02507, PLN02507, glutathione reductase 4e-45
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 3e-44
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 3e-44
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 3e-39
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 1e-37
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 1e-37
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 3e-37
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 4e-37
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 5e-33
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 3e-32
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 1e-31
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 7e-16
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 7e-16
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 1e-14
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 4e-13
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disu 1e-12
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 1e-11
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 9e-10
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 9e-08
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 1e-07
pfam01134391 pfam01134, GIDA, Glucose inhibited division protei 5e-07
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 2e-06
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperox 2e-05
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 2e-05
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 1e-04
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 2e-04
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 3e-04
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 3e-04
TIGR03364365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 4e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 5e-04
PRK12844557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog 5e-04
COG0578532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 5e-04
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 6e-04
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 6e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 8e-04
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate d 0.001
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydroge 0.001
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydroge 0.002
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 0.004
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 0.004
PRK12835 584 PRK12835, PRK12835, 3-ketosteroid-delta-1-dehydrog 0.004
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 0.004
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 0.004
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information 
 Score =  529 bits (1366), Expect = 0.0
 Identities = 180/412 (43%), Positives = 250/412 (60%), Gaps = 27/412 (6%)

Query: 99  SFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMR 158
           +F+YD+I+IGAG GG+ AA+ A + GLK AI+E + +GGTC+NRGC+PSKALL  + R  
Sbjct: 2   AFEYDVIVIGAGPGGYVAAIRAAQLGLKVAIVEKEKLGGTCLNRGCIPSKALLHAAERAD 61

Query: 159 ELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILG 218
           E +   H +  G++    G D + V +  N +  ++   +   +K   VDI+ G   ++ 
Sbjct: 62  EAR---HSEDFGIKAENVGIDFKKVQEWKNGVVNRLTGGVEGLLKKNKVDIIRGEAKLVD 118

Query: 219 PQKVKFGTDN---IVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIV 275
           P  V+  T++     TAK+II+ATGS P    GIE+DG+ + TSD AL L+ VP  + ++
Sbjct: 119 PNTVRVMTEDGEQTYTAKNIILATGSRPRELPGIEIDGRVIWTSDEALNLDEVPKSLVVI 178

Query: 276 GSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFAT 335
           G GYIG+EF+  Y +LG+EVT +EAL +++PG D EI KLA+R L   R I   TG  A 
Sbjct: 179 GGGYIGVEFASAYASLGAEVTIVEALPRILPGEDKEISKLAERALKK-RGIKIKTGAKAK 237

Query: 336 K-----DGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVTQRGFVP 390
           K     DG  VT+E         ++TLE D  L+A GR P T  LGLE + V T RGF+ 
Sbjct: 238 KVEQTDDGVTVTLE-----DGGKEETLEADYVLVAVGRRPNTENLGLEELGVKTDRGFIE 292

Query: 391 VDERMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHVLNHLSIPAA 450
           VDE++R        VP++Y IGD  G  MLAH ASA+GI   E + G  H +++  IPA 
Sbjct: 293 VDEQLRTN------VPNIYAIGDIVGGPMLAHKASAEGIIAAEAIAGNPHPIDYRGIPAV 346

Query: 451 CFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTKALAENEGEGLAK 502
            +THPE++ VGLTE +A+E    EGF+V V K  F  N KALA  E +G  K
Sbjct: 347 TYTHPEVASVGLTEAKAKE----EGFDVKVVKFPFAGNGKALALGETDGFVK 394

Length = 462
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|217252 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|213807 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|237221 PRK12835, PRK12835, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PLN02546558 glutathione reductase 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06370463 mercuric reductase; Validated 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PLN02507499 glutathione reductase 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
KOG4716503 consensus Thioredoxin reductase [Posttranslational 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.98
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.98
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK12814652 putative NADPH-dependent glutamate synthase small 99.97
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.97
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.97
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.96
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.96
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.96
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.96
PRK13984604 putative oxidoreductase; Provisional 99.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.96
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.95
PLN02852491 ferredoxin-NADP+ reductase 99.95
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.94
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.94
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.93
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.93
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.9
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.88
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.85
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.84
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.83
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.81
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.81
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.8
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.79
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.79
KOG2755334 consensus Oxidoreductase [General function predict 99.77
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.75
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.75
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.7
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.66
PTZ00188506 adrenodoxin reductase; Provisional 99.64
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 99.62
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.57
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.52
COG2081408 Predicted flavoproteins [General function predicti 99.39
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.35
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.32
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.22
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.22
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.21
PRK09897534 hypothetical protein; Provisional 99.2
PRK08401466 L-aspartate oxidase; Provisional 99.2
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.17
PRK08275554 putative oxidoreductase; Provisional 99.17
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.16
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.15
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.15
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.15
PRK12842 574 putative succinate dehydrogenase; Reviewed 99.14
PLN02815 594 L-aspartate oxidase 99.13
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.13
PRK07804541 L-aspartate oxidase; Provisional 99.13
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.12
PRK09077536 L-aspartate oxidase; Provisional 99.11
PRK06175433 L-aspartate oxidase; Provisional 99.1
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 99.08
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.08
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.08
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.07
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.07
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.06
PRK07395553 L-aspartate oxidase; Provisional 99.06
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.05
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.05
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.05
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.03
PRK08071510 L-aspartate oxidase; Provisional 99.0
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.99
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.97
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.96
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.94
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.93
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.9
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.9
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.84
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.83
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.83
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.83
PLN02463447 lycopene beta cyclase 98.82
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.81
PRK07512513 L-aspartate oxidase; Provisional 98.81
PRK10157428 putative oxidoreductase FixC; Provisional 98.77
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.74
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.71
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.7
PRK10015429 oxidoreductase; Provisional 98.68
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.67
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.66
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.66
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.66
PRK06847375 hypothetical protein; Provisional 98.64
PRK06834488 hypothetical protein; Provisional 98.63
PLN02697529 lycopene epsilon cyclase 98.62
PLN02661357 Putative thiazole synthesis 98.61
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.6
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.59
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.59
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.57
PRK07190487 hypothetical protein; Provisional 98.55
PRK11728393 hydroxyglutarate oxidase; Provisional 98.54
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.53
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.52
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.51
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.5
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.49
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.48
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.47
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.47
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.47
PRK06184502 hypothetical protein; Provisional 98.46
PRK07121492 hypothetical protein; Validated 98.46
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.45
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.44
PRK08274466 tricarballylate dehydrogenase; Validated 98.44
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.44
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.43
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.42
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.42
PRK09126392 hypothetical protein; Provisional 98.41
PRK08163396 salicylate hydroxylase; Provisional 98.41
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.4
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.38
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.38
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.37
PRK11445351 putative oxidoreductase; Provisional 98.36
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.36
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.35
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.35
PRK08013400 oxidoreductase; Provisional 98.34
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.33
PRK08244493 hypothetical protein; Provisional 98.31
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.31
PRK07045388 putative monooxygenase; Reviewed 98.3
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.3
PRK06185407 hypothetical protein; Provisional 98.29
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.28
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.28
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.28
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.28
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.27
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.27
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.26
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.25
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.24
PRK13512438 coenzyme A disulfide reductase; Provisional 98.24
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.24
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.23
PRK07236386 hypothetical protein; Provisional 98.22
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.21
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.21
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.2
PRK07588391 hypothetical protein; Provisional 98.2
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.18
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.16
PRK06126545 hypothetical protein; Provisional 98.16
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.16
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.15
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.14
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.14
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.14
PRK06996398 hypothetical protein; Provisional 98.14
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.12
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.12
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.1
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.09
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.09
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.08
COG0579429 Predicted dehydrogenase [General function predicti 98.08
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.06
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.06
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.06
PRK07208479 hypothetical protein; Provisional 98.05
PRK06753373 hypothetical protein; Provisional 98.05
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.05
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.05
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.02
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.01
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.01
PRK12839 572 hypothetical protein; Provisional 98.0
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.0
PRK06116450 glutathione reductase; Validated 97.99
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.99
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.99
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.98
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.97
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.97
TIGR02053463 MerA mercuric reductase. This model represents the 97.96
PRK06370463 mercuric reductase; Validated 97.96
PRK06475400 salicylate hydroxylase; Provisional 97.95
PRK05868372 hypothetical protein; Validated 97.95
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.94
PLN02507499 glutathione reductase 97.94
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.94
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.93
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.93
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.92
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.91
PRK14694468 putative mercuric reductase; Provisional 97.91
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.91
PLN02576496 protoporphyrinogen oxidase 97.9
PRK09564 444 coenzyme A disulfide reductase; Reviewed 97.89
PTZ00052499 thioredoxin reductase; Provisional 97.89
COG2081408 Predicted flavoproteins [General function predicti 97.89
PLN02268435 probable polyamine oxidase 97.88
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.87
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.87
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.87
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.86
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.86
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.85
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.85
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.84
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.84
PRK07846451 mycothione reductase; Reviewed 97.84
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.84
PRK07233434 hypothetical protein; Provisional 97.83
PLN02568539 polyamine oxidase 97.83
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.82
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.82
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.82
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.81
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.81
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.81
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.79
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.79
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.78
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.78
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.78
PRK06847375 hypothetical protein; Provisional 97.77
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.75
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.75
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.74
PRK14727479 putative mercuric reductase; Provisional 97.73
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.73
PRK13748561 putative mercuric reductase; Provisional 97.73
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.72
COG3349485 Uncharacterized conserved protein [Function unknow 97.71
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.71
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.71
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.7
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.7
PTZ00058561 glutathione reductase; Provisional 97.7
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.69
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.69
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.69
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.68
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.66
PRK12416463 protoporphyrinogen oxidase; Provisional 97.64
PLN02676487 polyamine oxidase 97.64
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.63
PLN02852 491 ferredoxin-NADP+ reductase 97.63
PLN02529 738 lysine-specific histone demethylase 1 97.63
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.62
PLN02546558 glutathione reductase 97.61
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.59
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.58
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.58
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.58
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.56
PRK12831464 putative oxidoreductase; Provisional 97.56
PRK07236386 hypothetical protein; Provisional 97.55
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.55
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.54
PRK10262321 thioredoxin reductase; Provisional 97.54
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.53
KOG2853509 consensus Possible oxidoreductase [General functio 97.53
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.51
PLN02985514 squalene monooxygenase 97.49
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.49
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.48
PRK13977576 myosin-cross-reactive antigen; Provisional 97.47
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.46
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.46
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.45
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.45
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.44
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.44
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.44
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.44
PLN02487569 zeta-carotene desaturase 97.44
PRK07538413 hypothetical protein; Provisional 97.44
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.43
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.43
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.43
PTZ00367567 squalene epoxidase; Provisional 97.42
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.42
PRK08294 634 phenol 2-monooxygenase; Provisional 97.41
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.41
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.39
PTZ00153659 lipoamide dehydrogenase; Provisional 97.39
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.38
PTZ00188 506 adrenodoxin reductase; Provisional 97.36
PRK06834 488 hypothetical protein; Provisional 97.35
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.33
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.31
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.31
PLN02612567 phytoene desaturase 97.3
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.29
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.27
PLN02661357 Putative thiazole synthesis 97.23
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.23
PRK08163 396 salicylate hydroxylase; Provisional 97.22
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.19
PLN03000 881 amine oxidase 97.19
PLN02976 1713 amine oxidase 97.15
PTZ00383497 malate:quinone oxidoreductase; Provisional 97.14
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.14
COG3573552 Predicted oxidoreductase [General function predict 97.12
PLN02463447 lycopene beta cyclase 97.12
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.11
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.11
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.1
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.1
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.09
PRK02106 560 choline dehydrogenase; Validated 97.08
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.07
PRK09126 392 hypothetical protein; Provisional 97.07
PRK05257494 malate:quinone oxidoreductase; Validated 97.05
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.05
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.05
PRK05868372 hypothetical protein; Validated 97.04
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.01
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.01
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.95
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.95
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.94
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.94
PRK06184 502 hypothetical protein; Provisional 96.94
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.93
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.93
PRK08244 493 hypothetical protein; Provisional 96.92
PRK13984604 putative oxidoreductase; Provisional 96.92
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.91
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.91
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 96.9
KOG1298509 consensus Squalene monooxygenase [Lipid transport 96.88
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 96.88
PRK07045 388 putative monooxygenase; Reviewed 96.86
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 96.85
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.85
PRK07588 391 hypothetical protein; Provisional 96.84
PRK06753373 hypothetical protein; Provisional 96.81
KOG2852380 consensus Possible oxidoreductase [General functio 96.8
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.8
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.79
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.78
PRK06475 400 salicylate hydroxylase; Provisional 96.76
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.75
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.73
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.72
PRK07190 487 hypothetical protein; Provisional 96.7
KOG2960328 consensus Protein involved in thiamine biosynthesi 96.7
PRK10157 428 putative oxidoreductase FixC; Provisional 96.67
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 96.62
PRK08013 400 oxidoreductase; Provisional 96.6
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.59
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.57
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.56
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.51
PRK06126 545 hypothetical protein; Provisional 96.5
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.5
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.49
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.43
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 96.42
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.4
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.39
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.38
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.35
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.32
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.32
PLN02785587 Protein HOTHEAD 96.25
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 96.24
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.23
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.19
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.17
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.14
PRK09897 534 hypothetical protein; Provisional 96.11
PLN02697 529 lycopene epsilon cyclase 96.11
TIGR00275 400 flavoprotein, HI0933 family. The model when search 96.06
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.06
PRK07538 413 hypothetical protein; Provisional 96.01
PRK10015 429 oxidoreductase; Provisional 95.94
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.92
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 95.91
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.9
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.89
KOG0404322 consensus Thioredoxin reductase [Posttranslational 95.85
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 95.84
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 95.82
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 95.79
PRK06185 407 hypothetical protein; Provisional 95.76
PRK06996398 hypothetical protein; Provisional 95.74
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 95.71
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 95.59
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.43
PLN02985 514 squalene monooxygenase 95.38
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.38
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 95.36
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.33
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 95.31
PRK11445351 putative oxidoreductase; Provisional 95.26
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 95.25
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.13
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 95.0
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.94
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 94.81
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 94.45
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.39
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 94.37
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 94.34
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 94.26
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 94.26
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 94.18
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 94.05
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.04
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.99
KOG2755334 consensus Oxidoreductase [General function predict 93.92
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.84
COG3349 485 Uncharacterized conserved protein [Function unknow 93.76
PRK11883 451 protoporphyrinogen oxidase; Reviewed 93.62
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 93.6
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.58
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.5
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.49
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 93.44
PRK08274466 tricarballylate dehydrogenase; Validated 93.41
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 93.36
PLN02268 435 probable polyamine oxidase 93.21
PRK07233 434 hypothetical protein; Provisional 93.16
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 93.09
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.09
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.05
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.0
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 92.85
PRK06719157 precorrin-2 dehydrogenase; Validated 92.75
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 92.69
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 92.67
PRK06719157 precorrin-2 dehydrogenase; Validated 92.66
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-76  Score=602.49  Aligned_cols=418  Identities=38%  Similarity=0.603  Sum_probs=381.2

Q ss_pred             CCcccEEEECCChHHHHHHHHHHHcCCcEEEeeCC-ccCcccccCCccCChhhHhhHHHHHHHHhhhhhhhcCccccccc
Q 008850           99 SFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGD-VVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAG  177 (551)
Q Consensus        99 ~~~~dVvIIGgG~AGl~aA~~l~~~g~~V~liE~~-~~GG~~~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~  177 (551)
                      +.+||+||||+||||..||.+++++|.+|++||+. .+||+|+|+||+|+|.+++.+..++.......  .+|+......
T Consensus         2 ~~~yDvvVIG~GpaG~~aA~raa~~G~kvalvE~~~~lGGtCln~GCIPsK~Ll~~a~~~~~~~~~~~--~~Gi~~~~~~   79 (454)
T COG1249           2 MKEYDVVVIGAGPAGYVAAIRAAQLGLKVALVEKGERLGGTCLNVGCIPSKALLHAAEVIEEARHAAK--EYGISAEVPK   79 (454)
T ss_pred             CccccEEEECCCHHHHHHHHHHHhCCCCEEEEeecCCcCceEEeeCccccHHHHHHHHHHHHHhhccc--ccceecCCCC
Confidence            35699999999999999999999999999999996 89999999999999999999988766543222  6888877778


Q ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHHHcCeEEEeceEEEeCCcEEEeCc--ceEEEeCeEEEeCCCCCCCCCCccCCCce
Q 008850          178 YDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFGT--DNIVTAKDIIIATGSVPFVPKGIEVDGKT  255 (551)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~v~~~~--g~~i~~d~lVlAtG~~p~~p~~~~~~~~~  255 (551)
                      +++.++.++.+.....+.......++..+|+++.|++.+.++++|.+.+  .++++++++|||||++|..|+++++++..
T Consensus        80 id~~~~~~~k~~v~~~~~~~~~~l~~~~~V~vi~G~a~f~~~~~v~V~~~~~~~~~a~~iiIATGS~p~~~~~~~~~~~~  159 (454)
T COG1249          80 IDFEKLLARKDKVVRLLTGGVEGLLKKNGVDVIRGEARFVDPHTVEVTGEDKETITADNIIIATGSRPRIPPGPGIDGAR  159 (454)
T ss_pred             cCHHHHHHHHHHHHHHHhhhHHHHHhhCCCEEEEEEEEECCCCEEEEcCCCceEEEeCEEEEcCCCCCcCCCCCCCCCCe
Confidence            9999999999998788888888888999999999999999999999876  47899999999999999999999999998


Q ss_pred             eecchhhhccccCCceEEEECCChhHHHHHHHHHhCCCeEEEEcccCcCCCCCCHHHHHHHHHHHhCCCceEEEeceEEE
Q 008850          256 VITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFAT  335 (551)
Q Consensus       256 v~~~~~~~~~~~~~k~v~VvG~G~~g~e~A~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~~~l~~~~gi~~~~~~~~~  335 (551)
                      ++++++.+.+.+.|++++|||||++|+|+|..++++|.+||++++.++++|.+|+++++.+.+.|++ .|+++++++.+.
T Consensus       160 ~~~s~~~l~~~~lP~~lvIiGgG~IGlE~a~~~~~LG~~VTiie~~~~iLp~~D~ei~~~~~~~l~~-~gv~i~~~~~v~  238 (454)
T COG1249         160 ILDSSDALFLLELPKSLVIVGGGYIGLEFASVFAALGSKVTVVERGDRILPGEDPEISKELTKQLEK-GGVKILLNTKVT  238 (454)
T ss_pred             EEechhhcccccCCCEEEEECCCHHHHHHHHHHHHcCCcEEEEecCCCCCCcCCHHHHHHHHHHHHh-CCeEEEccceEE
Confidence            9999887777799999999999999999999999999999999999999999999999999999997 899999999887


Q ss_pred             ---eCCCcEEEEEecccCCCCCeEEecCEEEEeecCCCCCCCCCCccccccc-CCCceeeCCCCccccCCCCCCCcEEEe
Q 008850          336 ---KDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVT-QRGFVPVDERMRVIDANGNLVPHLYCI  411 (551)
Q Consensus       336 ---~~~~~~~v~~~~g~~~~~~~~i~~D~vi~a~G~~p~~~~l~l~~~~l~~-~~G~i~Vd~~~~~~~~~~t~~~~IyA~  411 (551)
                         ..++.+.++++++..    .++++|.|++|+|++||++.|++++.|++. ++|+|.||+.++      |++|||||+
T Consensus       239 ~~~~~~~~v~v~~~~g~~----~~~~ad~vLvAiGR~Pn~~~LgLe~~Gv~~~~rg~I~VD~~~~------Tnvp~IyA~  308 (454)
T COG1249         239 AVEKKDDGVLVTLEDGEG----GTIEADAVLVAIGRKPNTDGLGLENAGVELDDRGFIKVDDQMT------TNVPGIYAI  308 (454)
T ss_pred             EEEecCCeEEEEEecCCC----CEEEeeEEEEccCCccCCCCCChhhcCceECCCCCEEeCCccc------cCCCCEEEe
Confidence               333337788877621    278999999999999999999999999998 669999996666      889999999


Q ss_pred             cCCCCCCCcHHHHHHHHHHHHHHHcC-CCccCCCCCcceEEEcCCCeeEecCCHHHHHhhchhcCCeEEEEEEecccchh
Q 008850          412 GDANGKMMLAHAASAQGISVVEQVTG-RDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSVAKTSFKANTK  490 (551)
Q Consensus       412 GD~~~~~~~~~~A~~~g~~aa~~i~g-~~~~~~~~~~p~~~~~~~~~~~vG~~e~~a~~~~~~~~~~~~~~~~~~~~~~~  490 (551)
                      |||++.+++++.|.+||++|++||+| .....+|..+|+++|++||+++||+||+||+++    +++|++.+.+|..+.|
T Consensus       309 GDV~~~~~Lah~A~~eg~iaa~~i~g~~~~~~d~~~iP~~ift~Peia~VGlte~ea~~~----g~~~~~~~~~f~~~~r  384 (454)
T COG1249         309 GDVIGGPMLAHVAMAEGRIAAENIAGGKRTPIDYRLIPSVVFTDPEIASVGLTEEEAKEA----GIDYKVGKFPFAANGR  384 (454)
T ss_pred             eccCCCcccHhHHHHHHHHHHHHHhCCCCCcCcccCCCEEEECCCcceeeeCCHHHHHhc----CCceEEEEeecccchh
Confidence            99999999999999999999999997 555678999999999999999999999999986    8899999999999999


Q ss_pred             hhhcCCCceEEEEEEeCCCCCCcceeeeeCCChhHHHHHHHHHh
Q 008850          491 ALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVY  534 (551)
Q Consensus       491 ~~~~~~~~~~~kli~~~~~~~~~lg~~~~g~~~~~~i~~l~~~~  534 (551)
                      +...++++||+||++|++ ++++||+|++|+.|.|+|+.++..-
T Consensus       385 a~~~~~~~G~~Klv~d~~-t~~IlGahivg~~A~ElI~~~~~a~  427 (454)
T COG1249         385 AITMGETDGFVKLVVDKE-TGRILGAHIVGPGASELINEIALAI  427 (454)
T ss_pred             HHhccCCceEEEEEEECC-CCeEEEEEEECCCHHHHHHHHHHHH
Confidence            999999999999999998 9999999999999999999996543

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 7e-53
3lad_A476 Refined Crystal Structure Of Lipoamide Dehydrogenas 1e-48
1lpf_A477 Three-Dimensional Structure Of Lipoamide Dehydrogen 2e-48
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 3e-47
2eq6_A464 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-46
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 7e-45
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 2e-43
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 2e-43
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 2e-43
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 3e-43
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 3e-42
1jeh_A478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 1e-40
2qae_A468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 2e-40
1ojt_A482 Structure Of Dihydrolipoamide Dehydrogenase Length 2e-39
1bhy_A482 Low Temperature Middle Resolution Structure Of P64k 2e-39
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 1e-35
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 3e-33
1ger_A450 The Structure Of Glutathione Reductase From Escheri 8e-32
3ii4_A466 Structure Of Mycobacterial Lipoamide Dehydrogenase 7e-30
3djg_X477 Catalytic Cycle Of Human Glutathione Reductase Near 3e-28
1bwc_A478 Structure Of Human Glutathione Reductase Complexed 3e-28
2aaq_A479 Crystal Structure Analysis Of The Human Glutahione 3e-28
1xan_A461 Human Glutathione Reductase In Complex With A Xanth 4e-28
1k4q_A463 Human Glutathione Reductase Inactivated By Peroxyni 4e-28
1grt_A478 Human Glutathione Reductase A34eR37W MUTANT Length 4e-28
2a8x_A464 Crystal Structure Of Lipoamide Dehydrogenase From M 5e-28
2grt_A461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 5e-28
1grg_A478 Substrate Binding And Catalysis By Glutathione Redu 7e-27
1dnc_A478 Human Glutathione Reductase Modified By Diglutathio 7e-27
1gsn_A478 Human Glutathione Reductase Modified By Dinitrosogl 1e-26
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 1e-26
1xdi_A499 Crystal Structure Of Lpda (Rv3303c) From Mycobacter 3e-26
3o0h_A484 Crystal Structure Of Glutathione Reductase From Bar 5e-26
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 7e-25
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 8e-25
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 6e-24
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 4e-23
3ic9_A492 The Structure Of Dihydrolipoamide Dehydrogenase Fro 2e-22
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 3e-21
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 3e-21
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 3e-21
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 3e-21
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 5e-21
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 5e-21
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 5e-21
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 5e-21
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 6e-21
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 9e-21
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 1e-20
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 1e-20
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 5e-20
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 1e-19
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 1e-19
2tpr_A490 X-ray Structure Of Trypanothione Reductase From Cri 2e-19
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 2e-19
1fea_A490 Unliganded Crithidia Fasciculata Trypanothione Redu 3e-19
1tyt_A487 Crystal And Molecular Structure Of Crithidia Fascic 7e-19
1typ_A487 Substrate Interactions Between Trypanothione Reduct 9e-19
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 3e-18
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-18
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-18
3h4k_A598 Crystal Structure Of The Wild Type Thioredoxin Glut 3e-17
2x8c_A598 Thioredoxin Glutathione Reductase From Schistosoma 3e-17
2v6o_A596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 3e-17
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 9e-17
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 5e-07
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 6e-07
2bc0_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 1e-06
2bc1_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 2e-06
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 3e-05
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 8e-05
1mo9_A523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 2e-04
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 8e-04
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 8e-04
1nhs_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 8e-04
1nhp_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 8e-04
1joa_A447 Nadh Peroxidase With Cysteine-Sulfenic Acid Length 9e-04
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure 
Iteration: 1

 Score =  204 bits (520), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 140/386 (36%), Positives = 202/386 (52%), Gaps = 29/386 (7%)
Query: 124 GLKTAIIEGD-VVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYDRQG 182
           G+K  ++E +  +GGTC+  GC+PSKALL  + R+ E +       LG +V     D   
Sbjct: 24  GMKVGVVEKEKALGGTCLRVGCIPSKALLETTERIYEAKK----GLLGAKVKGVELDLPA 79
Query: 183 VADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKFG-TDNIVTAKDIIIATGS 241
           +  H + +       +    K  G+    G    L  +KV    T   + A+ I+IATGS
Sbjct: 80  LMAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSERKVLVEETGEELEARYILIATGS 139
Query: 242 VPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEAL 301
            P +P   +VD + V+TS  AL    VP  + +VG G IGLE   V+  LG+EV  +E +
Sbjct: 140 APLIPPWAQVDYERVVTSTEALSFPEVPKRLIVVGGGVIGLELGVVWHRLGAEVIVLEYM 199
Query: 302 DQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATK---DGKPVTIELIDAKTKEPKDTLE 358
           D+++P  D E+ + A+RV    + +   TGV  T    + K   +EL      E  + LE
Sbjct: 200 DRILPTMDLEVSRAAERVF-KKQGLTIRTGVRVTAVVPEAKGARVEL------EGGEVLE 252
Query: 359 VDAALIATGRAPFTNGLGLENINVVT-QRGFVPVDERMRVIDANGNLVPHLYCIGDANGK 417
            D  L+A GR P+T GL LEN  + T +RG +PVDE +R        VPH+Y IGD    
Sbjct: 253 ADRVLVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLR------TRVPHIYAIGDVVRG 306
Query: 418 MMLAHAASAQGISVVEQ-VTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGF 476
            MLAH AS +GI+ VE  V G  HV ++ +IP+  +THPEI+ VG TE    E+ + +G 
Sbjct: 307 PMLAHKASEEGIAAVEHMVRGFGHV-DYQAIPSVVYTHPEIAAVGYTE----EELKAQGI 361
Query: 477 EVSVAKTSFKANTKALAENEGEGLAK 502
              V K  + A+ +A A  E EG  K
Sbjct: 362 PYKVGKFPYSASGRARAMGETEGFIK 387
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|1OJT|A Chain A, Structure Of Dihydrolipoamide Dehydrogenase Length = 482 Back     alignment and structure
>pdb|1BHY|A Chain A, Low Temperature Middle Resolution Structure Of P64k From Masc Data Length = 482 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|3II4|A Chain A, Structure Of Mycobacterial Lipoamide Dehydrogenase Bound To A Triazaspirodimethoxybenzoyl Inhibitor Length = 466 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|2A8X|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Mycobacterium Tuberculosis Length = 464 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|1XDI|A Chain A, Crystal Structure Of Lpda (Rv3303c) From Mycobacterium Tuberculosis Length = 499 Back     alignment and structure
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From Colwellia Psychrerythraea 34h. Length = 492 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|2BC0|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: Wild-Type Nox Length = 490 Back     alignment and structure
>pdb|2BC1|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: C44s Nox Length = 490 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHS|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHP|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1JOA|A Chain A, Nadh Peroxidase With Cysteine-Sulfenic Acid Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-129
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-127
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 1e-126
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 1e-124
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 1e-124
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 1e-122
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 1e-121
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 1e-121
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 1e-121
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 1e-120
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 1e-119
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 1e-119
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 1e-118
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 1e-117
1ojt_A482 Surface protein; redox-active center, glycolysis, 1e-116
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-115
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-109
4dna_A463 Probable glutathione reductase; structural genomic 1e-107
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 1e-107
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 1e-106
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 1e-106
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 1e-106
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-103
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 1e-103
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 5e-98
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 7e-96
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 6e-95
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 2e-93
1fec_A490 Trypanothione reductase; redox-active center, oxid 7e-93
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 7e-90
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 2e-27
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-27
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-26
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 2e-25
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 2e-25
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 6e-25
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 7e-25
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 2e-24
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 4e-24
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 1e-22
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 6e-17
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 8e-15
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-14
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 3e-14
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 3e-14
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 6e-14
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 6e-14
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 8e-13
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 8e-13
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 1e-12
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 2e-12
4fk1_A304 Putative thioredoxin reductase; structural genomic 4e-12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 3e-11
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 3e-11
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 4e-11
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 5e-11
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 5e-11
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 3e-10
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 3e-10
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 2e-09
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 9e-08
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 1e-07
2ywl_A180 Thioredoxin reductase related protein; uncharacter 2e-06
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 4e-06
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 4e-06
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 5e-06
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 1e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 1e-05
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 2e-05
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 3e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 3e-05
3atr_A453 Conserved archaeal protein; saturating double bond 3e-05
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 5e-05
3r9u_A315 Thioredoxin reductase; structural genomics, center 5e-05
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 6e-05
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 6e-05
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 7e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 8e-05
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 1e-04
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 1e-04
2gqf_A401 Hypothetical protein HI0933; structural genomics, 2e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 2e-04
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 2e-04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 3e-04
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 3e-04
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 3e-04
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 4e-04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 4e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 5e-04
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 5e-04
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 6e-04
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 7e-04
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 9e-04
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
 Score =  385 bits (991), Expect = e-129
 Identities = 101/412 (24%), Positives = 168/412 (40%), Gaps = 18/412 (4%)

Query: 98  KSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRM 157
           K  + D+ IIG G  G GA   A +   K  +IEG   G TC   GC+PSK L+A +   
Sbjct: 5   KVINVDVAIIGTGTAGMGAYRAAKKHTDKVVLIEGGAYGTTCARVGCMPSKLLIAAADAS 64

Query: 158 RELQSEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNS-MKALGVDILTGVGTI 216
                       G+QV     + + V         +    +  S       D + G    
Sbjct: 65  YHA---SQTDLFGIQVDRISVNGKAVMKRIQTERDRFVGFVVESVESFDEQDKIRGFAKF 121

Query: 217 LGPQKVKFGTDNIVTAKDIIIATGSVPFVPKGIEVDGKTVITSDHALKLEFVPDWIAIVG 276
           L    ++    + V AK I+IATGS P  P+ +   G  ++T+D+  +L  +P  +A+ G
Sbjct: 122 LDEHTLQVDDHSQVIAKRIVIATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFG 181

Query: 277 SGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVF-AT 335
            G IGLE     + LG  V        +    D E+ + A++        D    V    
Sbjct: 182 PGVIGLELGQALSRLGVIVKVFGRSGSVANLQDEEMKRYAEKTFNEEFYFDAKARVISTI 241

Query: 336 KDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINV-VTQRGFVPVDE- 393
           +    V +   D   ++   T      L ATGR    + LGLEN ++ + ++     DE 
Sbjct: 242 EKEDAVEVIYFDKSGQK--TTESFQYVLAATGRKANVDKLGLENTSIELDKKNSPLFDEL 299

Query: 394 RMRVIDANGNLVPHLYCIGDANGKMMLAHAASAQGISVVEQVTGRDHV--LNHLSIPAAC 451
            ++    +   V H++  GDAN  + L H A+  G            +      +  +  
Sbjct: 300 TLQ---TS---VDHIFVAGDANNTLTLLHEAADDGKVAGTNAGAYPVIAQGQRRAPLSVV 353

Query: 452 FTHPEISMVGLTEPQARE-KAEKEGFEVSVAKTSFKANTKALAENEGEGLAK 502
           FT P+++ VGL+  Q  +  A+++     V + SF+   ++    + +GL  
Sbjct: 354 FTEPQVASVGLSLRQIEDLYADQDAANYVVGQVSFEGQGRSRVMGKNKGLLN 405
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Length = 501 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Length = 561 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Length = 571 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.98
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.98
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.97
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.97
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.97
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.97
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.97
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.94
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.94
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.94
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.93
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.86
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.83
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.83
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.74
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.73
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.57
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.46
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.43
2cul_A232 Glucose-inhibited division protein A-related PROT 99.42
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.22
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.2
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.15
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.13
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.1
2cul_A232 Glucose-inhibited division protein A-related PROT 99.06
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.0
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.99
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.95
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.89
3dme_A369 Conserved exported protein; structural genomics, P 98.87
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.86
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.86
2bry_A497 NEDD9 interacting protein with calponin homology a 98.81
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.8
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.8
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.78
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.78
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.77
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.72
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.7
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.69
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.69
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.67
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.66
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.65
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.65
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.65
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.64
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.63
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.63
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.62
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.61
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.61
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.61
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.61
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.59
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.59
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.58
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.58
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.58
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.58
3atr_A453 Conserved archaeal protein; saturating double bond 98.54
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.54
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.54
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.53
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.52
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.52
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.51
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.51
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.51
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.5
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.48
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.48
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.45
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.45
2bry_A497 NEDD9 interacting protein with calponin homology a 98.43
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.43
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.41
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.39
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.39
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.37
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.35
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.34
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.32
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.31
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.29
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.29
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.26
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.25
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.25
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.23
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.2
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.2
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.19
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.19
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.18
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.17
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.16
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.16
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.15
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.15
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.15
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.15
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.14
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.13
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.13
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.13
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.13
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.12
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.12
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.12
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.11
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.1
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.09
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.09
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.09
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.07
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.07
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.06
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.06
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.05
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.05
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.04
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.04
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.03
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.03
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.03
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.03
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.01
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.01
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.01
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.99
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.99
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.98
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.98
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.97
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.97
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.96
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.95
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.94
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.94
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.93
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.93
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.93
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.93
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.92
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.92
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.91
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.91
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 97.91
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.9
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.9
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.9
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.89
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.89
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.89
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.88
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.88
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.88
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.88
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.88
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.87
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.87
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.87
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.86
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.85
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.84
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.84
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 97.84
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.84
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.84
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.83
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.83
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.83
4dna_A463 Probable glutathione reductase; structural genomic 97.82
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.81
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.79
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.79
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.78
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.78
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.77
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.76
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.75
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.74
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.74
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.74
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.73
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.72
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.71
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.71
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.71
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.7
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.68
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.68
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.68
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.68
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.65
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.65
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.64
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.62
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.57
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.57
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.57
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.52
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.5
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.49
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.49
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.49
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.46
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.46
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.42
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.41
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.41
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.35
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.33
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.3
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.3
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.3
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.27
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.25
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.25
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.25
3atr_A 453 Conserved archaeal protein; saturating double bond 97.24
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.24
3dme_A369 Conserved exported protein; structural genomics, P 97.19
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 97.19
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.18
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 97.15
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.15
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.14
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.14
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.12
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.12
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.09
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.09
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 97.05
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.05
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.04
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.04
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.03
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.02
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 97.01
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.01
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.98
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.95
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.94
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.94
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.93
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.93
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.91
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 96.9
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.89
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.81
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.75
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.72
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.68
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 96.65
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.63
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.63
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.6
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 96.57
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 96.52
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 96.51
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.5
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.47
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.41
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.38
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.3
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.23
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.18
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.13
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.11
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.1
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 96.08
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 96.07
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 96.03
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.9
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.9
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 95.63
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 95.44
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.4
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.35
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.27
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.18
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 94.88
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.83
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 94.72
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 94.63
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.6
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.49
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.33
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.14
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 94.08
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.02
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.95
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 93.76
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.72
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.46
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 93.36
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 93.36
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.21
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 93.2
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 93.17
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 93.13
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 93.08
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.05
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.01
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 92.77
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 92.67
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 92.59
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 92.52
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.41
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 92.38
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 92.31
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.21
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 92.17
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.04
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 92.03
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 91.89
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 91.7
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 91.68
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.54
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 91.52
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.41
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 91.37
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.28
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.21
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 91.04
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 91.03
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.95
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 90.94
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 90.85
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 90.82
1lss_A140 TRK system potassium uptake protein TRKA homolog; 90.73
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 90.7
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 90.6
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 90.54
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 90.46
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.43
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 90.27
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 90.04
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 90.03
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 89.97
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.79
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 89.76
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 89.68
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 89.62
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 89.57
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 89.38
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 89.1
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 89.08
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 89.02
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 88.98
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 88.91
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.89
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 88.87
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 88.83
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 88.62
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 88.21
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 88.15
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.15
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 88.12
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 88.07
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 87.93
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 87.9
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 87.79
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 87.77
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.58
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 87.58
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.56
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.49
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 87.41
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 87.25
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 87.24
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 87.22
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 87.17
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 87.07
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 87.05
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.91
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 86.84
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 86.72
3tl2_A315 Malate dehydrogenase; center for structural genomi 86.66
3qha_A296 Putative oxidoreductase; seattle structural genomi 86.54
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 86.49
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 86.35
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 86.24
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 86.15
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 86.13
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.06
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 85.97
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 85.91
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 85.79
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 85.72
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 85.65
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 85.63
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 85.5
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 85.31
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 85.28
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 85.27
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 85.25
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 84.82
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 84.8
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 84.62
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.59
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 84.53
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 84.47
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 84.47
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 84.37
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.36
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.26
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 84.17
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 84.08
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 84.05
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 84.0
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=2e-68  Score=567.23  Aligned_cols=419  Identities=24%  Similarity=0.354  Sum_probs=351.6

Q ss_pred             CCcccEEEECCChHHHHHHHHHHHcCCcEEEeeC---------CccCcccccCCccCChhhHhhHHHHHHHHhhhhhhhc
Q 008850           99 SFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEG---------DVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKAL  169 (551)
Q Consensus        99 ~~~~dVvIIGgG~AGl~aA~~l~~~g~~V~liE~---------~~~GG~~~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~  169 (551)
                      ..+|||+||||||||+.||.+++++|.+|+|||+         ..+||+|+|+||+|+|.|+..+...+.+.  .....+
T Consensus        40 ~ydYDviVIG~GpaG~~aA~~aa~~G~kValIE~~~~~~~~~k~~lGGtCln~GCIPsK~L~~aa~~~~~~~--~~~~~~  117 (542)
T 4b1b_A           40 TYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFK--LDSKAY  117 (542)
T ss_dssp             CSSEEEEEECCSHHHHHHHHHHHTTTCCEEEECCCCCCTTCCCCCSSHHHHHHSHHHHHHHHHHHHHHHHHH--HTGGGG
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCeEEEEeccccccccccCCCCCcccccchHHHHHHHHHHHHHHHHH--hhhHhc
Confidence            3469999999999999999999999999999995         34899999999999999998887665543  134568


Q ss_pred             CccccccccCHHHHHHHHHHHHHHHHHHHHHHHHHcCeEEEeceEEEeCCcEEEe------CcceEEEeCeEEEeCCCCC
Q 008850          170 GLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKF------GTDNIVTAKDIIIATGSVP  243 (551)
Q Consensus       170 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~v~~------~~g~~i~~d~lVlAtG~~p  243 (551)
                      |+......++|..+.++.+..++++...+...++..+|+++.+.+.+.+.+++.+      .+++++++|++|||||++|
T Consensus       118 Gi~~~~~~~d~~~~~~~~~~~v~~l~~~~~~~l~~~~V~~i~G~a~f~~~~~v~V~~~~~~~~~~~i~a~~iiIATGs~P  197 (542)
T 4b1b_A          118 GWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRP  197 (542)
T ss_dssp             TEEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEECEEEEEEETTEEEEEEC--CCCEEEEEEEEEEECCCEEE
T ss_pred             CcccCcccccHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEEeeeEEEcCCCcceEeecccCCceEEEeeeeEEeccCCCC
Confidence            8887777889999999999999999888888899999999999999999988865      2346799999999999999


Q ss_pred             CCCCCccCCCceeecchhhhccccCCceEEEECCChhHHHHHHHHHhCCCeEEEEcccCcCCCCCCHHHHHHHHHHHhCC
Q 008850          244 FVPKGIEVDGKTVITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINP  323 (551)
Q Consensus       244 ~~p~~~~~~~~~v~~~~~~~~~~~~~k~v~VvG~G~~g~e~A~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~~~l~~~  323 (551)
                      .+|+..+..+..++++++++.+++.|++++|||+|++|+|+|..|+++|.+||++.+ +++++.+|+++++.+.+.+++ 
T Consensus       198 ~~P~~~~~~~~~~~ts~~~l~l~~lP~~lvIIGgG~IGlE~A~~~~~lG~~VTii~~-~~~L~~~D~ei~~~l~~~l~~-  275 (542)
T 4b1b_A          198 HIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVR-SIVLRGFDQQCAVKVKLYMEE-  275 (542)
T ss_dssp             CCCSSSBTHHHHCBCHHHHTTCSSCCCSEEEECCSHHHHHHHHHHHHHTCCEEEEES-SCSSTTSCHHHHHHHHHHHHH-
T ss_pred             CCCCcccCCCccccCchhhhccccCCceEEEECCCHHHHHHHHHHHhcCCeEEEecc-cccccccchhHHHHHHHHHHh-
Confidence            999877766677899999999999999999999999999999999999999999986 578899999999999999987 


Q ss_pred             CceEEEeceEEE---eCCCcEEEEEecccCCCCCeEEecCEEEEeecCCCCCCCCCCccccccc-C-CCceeeCCCCccc
Q 008850          324 RKIDYHTGVFAT---KDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVT-Q-RGFVPVDERMRVI  398 (551)
Q Consensus       324 ~gi~~~~~~~~~---~~~~~~~v~~~~g~~~~~~~~i~~D~vi~a~G~~p~~~~l~l~~~~l~~-~-~G~i~Vd~~~~~~  398 (551)
                      .||+++++..+.   ..++.+.+++.++      .++.+|.|++|+|++||++.|+++..++.. . ++.|.||+++|  
T Consensus       276 ~gi~~~~~~~v~~~~~~~~~~~v~~~~~------~~~~~D~vLvAvGR~Pnt~~L~le~~gv~~~~~~~~i~vd~~~~--  347 (542)
T 4b1b_A          276 QGVMFKNGILPKKLTKMDDKILVEFSDK------TSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSC--  347 (542)
T ss_dssp             TTCEEEETCCEEEEEEETTEEEEEETTS------CEEEESEEEECSCEEESCGGGCGGGTTCCEETTTTEECCCTTSB--
T ss_pred             hcceeecceEEEEEEecCCeEEEEEcCC------CeEEEEEEEEcccccCCccccCcccceeeecccCceEecccccc--
Confidence            899999998776   4556677777654      578899999999999999999999888876 3 44468899999  


Q ss_pred             cCCCCCCCcEEEecCCCCC-CCcHHHHHHHHHHHHHHHcCCC-ccCCCCCcceEEEcCCCeeEecCCHHHHHhhchhcCC
Q 008850          399 DANGNLVPHLYCIGDANGK-MMLAHAASAQGISVVEQVTGRD-HVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGF  476 (551)
Q Consensus       399 ~~~~t~~~~IyA~GD~~~~-~~~~~~A~~~g~~aa~~i~g~~-~~~~~~~~p~~~~~~~~~~~vG~~e~~a~~~~~~~~~  476 (551)
                          |++|||||+|||++. |++++.|.+||+++++||+|.. ...+|..+|+++|++|++++||+||+||++++.+.+ 
T Consensus       348 ----Ts~p~IyAiGDv~~~~p~La~~A~~eg~~aa~~i~g~~~~~~d~~~iP~~vft~PeiA~VGlTE~eA~~~g~~~~-  422 (542)
T 4b1b_A          348 ----TNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSN-  422 (542)
T ss_dssp             ----CSSTTEEECTTSBTTCCCCHHHHHHHHHHHHHHHHSCCCCCCCCSSCCEEECSSSCEEEEECCHHHHHHHHCTTT-
T ss_pred             ----ccCCCeEEeccccCCchhHHHHHHHHHHHHHHHHhcCCCcccCCCCCceEEeCCCCeEEEeCCHHHHHHhCCCCc-
Confidence                899999999999965 6899999999999999999865 457899999999999999999999999998744333 


Q ss_pred             eEEEEEEecccchh---------------hhhcCCCceEEEEEEeCCCCCCcceeeeeCCChhHHHHHHHHHhh
Q 008850          477 EVSVAKTSFKANTK---------------ALAENEGEGLAKGVPRNFASSERTNQHSDRPSKPNLVKKLADVYM  535 (551)
Q Consensus       477 ~~~~~~~~~~~~~~---------------~~~~~~~~~~~kli~~~~~~~~~lg~~~~g~~~~~~i~~l~~~~~  535 (551)
                       +.++...|.....               ......++||+|||+++..+++|||+|++|++|.|+|+.++..-.
T Consensus       423 -v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~vKli~~~~~t~~ILGa~ivG~~A~ElI~~~alAi~  495 (542)
T 4b1b_A          423 -VEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALR  495 (542)
T ss_dssp             -EEEEEC-----------------------------CCCEEEEEETTTTTBEEEEEEESTTHHHHHHHHHHHHH
T ss_pred             -EEEEEeeccchhhhhhhhhhhhhcccccccccCCCceEEEEEEEeCCCCEEEEEEEECCCHHHHHHHHHHHHH
Confidence             3333333322211               123356789999997544389999999999999999998876543
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 3e-29
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 6e-09
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 1e-23
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 9e-08
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 4e-21
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 2e-15
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 4e-21
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 9e-21
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 5e-18
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 5e-20
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 1e-17
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 2e-19
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-19
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 4e-19
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-19
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 6e-12
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 2e-18
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 4e-18
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 6e-18
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-17
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 8e-13
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 9e-17
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-12
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 1e-16
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-16
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-13
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 3e-16
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-15
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 9e-11
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 5e-15
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 8e-15
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 1e-14
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 6e-13
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 1e-07
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 2e-12
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 2e-12
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 6e-12
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 4e-10
d1dxla3123 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenas 9e-12
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 3e-11
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 6e-11
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 1e-10
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 5e-06
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 3e-10
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 5e-10
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-09
d3lada3124 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenas 3e-09
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 4e-09
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 6e-09
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 8e-09
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-08
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 2e-08
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-08
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 2e-08
d1v59a3123 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenas 4e-08
d1mo9a3140 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl c 1e-07
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 3e-07
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 5e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 7e-07
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 9e-07
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 1e-06
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 1e-06
d1onfa3119 d.87.1.1 (A:377-495) Glutathione reductase {Plasmo 1e-06
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 1e-06
d1xdia2118 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenas 2e-06
d1gesa3115 d.87.1.1 (A:336-450) Glutathione reductase {Escher 2e-06
d1ojta3128 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenas 2e-06
d1h6va3133 d.87.1.1 (A:367-499) Mammalian thioredoxin reducta 3e-06
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 4e-06
d1ebda3115 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenas 4e-06
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 4e-06
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 5e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 6e-06
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 6e-06
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 7e-06
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 8e-06
d3grsa3115 d.87.1.1 (A:364-478) Glutathione reductase {Human 9e-06
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 9e-06
d1feca3128 d.87.1.1 (A:358-485) Trypanothione reductase {Crit 9e-06
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 1e-05
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-05
d1lvla3123 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenas 2e-05
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 4e-05
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 6e-05
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 6e-05
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 7e-05
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-04
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-04
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 1e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-04
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-04
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 2e-04
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 3e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 4e-04
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 7e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 0.001
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Glutathione reductase
species: Escherichia coli [TaxId: 562]

 Score =  112 bits (281), Expect = 3e-29
 Identities = 51/220 (23%), Positives = 83/220 (37%), Gaps = 17/220 (7%)

Query: 102 YDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQ 161
           YD I IG G GG  +   A   G K A+IE   +GGTCVN GCVP K +   +       
Sbjct: 3   YDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIRE--A 60

Query: 162 SEHHMKALGLQVHAAGYDRQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQK 221
              +    G       ++ + +         +I  +  N +    VD++ G    +  + 
Sbjct: 61  IHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKT 120

Query: 222 VKFGTDNIVTAKDIIIATGSVPFVPK------------GIEVDGKTVITSDHALKLEFVP 269
           ++   + I     I+IATG  P  P+            G++ + K  I  D         
Sbjct: 121 LEVNGETITA-DHILIATGGRPSHPREPANDNINLEAAGVKTNEKGYIVVDKYQNTN--I 177

Query: 270 DWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFD 309
           + I  VG     +E + V  A G  ++     ++     D
Sbjct: 178 EGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLD 217
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 124 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 123 Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 140 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 119 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 128 Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 115 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 128 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 123 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.98
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.97
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.97
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.97
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.97
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.96
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.95
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.95
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.95
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.95
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.94
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.94
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.94
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.81
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.78
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.78
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.77
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.77
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.76
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.75
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.73
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.73
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.73
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.73
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.72
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.71
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.71
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.7
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.7
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 99.7
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.7
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.69
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.69
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.69
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.69
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.69
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.68
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 99.68
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.68
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.66
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.65
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.64
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.62
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 99.6
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.6
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 99.6
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.57
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.56
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.56
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.54
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.53
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.52
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.47
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.46
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 99.43
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.38
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.34
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.34
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.34
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.32
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.3
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.27
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.23
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.23
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.22
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.19
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.17
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.16
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.16
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.15
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.12
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.11
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.11
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.09
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.02
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.02
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.01
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.96
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.96
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.95
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.95
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.94
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.94
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.93
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.9
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.89
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.85
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.85
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.81
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.81
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.8
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.79
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.79
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.78
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.71
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.71
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.7
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.68
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.66
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.66
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.63
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.63
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.62
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.62
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.62
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.61
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.59
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.58
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.57
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.56
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.56
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.56
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.53
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.53
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.53
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.51
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.51
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.5
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.47
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.47
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.44
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.43
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.43
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.41
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.4
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.39
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.36
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.35
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.32
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.24
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.22
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.21
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.2
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.17
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.15
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.03
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.94
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.92
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.91
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.85
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.84
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.75
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.74
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.68
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.64
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.62
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.6
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.54
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.53
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.52
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.52
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.48
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.46
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.43
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.33
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.26
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.22
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.22
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.19
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.16
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.14
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.09
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.09
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.08
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.08
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.07
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.04
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.02
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 96.96
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.94
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.92
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 96.87
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.77
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.65
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 96.61
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.36
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.36
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 96.25
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.1
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.08
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 95.94
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.91
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.75
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.72
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.66
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.62
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.61
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.6
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.44
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 95.4
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 95.16
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.12
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.12
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.09
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.99
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.69
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.63
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.63
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.53
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.51
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.5
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.5
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.48
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.46
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.4
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 94.3
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.2
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.9
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.72
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.68
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.63
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.37
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 93.34
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.88
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 92.84
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.8
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.78
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.6
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.47
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 92.41
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.27
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 92.19
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 91.92
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 91.87
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.81
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 91.7
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.63
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.46
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.41
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.19
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 90.74
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 90.74
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.62
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.55
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 90.49
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.41
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.4
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.36
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 90.31
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.27
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 90.04
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.96
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.89
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.74
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.72
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.39
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 89.35
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 88.99
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 88.92
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.9
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 88.78
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 88.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.42
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.38
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.37
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.19
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 87.95
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.74
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.67
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.64
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 87.62
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 87.56
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.05
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.81
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 86.62
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.62
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.44
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 86.4
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 86.33
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 86.32
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 86.03
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.83
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 85.72
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.54
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 85.39
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 85.22
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 85.0
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.99
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.82
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.66
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.47
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.14
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 83.89
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 83.76
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.57
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 83.54
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 83.52
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 83.43
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.29
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 83.23
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 83.22
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 83.19
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 83.13
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.0
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 82.98
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 82.96
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.96
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.88
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.68
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 82.34
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.19
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 82.11
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 81.98
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 81.4
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 81.32
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 81.22
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 81.16
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 81.14
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 80.93
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 80.92
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 80.85
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 80.52
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 80.43
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 80.35
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 80.33
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 80.29
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 80.19
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Dihydrolipoamide dehydrogenase
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=99.98  E-value=1.3e-31  Score=251.90  Aligned_cols=217  Identities=33%  Similarity=0.565  Sum_probs=183.1

Q ss_pred             CcccEEEECCChHHHHHHHHHHHcCCcEEEeeCCccCcccccCCccCChhhHhhHHHHHHHHhhhhhhhcCccccccccC
Q 008850          100 FDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQSEHHMKALGLQVHAAGYD  179 (551)
Q Consensus       100 ~~~dVvIIGgG~AGl~aA~~l~~~g~~V~liE~~~~GG~~~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  179 (551)
                      .+||||||||||||++||..+++.|++|+|||+..+||+|.+.+|+|++.++.........   .....+++......++
T Consensus         2 ~~~DviVIG~GpaGl~aA~~aar~G~kV~vIEk~~~GG~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~   78 (223)
T d1ebda1           2 IETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQA---KHSEEMGIKAENVTID   78 (223)
T ss_dssp             EECSEEEECCSHHHHHHHHHHHHTTCCEEEEESSCTTHHHHHTSHHHHHHHHHHHHHHHHH---HTCGGGTEECCSCEEC
T ss_pred             ccCCEEEECCCHHHHHHHHHHHHCCCEEEEEecCCCCcceeccccccccccccccchhhhh---hhhhhhcccchhheee
Confidence            3589999999999999999999999999999999999999999999999888776654433   2333445555555678


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCeEEEeceEEEeCCcEEEe---CcceEEEeCeEEEeCCCCCCCCCCccCCCcee
Q 008850          180 RQGVADHANNLATKIRNNLTNSMKALGVDILTGVGTILGPQKVKF---GTDNIVTAKDIIIATGSVPFVPKGIEVDGKTV  256 (551)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~v~~---~~g~~i~~d~lVlAtG~~p~~p~~~~~~~~~v  256 (551)
                      +..+..+....+..+...+.......+|+++.+++.+.+......   .+..++.++.+|||+|..|..           
T Consensus        79 ~~~~~~~~~~~v~~l~~~~~~~~~~~~V~~i~G~a~f~~~~~~~v~~~~~~~~~~~~~iiIa~g~~p~~-----------  147 (223)
T d1ebda1          79 FAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIE-----------  147 (223)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTCEEEESEEEEEETTEEEEEETTEEEEEECSEEEECCCEEECC-----------
T ss_pred             HHHHhhHHHHHHHHHHhhHHHhhhccceeeeccEEEEccCcccceeccccceEEecccEEEEcCCCccc-----------
Confidence            888888888888888888888888899999999988877654443   334678899999998876641           


Q ss_pred             ecchhhhccccCCceEEEECCChhHHHHHHHHHhCCCeEEEEcccCcCCCCCCHHHHHHHHHHHhCCCceEEEeceEEEe
Q 008850          257 ITSDHALKLEFVPDWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLINPRKIDYHTGVFATK  336 (551)
Q Consensus       257 ~~~~~~~~~~~~~k~v~VvG~G~~g~e~A~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~~~l~~~~gi~~~~~~~~~~  336 (551)
                                                                                                      
T Consensus       148 --------------------------------------------------------------------------------  147 (223)
T d1ebda1         148 --------------------------------------------------------------------------------  147 (223)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCcEEEEEecccCCCCCeEEecCEEEEeecCCCCCCCCCCccccccc-CCCceeeCCCCccccCCCCCCCcEEEecCCC
Q 008850          337 DGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENINVVT-QRGFVPVDERMRVIDANGNLVPHLYCIGDAN  415 (551)
Q Consensus       337 ~~~~~~v~~~~g~~~~~~~~i~~D~vi~a~G~~p~~~~l~l~~~~l~~-~~G~i~Vd~~~~~~~~~~t~~~~IyA~GD~~  415 (551)
                                                  .+|++||++.|.+++.|++. ++|+|.||+++|      ||+|+|||+|||+
T Consensus       148 ----------------------------~~G~~p~~~~l~l~~~gv~~~~~G~I~vd~~~~------T~~~gvyA~GDv~  193 (223)
T d1ebda1         148 ----------------------------LVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCR------TSVPNIFAIGDIV  193 (223)
T ss_dssp             ----------------------------BSCEEESCSSSSTTTTTCCBCTTSCBCCCTTCB------CSSTTEEECGGGS
T ss_pred             ----------------------------cccceecCCCCChHhcCceECCCCCEeECCCCC------CCCCCEEEEeccC
Confidence                                        24778999988889999987 799999999999      8999999999999


Q ss_pred             CCCCcHHHHHHHHHHHHHHHcCCCccCCC
Q 008850          416 GKMMLAHAASAQGISVVEQVTGRDHVLNH  444 (551)
Q Consensus       416 ~~~~~~~~A~~~g~~aa~~i~g~~~~~~~  444 (551)
                      +.+.+++.|..||++||++|+|++.+++|
T Consensus       194 ~~~~~~~~A~~~g~~aa~~i~g~~~~~dy  222 (223)
T d1ebda1         194 PGPALAHKASYEGKVAAEAIAGHPSAVDY  222 (223)
T ss_dssp             SSCCCHHHHHHHHHHHHHHHTSCCCCCCC
T ss_pred             CCcccHHHHHHHHHHHHHHHcCCCCCCCC
Confidence            99999999999999999999999877776
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure