Citrus Sinensis ID: 008856


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MQRIVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
cccccccccccccccEEEEEccccccccccccccccccEEEEEcccccEEEccccccccccccEEEEEcccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccccEEEEEEccccEEEcccccccccccEEEEEcccccEEcccccccccccEEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEccccccccHHcccccccccEEEEEcccccccccccccccccccEEEEEcccccEEccccccccccccEEEEEEccccccccccccccccccEEEEEcccccccccccccccccEEEcccccccHHHHHHcccccccccccEEEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHHcccccccccccccccEEEEcc
cccccccHcccccccEEEccccccccccccccccccccHEEHccccccccccHcccccccccEEEEEcccccccccccccccHHcccccccEEEccccccHcccccccccccccHHccccccccEEEEcccccHHcccccccccccccEEEccccccccccccccccccccEEEEcccccHccccHHHcccccccccEEEccccccccccccccccccccEEEccccccHccccHHcccccccccccccccHHHEccccccccHHcccHHHccccccccccccccccccEEEEEcccccHHcccHHccccccccEEEEcccccHccccccccccccccEEEccccccHccccccccccccccEEEEccccHHHcccccccccccccEEEccccccccccccccccHHHEEEccHHHHHHHHHHcccHHcccccccEEEccccccccccccccccHHccHHHccccccccEEEEcccccHHHccHHHcccccccEEEEcccccHcccccccccccccEEEEcccHHHHHcccccccccccccccccEEEEcc
MQRIVISITslpalckmeiggckKVVWRSatdhlgsqnsvvcrdasnqvflagplkpripkleelkinniqnETCIWKSHNELLQDICSlkrltitscpklqsLVAEEEKDQQQQLCQLSCRLEYLILSYCEGlvklpqssfslsslreIEIFKcsslvsfpevalpsklkkiqigecdalkslpeawmcdtnssleilsihgcrSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEgiqcssssrrYTSYLLEHlgirycpsltcifsknelpatleslevgnlppslkSLRVRYCSKLESIAErldnntsletisiyncenlkilpsglhklhqlreisigscgnlvsfpggglpcakltaleiyDCKRlkalpkglhnlstlqDLTIGGALLsleedglptnlhSLVIRGNMEIWKSMIEWGrgfhrfsslrhltidgcdddtmmvsfpledkrlgtvlrlpttltslriedfpnlerlsssiidlrnltelvlrgcpklkyfpekglpssLLELWISgcplieekcrkdggQYWDLLTHiplvaiyg
mqrivisitslpalckMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLEslevgnlppslkSLRVRYCSKLESIaerldnntsletISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFpledkrlgtvlRLPTtltslriedfpnlerlsssiidlrnlTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
MQRIVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEEKDqqqqlcqlscRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCssssrrytsyllEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
***IVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVA*******QQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIY*
MQRIVISITSLPALCKMEIGGCKKVVW*****HLGSQNSVVCRDASNQVF********IPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEE********QLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEG*****SSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
MQRIVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLV**********LCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
*QRIVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRIVISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKSHNELLQDICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.593 0.229 0.303 2e-24
Q7XA39988 Putative disease resistan N/A no 0.294 0.163 0.345 2e-13
O23530 1301 Protein SUPPRESSOR OF npr no no 0.667 0.282 0.256 3e-10
Q7XBQ9970 Disease resistance protei N/A no 0.361 0.205 0.305 4e-10
Q9LVT1623 Putative disease resistan no no 0.166 0.147 0.294 4e-08
Q7XA42979 Putative disease resistan N/A no 0.762 0.429 0.216 6e-07
Q9FKZ0815 Probable disease resistan no no 0.186 0.126 0.283 9e-07
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.430 0.231 0.302 1e-06
Q9LZ25811 Probable disease resistan no no 0.206 0.140 0.296 2e-06
Q9FKZ2415 Probable disease resistan no no 0.270 0.359 0.278 5e-06
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 186/395 (47%), Gaps = 68/395 (17%)

Query: 164  VALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLT 223
            + LP  L+ + I  CD L SLPE  + ++  +L  L I  C SL        P++LK L 
Sbjct: 1087 MELPQNLQSLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLY 1145

Query: 224  IWYCDNIRTLTVEEGIQCSSSSRRYTSYLLEHLGI-RYCPSLTCIFSKNELPATLESLEV 282
            I  C   + L   E +Q    +R Y+   LE+L I   C +L         P +L     
Sbjct: 1146 IRDC---KKLNFTESLQ---PTRSYSQ--LEYLFIGSSCSNLV------NFPLSLF---- 1187

Query: 283  GNLPPSLKSLRVRYCSKLESI---AERLDNNTSLETISIYNCENLKILPSGLHKLHQLRE 339
                P L+SL +R C   ++    A   D+  +LE++ I +C NL+              
Sbjct: 1188 ----PKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLE-------------- 1229

Query: 340  ISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGG--ALLSL 397
                      +FP GGLP  KL+++ + +CK+L+ALP+ L  L++L  L I     + ++
Sbjct: 1230 ----------TFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETI 1279

Query: 398  EEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKR 457
               G P+NL +L I    +     IEW  G     +LR+L IDG ++D  + SFP E   
Sbjct: 1280 PGGGFPSNLRTLCI-SLCDKLTPRIEW--GLRDLENLRNLEIDGGNED--IESFPEEG-- 1332

Query: 458  LGTVLRLPTTLTSLRIEDFPNLERLS-SSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLL 516
                  LP ++ SLRI  F NL+ L+     D + +  + + GC KL+   ++ LP  L 
Sbjct: 1333 -----LLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLS 1386

Query: 517  ELWISGCPLIEEKCRKDGGQYWDLLTHIPLVAIYG 551
             L IS C L+ E   +   +++ +L +IP V I G
Sbjct: 1387 CLRISSCSLLTETFAEVETEFFKVL-NIPYVEIDG 1420




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKZ2|DRL41_ARATH Probable disease resistance protein At5g66890 OS=Arabidopsis thaliana GN=At5g66890 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
224132254552 predicted protein [Populus trichocarpa] 0.921 0.920 0.403 2e-81
356554923 1399 PREDICTED: putative disease resistance R 0.872 0.343 0.374 6e-70
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.860 0.332 0.357 2e-65
45826061 739 resistance protein [Quercus suber] 0.740 0.552 0.392 2e-61
400131587 1388 FB_MR5 [Malus x robusta] 0.847 0.336 0.361 5e-58
225449649 1418 PREDICTED: putative disease resistance p 0.896 0.348 0.355 9e-58
224059584 1418 cc-nbs-lrr resistance protein [Populus t 0.796 0.309 0.365 1e-52
225450023 1396 PREDICTED: putative disease resistance p 0.820 0.323 0.316 2e-50
359495054 1347 PREDICTED: putative disease resistance R 0.773 0.316 0.353 2e-49
359495085 1345 PREDICTED: putative disease resistance p 0.789 0.323 0.350 2e-49
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 228/565 (40%), Positives = 309/565 (54%), Gaps = 57/565 (10%)

Query: 17  MEIGGCKKVVWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCI 76
           M I GCK+VV+     +L S NS+   + S   +LA      + +++EL+I N    T +
Sbjct: 1   MVINGCKEVVYEGGV-YLRSLNSMTISNISKLTYLAEGFIQPLAEVQELEIANCMELTSL 59

Query: 77  WKSHNELLQDICSLKRLTITSCPKLQSLV-AEEEKDQQQQLCQLSCRLEYLILSYCEGLV 135
           +++   L + + SL +L + +CP++ SL+  E     QQQL   +C+LE L  S CE L 
Sbjct: 60  YENGVALAKQLTSLLKLEVRNCPQVVSLMEGEVPVYMQQQLA--NCKLESLTFSTCESLK 117

Query: 136 KLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALKSLPEA----WMCD 191
           KLPQ   SL SL+E++I  C  L+SFPE  LPS L+ I+I  C+AL  LP A     MC 
Sbjct: 118 KLPQWVHSLVSLKELKIQYCPRLLSFPEAGLPSTLRIIEIVGCNALTPLPAAVTYNMMC- 176

Query: 192 TNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTL----------TVEEGIQC 241
               LE L I  C SL     +QLP +LK L I YC+N+  L            +E   C
Sbjct: 177 ----LEQLRIENCESLISFGRIQLPPTLKKLEIRYCENLLCLLDDGEGSSSKKSDENTSC 232

Query: 242 SSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEV------------GNLPPSL 289
           S ++    S LLE+L +  C SLT I    ELP+ L+ L+V              LP  L
Sbjct: 233 SGNN----SSLLEYLYVGICNSLTSI---GELPSALKYLQVCSCSKLKSLSSRDKLPAGL 285

Query: 290 KSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLV 349
           K L +  C  LES+ +R  +N SLE + I+ C NL+ LP GLHKL  LREISI  C  LV
Sbjct: 286 KHLAIDSCENLESMPDRFQDNMSLENLKIWFCFNLRSLPEGLHKLCHLREISIWYCPALV 345

Query: 350 SFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGA--LLSLEEDGLPTNLH 407
           SF   GLP   L  L I  C  LKA+P  +HNL +L++L+I     ++S  E+G PT+L 
Sbjct: 346 SFAAEGLP-INLRRLFIIKCDGLKAIPDHMHNLMSLEELSIYYCPDIVSFPEEGFPTSLT 404

Query: 408 SLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTT 467
            L    +++I + +  W  G H+ S+LR L I G       +SFP  D  +G  +RLP+ 
Sbjct: 405 YLATV-DLKICELLFNW--GMHKLSALRTLIIQG---GFSHISFPSVD--MG--VRLPSA 454

Query: 468 LTSLRIEDFPNLERLS-SSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLI 526
           L  L IEDFPNLE LS S   +L +L  L +  CPKL  FP KGLPSSLLEL I  CPL+
Sbjct: 455 LNRLSIEDFPNLEYLSYSGFQNLSSLERLSISDCPKLTSFPGKGLPSSLLELRIRACPLL 514

Query: 527 EEKCRKDGGQYWDLLTHIPLVAIYG 551
            ++  K   + W  + HIP + I G
Sbjct: 515 VQQI-KGRVKEWLKIRHIPYINIDG 538




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224059584|ref|XP_002299919.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847177|gb|EEE84724.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359495054|ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495085|ref|XP_003634909.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.615 0.238 0.294 6.3e-21
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.509 0.236 0.273 3e-16
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.509 0.231 0.254 1.4e-14
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.644 0.179 0.249 5.4e-14
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.488 0.226 0.258 1.6e-12
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.658 0.279 0.266 7.9e-12
TAIR|locus:2098145 1240 AT3G44630 [Arabidopsis thalian 0.402 0.179 0.273 3e-09
TAIR|locus:2028681 1161 AT1G31540 [Arabidopsis thalian 0.453 0.215 0.278 1.9e-11
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.368 0.166 0.303 2e-11
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.736 0.313 0.248 2.2e-11
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 268 (99.4 bits), Expect = 6.3e-21, Sum P(3) = 6.3e-21
 Identities = 110/373 (29%), Positives = 182/373 (48%)

Query:   191 DTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTL--TVEEGIQCXXXXXXX 248
             D  + +E L +     ++++  ++LP +L+ L I  CD + +L   + E           
Sbjct:  1070 DDETDMEYLKV---TDISHL--MELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLII 1124

Query:   249 XXXXXEHLGIRYCPS-LTCIFSKN--ELPATLESLEVGNLPPSLKSLRV-RYCSKLESIA 304
                  E     + P+ L  ++ ++  +L  T ESL+       L+ L +   CS L +  
Sbjct:  1125 ACHSLESFPGSHPPTTLKTLYIRDCKKLNFT-ESLQPTRSYSQLEYLFIGSSCSNLVNFP 1183

Query:   305 ERLDNNTSLETISIYNCENLKI--LPSGLHKLH-QLREISIGSCGNLVSFPGGGLPCAKL 361
               L     L ++SI +CE+ K   + +GL      L  + I  C NL +FP GGLP  KL
Sbjct:  1184 --LSLFPKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKL 1241

Query:   362 TALEIYDCKRLKALPKGLHNLSTLQDLTIGGA--LLSLEEDGLPTNLHSLVIRGNMEIWK 419
             +++ + +CK+L+ALP+ L  L++L  L I     + ++   G P+NL +L I    +   
Sbjct:  1242 SSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCI-SLCDKLT 1300

Query:   420 SMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPTTLTSLRIEDFPNL 479
               IEWG       +LR+L IDG ++D  + SFP E    G    LP ++ SLRI  F NL
Sbjct:  1301 PRIEWG--LRDLENLRNLEIDGGNED--IESFPEE----GL---LPKSVFSLRISRFENL 1349

Query:   480 ERLS-SSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLIEEKCRKDGGQYW 538
             + L+     D + +  + + GC KL+   ++ LP  L  L IS C L+ E   +   +++
Sbjct:  1350 KTLNRKGFHDTKAIETMEISGCDKLQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFF 1408

Query:   539 DLLTHIPLVAIYG 551
              +L +IP V I G
Sbjct:  1409 KVL-NIPYVEIDG 1420


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028681 AT1G31540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-11
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-06
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 2e-05
PRK15386 426 PRK15386, PRK15386, type III secretion protein Gog 6e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 65.3 bits (159), Expect = 5e-11
 Identities = 69/237 (29%), Positives = 106/237 (44%), Gaps = 39/237 (16%)

Query: 289 LKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNL 348
           L+++ +R    L+ I + L   T+LET+ + +C +L  LPS +  L++L ++ +  C NL
Sbjct: 636 LRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL 694

Query: 349 VSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGGALLSLEEDGLPTNLH- 407
              P  G+    L  L +  C RLK+ P    N+S    L +     ++EE   P+NL  
Sbjct: 695 EILP-TGINLKSLYRLNLSGCSRLKSFPDISTNISW---LDLDET--AIEE--FPSNLRL 746

Query: 408 -SLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLEDKRLGTVLRLPT 466
            +L      E+ KS   W R       ++ LT             PL       +  L  
Sbjct: 747 ENLDELILCEM-KSEKLWER-------VQPLT-------------PL-------MTMLSP 778

Query: 467 TLTSLRIEDFPNLERLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGC 523
           +LT L + D P+L  L SSI +L  L  L +  C  L+  P      SL  L +SGC
Sbjct: 779 SLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG4341483 consensus F-box protein containing LRR [General fu 99.4
KOG4341483 consensus F-box protein containing LRR [General fu 99.34
KOG4237498 consensus Extracellular matrix protein slit, conta 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.1
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.0
KOG0617264 consensus Ras suppressor protein (contains leucine 98.99
PRK15386 426 type III secretion protein GogB; Provisional 98.72
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.67
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.51
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.45
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.37
PRK15386426 type III secretion protein GogB; Provisional 98.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.04
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.88
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.31
PLN03150623 hypothetical protein; Provisional 97.27
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.12
PLN03150623 hypothetical protein; Provisional 97.12
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.81
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.13
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.01
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.7
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.09
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.87
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.82
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.22
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.62
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.07
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.85
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.6e-32  Score=305.00  Aligned_cols=462  Identities=17%  Similarity=0.120  Sum_probs=257.4

Q ss_pred             hhhccCCCCcceEEeCCCCCc-cccc----cccccceeeeccccCcccceeccCCcCCCCCCccEEEecCCCCchhhccc
Q 008856            5 VISITSLPALCKMEIGGCKKV-VWRS----ATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELKINNIQNETCIWKS   79 (551)
Q Consensus         5 ~~~~~~~~~L~~L~l~~~~~~-~~~~----~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~   79 (551)
                      ..+|..+++|++|++++|... .++.    .+.+|++|++.++....   .+|.   ..+++|++|+++++ .+...   
T Consensus        86 ~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~---~~p~---~~l~~L~~L~Ls~n-~~~~~---  155 (968)
T PLN00113         86 SSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTG---SIPR---GSIPNLETLDLSNN-MLSGE---  155 (968)
T ss_pred             ChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCcccc---ccCc---cccCCCCEEECcCC-ccccc---
Confidence            456888999999999998754 2433    36779999998876543   2332   24788888888884 44422   


Q ss_pred             CcchhcccCCccEEeecCCccccccchhhhhhhhhhhhccCCCccEEecccCccccccccccCCCCCCceEEEccCCCCc
Q 008856           80 HNELLQDICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLV  159 (551)
Q Consensus        80 ~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~  159 (551)
                      ....+..+++|++|++++|.-...+|..     +..+    ++|++|++++|.....+|..+..+++|++|+++++....
T Consensus       156 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~-----~~~l----~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~  226 (968)
T PLN00113        156 IPNDIGSFSSLKVLDLGGNVLVGKIPNS-----LTNL----TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSG  226 (968)
T ss_pred             CChHHhcCCCCCEEECccCcccccCChh-----hhhC----cCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCC
Confidence            3344678888888888886422334432     6666    888888888876555677778888888888888764333


Q ss_pred             ccCC-CCCCCCCcEEEccCCCCccccchhhhhccCCCccEEEEecCCCcceeccc-cCCCCccEEEEecCCCcccccccc
Q 008856          160 SFPE-VALPSKLKKIQIGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAV-QLPSSLKMLTIWYCDNIRTLTVEE  237 (551)
Q Consensus       160 ~~~~-~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-~~~~~L~~L~l~~~~~l~~l~~~~  237 (551)
                      .+|. ++.+++|++|++++|.....++..+  ..+++|+.|++++|.....++.. ..+++|+.|++++|.-...+  |.
T Consensus       227 ~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~--p~  302 (968)
T PLN00113        227 EIPYEIGGLTSLNHLDLVYNNLTGPIPSSL--GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI--PE  302 (968)
T ss_pred             cCChhHhcCCCCCEEECcCceeccccChhH--hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCC--Ch
Confidence            4444 5667888888888765443444432  22367778877775433233322 33567777777765333233  44


Q ss_pred             cccccCCCcccccCCccEEEEecCCCCcccccCCCchhhhhhccccCCCCCccEEEeccCcchhhhHhhhcCCCCCcEEE
Q 008856          238 GIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVRYCSKLESIAERLDNNTSLETIS  317 (551)
Q Consensus       238 ~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~  317 (551)
                      .+..        +++|+.|+++++.....      .|..+..+.      +|+.|++++|.....++..++.+++|+.|+
T Consensus       303 ~~~~--------l~~L~~L~l~~n~~~~~------~~~~~~~l~------~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~  362 (968)
T PLN00113        303 LVIQ--------LQNLEILHLFSNNFTGK------IPVALTSLP------RLQVLQLWSNKFSGEIPKNLGKHNNLTVLD  362 (968)
T ss_pred             hHcC--------CCCCcEEECCCCccCCc------CChhHhcCC------CCCEEECcCCCCcCcCChHHhCCCCCcEEE
Confidence            4444        45566666665332111      111111111      244444444443333333444444444444


Q ss_pred             EecC------------------------CCcccccccccCCCCcceEEecCCCCCccCCCCCCCCCCccEEEEccCcccc
Q 008856          318 IYNC------------------------ENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLK  373 (551)
Q Consensus       318 l~~~------------------------~~l~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~c~~l~  373 (551)
                      ++++                        .....+|..+..+++|+.|++++|.....+|.....+++|+.|++++|....
T Consensus       363 Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  442 (968)
T PLN00113        363 LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQG  442 (968)
T ss_pred             CCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccC
Confidence            4442                        2222233334444455555555443222333333333455555555543333


Q ss_pred             ccccccccCCcccceeccc-ccc-ccccCCcCCCcceeEecCCchhhhhhhhhccccccCCCccEEEEeccCCCCccccc
Q 008856          374 ALPKGLHNLSTLQDLTIGG-ALL-SLEEDGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSF  451 (551)
Q Consensus       374 ~~~~~~~~l~~L~~L~l~~-~l~-~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~  451 (551)
                      .++..+..+++|+.|++++ .+. .+|.....++|+.|++++|+... ..+..   +..+++|+.|++++|. .  ...+
T Consensus       443 ~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~-~~~~~---~~~l~~L~~L~Ls~N~-l--~~~~  515 (968)
T PLN00113        443 RINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSG-AVPRK---LGSLSELMQLKLSENK-L--SGEI  515 (968)
T ss_pred             ccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCC-ccChh---hhhhhccCEEECcCCc-c--eeeC
Confidence            3333444555555555555 221 23333334566666666665332 22222   4566677777777762 2  2244


Q ss_pred             ccccccccccccccccccccccccCCChh-hhhhhccCCCCcCEEEEcCCCCccccCCC-CCccccceEeecCCc
Q 008856          452 PLEDKRLGTVLRLPTTLTSLRIEDFPNLE-RLSSSIIDLRNLTELVLRGCPKLKYFPEK-GLPSSLLELWISGCP  524 (551)
Q Consensus       452 ~~~~~~~~~~~~~~~~L~~L~l~~~~~l~-~~~~~~~~l~~L~~L~l~~c~~l~~l~~~-~~~~~L~~L~i~~c~  524 (551)
                      |+..       ..+++|++|++++ +.+. .+|..+..+++|++|++++|+....+|.. ..+++|+.+++++|+
T Consensus       516 p~~~-------~~l~~L~~L~Ls~-N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~  582 (968)
T PLN00113        516 PDEL-------SSCKKLVSLDLSH-NQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNH  582 (968)
T ss_pred             ChHH-------cCccCCCEEECCC-CcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCc
Confidence            4433       2456777777777 3443 45566667777777777776544455542 224567777777775



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 88.1 bits (219), Expect = 3e-19
 Identities = 62/326 (19%), Positives = 102/326 (31%), Gaps = 58/326 (17%)

Query: 123 LEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVALPSKLKKIQIGECDALK 182
            E L       L                +  +  S          S   +I+     ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 183 SLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLT------------------I 224
           +  +     T      L +     L      Q P     L+                  +
Sbjct: 70  ATADLLEDATQPGRVALELRSV-PLP-----QFPDQAFRLSHLQHMTIDAAGLMELPDTM 123

Query: 225 WYCDNIRTLTV---------EEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPA 275
                + TLT+               +          L  L IR CP LT      ELP 
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNR---------LRELSIRACPELT------ELPE 168

Query: 276 TLESLEVGNLPPSLKSLRVRY--CSKLESIAERLDNNTSLETISIYNCENLKILPSGLHK 333
            L S +       L +L+      + + S+   + N  +L+++ I N   L  L   +H 
Sbjct: 169 PLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-PLSALGPAIHH 227

Query: 334 LHQLREISIGSCGNLVSFPGGGLPCAKLTALEIYDCKRLKALPKGLHNLSTLQDLTIGG- 392
           L +L E+ +  C  L ++P      A L  L + DC  L  LP  +H L+ L+ L + G 
Sbjct: 228 LPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGC 287

Query: 393 -ALLSL-EEDGLPTNLHSLVIRGNME 416
             L  L            +++  +++
Sbjct: 288 VNLSRLPSLIAQLPANCIILVPPHLQ 313


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.6
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.5
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.44
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.33
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.32
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.3
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.3
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.24
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.21
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.18
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.96
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.86
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.8
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.78
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.74
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.68
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.67
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.0
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.91
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-35  Score=323.97  Aligned_cols=246  Identities=18%  Similarity=0.103  Sum_probs=160.3

Q ss_pred             CccEEEeccCcchhhhHhhhcCCCCCcEEEEecCCCcccccccccCCCCcceEEecCCCCCccCCCCCCCCCCccEEEEc
Q 008856          288 SLKSLRVRYCSKLESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLREISIGSCGNLVSFPGGGLPCAKLTALEIY  367 (551)
Q Consensus       288 ~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~  367 (551)
                      +|++|++++|.....++..+..+++|+.|++++|.....+|..+..+++|++|++++|.....+|.....+++|+.|+++
T Consensus       443 ~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~  522 (768)
T 3rgz_A          443 KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLS  522 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             CCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECC
Confidence            57777777776655666677777777777777744333556777777778888887765444566555556678888888


Q ss_pred             cCccccccccccccCCcccceeccc-ccc-cccc----------------------------------------------
Q 008856          368 DCKRLKALPKGLHNLSTLQDLTIGG-ALL-SLEE----------------------------------------------  399 (551)
Q Consensus       368 ~c~~l~~~~~~~~~l~~L~~L~l~~-~l~-~l~~----------------------------------------------  399 (551)
                      +|.....+|..+.++++|+.|++++ .+. .+|.                                              
T Consensus       523 ~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  602 (768)
T 3rgz_A          523 NNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSE  602 (768)
T ss_dssp             SSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGG
T ss_pred             CCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccch
Confidence            7665556777777788888887776 222 1211                                              


Q ss_pred             -------------------------CCcCCCcceeEecCCchhhhhhhhhccccccCCCccEEEEeccCCCCcccccccc
Q 008856          400 -------------------------DGLPTNLHSLVIRGNMEIWKSMIEWGRGFHRFSSLRHLTIDGCDDDTMMVSFPLE  454 (551)
Q Consensus       400 -------------------------~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~  454 (551)
                                               ...+++|++|++++|..... .+..   +..+++|+.|++++|. -  ...+|..
T Consensus       603 ~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~-ip~~---l~~l~~L~~L~Ls~N~-l--~g~ip~~  675 (768)
T 3rgz_A          603 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY-IPKE---IGSMPYLFILNLGHND-I--SGSIPDE  675 (768)
T ss_dssp             GGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSC-CCGG---GGGCTTCCEEECCSSC-C--CSCCCGG
T ss_pred             hhhccccccccccccceecccCchhhhccccccEEECcCCccccc-CCHH---HhccccCCEEeCcCCc-c--CCCCChH
Confidence                                     11246788888888874432 2332   6788889999999883 2  2366665


Q ss_pred             cccccccccccccccccccccCCChh-hhhhhccCCCCcCEEEEcCCCCccccCCCCCccccceEeecCCchH----HHH
Q 008856          455 DKRLGTVLRLPTTLTSLRIEDFPNLE-RLSSSIIDLRNLTELVLRGCPKLKYFPEKGLPSSLLELWISGCPLI----EEK  529 (551)
Q Consensus       455 ~~~~~~~~~~~~~L~~L~l~~~~~l~-~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l----~~~  529 (551)
                      .       ..+++|+.|++++ |++. .+|..+..+++|++|++++|+.-..+|..+...++....+.+|+.+    -..
T Consensus       676 l-------~~L~~L~~LdLs~-N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~  747 (768)
T 3rgz_A          676 V-------GDLRGLNILDLSS-NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR  747 (768)
T ss_dssp             G-------GGCTTCCEEECCS-SCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCC
T ss_pred             H-------hCCCCCCEEECCC-CcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcC
Confidence            5       3678899999999 5665 6788888999999999999765567777666667777777776532    227


Q ss_pred             hhccCcccccccCccccee
Q 008856          530 CRKDGGQYWDLLTHIPLVA  548 (551)
Q Consensus       530 ~~~~~~~~~~~~~~~~~~~  548 (551)
                      |...++++|++++|+|++.
T Consensus       748 C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          748 CDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             CCSCC--------------
T ss_pred             CCCCccCCCCCCCCccccC
Confidence            8889999999999999864



>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.0 bits (84), Expect = 0.004
 Identities = 29/225 (12%), Positives = 66/225 (29%), Gaps = 17/225 (7%)

Query: 117 CQLSCRLEYLILSYCEGLVKLPQSSFS-LSSLREIEIFKCSSLVSFPE-VALPSKLKKIQ 174
                R++++ LS     V       S  S L+ + +            +A  S L ++ 
Sbjct: 42  HFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLN 101

Query: 175 IGECDALKSLPEAWMCDTNSSLEILSIHGCRSLTYIAAVQLPSSLKMLTIWYCDNIRTLT 234
           +  C          +  + S L+ L++  C   T             + + +     T  
Sbjct: 102 LSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKH--------VQVAVAHVSETITQL 153

Query: 235 VEEGIQCSSSSRRYTSYLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLRV 294
              G + +      ++ +     + +      +  KN+                L+ L +
Sbjct: 154 NLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ------LNYLQHLSL 207

Query: 295 RYCSKL-ESIAERLDNNTSLETISIYNCENLKILPSGLHKLHQLR 338
             C  +       L    +L+T+ ++       L      L  L+
Sbjct: 208 SRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQ 252


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.25
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.21
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.9
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.9
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.8
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.26
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.83  E-value=5.6e-19  Score=175.71  Aligned_cols=79  Identities=15%  Similarity=0.155  Sum_probs=43.2

Q ss_pred             ccCCccEEeecCCccccccchhhhhhhhhhhhccCCCccEEecccCccccccccccCCCCCCceEEEccCCCCcccCCCC
Q 008856           86 DICSLKRLTITSCPKLQSLVAEEEKDQQQQLCQLSCRLEYLILSYCEGLVKLPQSSFSLSSLREIEIFKCSSLVSFPEVA  165 (551)
Q Consensus        86 ~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~l~~~~~~L~~L~L~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~  165 (551)
                      .+.+|++|+++++ +++.+.      ++..+    ++|++|++++| .++.++ .+..+++|++|+++++ .+..+++++
T Consensus        42 ~l~~l~~L~l~~~-~I~~l~------gl~~L----~nL~~L~Ls~N-~l~~l~-~l~~L~~L~~L~L~~n-~i~~i~~l~  107 (384)
T d2omza2          42 DLDQVTTLQADRL-GIKSID------GVEYL----NNLTQINFSNN-QLTDIT-PLKNLTKLVDILMNNN-QIADITPLA  107 (384)
T ss_dssp             HHTTCCEEECCSS-CCCCCT------TGGGC----TTCCEEECCSS-CCCCCG-GGTTCTTCCEEECCSS-CCCCCGGGT
T ss_pred             HhCCCCEEECCCC-CCCCcc------ccccC----CCCCEEeCcCC-cCCCCc-cccCCccccccccccc-ccccccccc
Confidence            3455666666654 355442      14444    66666666664 345454 2555666666666663 344555555


Q ss_pred             CCCCCcEEEccCC
Q 008856          166 LPSKLKKIQIGEC  178 (551)
Q Consensus       166 ~~~~L~~L~l~~~  178 (551)
                      .+++|+.++++++
T Consensus       108 ~l~~L~~L~~~~~  120 (384)
T d2omza2         108 NLTNLTGLTLFNN  120 (384)
T ss_dssp             TCTTCCEEECCSS
T ss_pred             ccccccccccccc
Confidence            5666666666553



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure