Citrus Sinensis ID: 008905

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55

MSGDSVSPRSQQRAGPVASQGSSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSFVPSRKNKQESTTGSIDETYDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQSTKIASNPSHLLNTLSPDISEQNQKLTKLTLNKPDSGSASGQNSALGELSDCDETSLSSSYDESKSMQANETSLSSSYDESKSLQANETSLSSSYDESKSMQANETSLSSSYDESKSLQANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKSHTVLISRSGRRK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHcccccccccccccccccccEEEcccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHcccccccccccccHHHHHHHccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEcHHcHHHHHHHHcccccccccEEEEEEEEEEEEEcHHHHHHHccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

ccccccccccHHHHcccccccccccccccEEcHEEEEEEccccccccccccccccccccccccccHHHHEEEEEEEEEccccccccccccccccccHccEEEEEEEccccccccccccccccccccccccEEcHHHHHHHHccccccccccccccccccHcHEcHHcccEEEEEEccccccccEEEEEEEEcccccEEEccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEccHHHHHHHHHHccHHHccccEEEEEEEEcccEccHHHHHHHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

msgdsvsprsqqragpvasqgssgrraqtisgnhllnfqydpisrpqyrmpppparrqrkirpynkdlflqanYKFVvldtgdhapesmdpdkmlqweDIICvrysnplsvqcpicleyplcpqitscghifcfpCILQYLlmgdedykgdcfkrcplcfvmissKELYTIHIENVRQHAVGDTIEFMLLIRekdsfvpsrknkqesttgsidetydpfskftftsdVDLSVRKAMSDLDGWLAkadsglvddlekLPYVCAAMEQLEQRKKYWNErrasgsdkasnnadgqtgfhglqstkiasnpshllntlspdiseqnqkltkltlnkpdsgsasgqnsalgelsdcdetslsssydesksmqanetslsssydeskslqanetslsssydesksmqanetslsssydeskslqanftgsteikdkdsynfyqaidgqhlilhpLNLKCLLHhygsydmlphrisgrilqlesVTQSEAMRRRYRYLSHFSLTTTFQLCeidltealppdalspfIDEIRKREKQRKQLANKSHTVLISRSGRRK

msgdsvsprsqqragpvasqgssgrraqtisgnhllnfqydpisrpqyrmpppparrqrkirpYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIRekdsfvpsrknkqesttgsidetydpfskFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRAsgsdkasnnadgQTGFHGLQSTKIASNPSHLLNTLSPDISEQNQKLTKLTlnkpdsgsasgqnsalgelsdCDETSLSssydesksmqanETSLSSSYDESKSLQANETSlsssydesksMQANETslsssydesKSLQANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKREKqrkqlankshtvlisrsgrrk

MSGDSVSPRSQQRAGPVASQGSSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSFVPSRKNKQESTTGSIDETYDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQSTKIASNPSHLLNTLSPDISEQNQKLTKLTLNKPDSGSASGQNSALGELSDCDETSLSSSYDESKSMQANETslsssydesksLQANETSLSSSYDESKSMQANETslsssydesksLQANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKSHTVLISRSGRRK

***********************************LNF************************PYNKDLFLQANYKFVVLDTGD*********KMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIRE**********************YDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLE******************************************************************************************************************************************************************DSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFI*****************************

*********************************HLLNF******************************FLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLL***********KRCPLCFVMISSKELYTIHIENVRQHAVGDTIEF*L**************************YDPFSKFTFTSDVDLSV**********************EKLPYVCAAMEQLEQRKKYWNERRASGSD*******************************SPDISEQNQKLTKLTLNKPDS************LSDCDETSLSSSYDESKSMQANETSLSSSYDESKSLQANETSL**SYDESKSMQAN*****************************YNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPF******************************

**************************AQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSF*************SIDETYDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWN**************DGQTGFHGLQSTKIASNPSHLLNTLSPDISEQNQKLTKLTLNK*************************************************************************************QANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKR***********************

***************************QTISGNHLLNFQYDP*******************RPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSFVPSRKNKQESTTGSIDETYDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQSTKIASNPSHL***********************************************************************************************************************KDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLAN**************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		549	2.2.26 [Sep-21-2011]
Q08E13		810	RING finger protein 10 OS	yes	no	0.426	0.288	0.317	9e-30
Q3UIW5		804	RING finger protein 10 OS	yes	no	0.353	0.241	0.359	2e-29
Q32NQ8		756	RING finger protein 10 OS	N/A	no	0.307	0.223	0.382	2e-29
Q5XI59		802	RING finger protein 10 OS	yes	no	0.353	0.241	0.349	7e-29
Q8N5U6		811	RING finger protein 10 OS	yes	no	0.428	0.289	0.312	2e-28
O94271		673	Uncharacterized RING fing	yes	no	0.262	0.213	0.323	6e-18
Q06436		670	RING-finger protein MAG2	yes	no	0.315	0.258	0.290	1e-11
Q6CHI1		344	Postreplication repair E3	no	no	0.138	0.220	0.282	0.0002
P40072		274	E3 ubiquitin-protein liga	no	no	0.103	0.208	0.366	0.0003
Q6BLM3		491	Postreplication repair E3	no	no	0.071	0.079	0.416	0.0006

>sp\|Q08E13\|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1	Back alignment and function desciption

 Score =  132 bits (331), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 133/271 (49%), Gaps = 37/271 (13%)

Query: 28  QTISGNHLLNFQYDPISRPQYRMPPPPA----RRQRKIRPYNKDLFLQANYKFVVLDTGD 83
           + I+ NHLLNF ++P  +  +           R +   +P+NK+LFLQAN +FVV +  D
Sbjct: 136 KKINLNHLLNFTFEPRGQAGHFEGSGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQD 195

Query: 84  HAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLM 143
           +     DPD ++ W+ +  VR  +     CPICL  P   +IT CGHIFC+ CIL YL +
Sbjct: 196 YTVHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSL 255

Query: 144 GDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAVGDTIEFMLLIREKDSFVPSRKN 203
            ++ +      +CP+C+  +  K+L ++     RQ+ VGDTI   L+ REK   V   K+
Sbjct: 256 SEKTW-----SKCPICYSSVHKKDLKSVVATESRQYVVGDTITMQLMKREKGVLVALPKS 310

Query: 204 KQESTTGSI---DETYDPFSKFTFTSDVDL---SVRKAMSDLDGWLA------------- 244
           K  +    I   DE +  +SK    S   +    V++  + L+  LA             
Sbjct: 311 KWMNVDHPIHLGDEQHSQYSKLLLASKEQVLRRVVQEEKAALERQLAEEKHTPESCFIEA 370

Query: 245 ---------KADSGLVDDLEKLPYVCAAMEQ 266
                    +A SGL +   ++P V AA+EQ
Sbjct: 371 AIQELKAREEALSGLAESRGEVPGVVAALEQ 401

Bos taurus (taxid: 9913)

>sp\|Q3UIW5\|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2	Back alignment and function description

>sp\|Q32NQ8\|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1	Back alignment and function description

>sp\|Q5XI59\|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1	Back alignment and function description

>sp\|Q8N5U6\|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2	Back alignment and function description

>sp\|O94271\|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=4 SV=1	Back alignment and function description

>sp\|Q06436\|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1	Back alignment and function description

>sp\|Q6CHI1\|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1	Back alignment and function description

>sp\|P40072\|SLX8_YEAST E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLX8 PE=1 SV=1	Back alignment and function description

>sp\|Q6BLM3\|RAD18_DEBHA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD18 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		549
224128814		622	predicted protein [Populus trichocarpa]	0.854	0.754	0.625	1e-179
356571636		747	PREDICTED: RING finger protein 10-like [	0.863	0.634	0.597	1e-179
359488431		765	PREDICTED: RING finger protein 10-like [	0.877	0.630	0.600	1e-177
255543557		746	conserved hypothetical protein [Ricinus	0.857	0.631	0.603	1e-176
357508423		744	RING finger protein [Medicago truncatula	0.881	0.650	0.594	1e-175
356560432		838	PREDICTED: RING finger protein 10-like [	0.863	0.565	0.593	1e-172
297814906		760	hypothetical protein ARALYDRAFT_484446 [	0.865	0.625	0.581	1e-171
22331355		772	RING/U-box domain-containing protein [Ar	0.881	0.626	0.572	1e-170
449492935		654	PREDICTED: RING finger protein 10-like [	0.856	0.718	0.570	1e-159
449455928		742	PREDICTED: RING finger protein 10-like [	0.854	0.632	0.563	1e-158

>gi\|224128814\|ref\|XP_002320428.1\| predicted protein [Populus trichocarpa] gi\|222861201\|gb\|EEE98743.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 336/537 (62%), Positives = 391/537 (72%), Gaps = 68/537 (12%)

Query: 6   VSPRSQQRAGPVASQG----SSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKI 61
            SP+SQQ  G V S+G    +SGRRAQ  + NHLLNF YDPISRPQ R PP   RR +K 
Sbjct: 1   ASPQSQQSVGSVNSRGGTTHASGRRAQMTNANHLLNFHYDPISRPQPRAPP--PRRPQKK 58

Query: 62  RPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYPL 121
           R YNKDLFLQANYKFVVLDTG +APESMDPDKML+WEDIICVRYS    VQCPICLEYPL
Sbjct: 59  RAYNKDLFLQANYKFVVLDTGSYAPESMDPDKMLKWEDIICVRYSTTFPVQCPICLEYPL 118

Query: 122 CPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHAV 181
           CPQITSCGHIFCFPCIL+YLLMG+ED+KGDCFKRCPLCFVMIS K+LYTI+IE V+Q+ +
Sbjct: 119 CPQITSCGHIFCFPCILRYLLMGEEDHKGDCFKRCPLCFVMISPKDLYTIYIEKVKQYCI 178

Query: 182 GDTIEFMLLIREKDSFVPSRKNKQESTTG--SIDETYDPFSKFTFTSDVDLSVRKAMSDL 239
           G+TIEFMLL R+K SFVPS K + E+ T   S D  YDPFSKFTFTSDV+LSVRKA+SDL
Sbjct: 179 GETIEFMLLTRQKHSFVPSMKIEPEADTELCSNDNIYDPFSKFTFTSDVELSVRKAISDL 238

Query: 240 DGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQ 299
           D WL +ADSGLVDDLEKLPYVCAAMEQLE+RKKYWNE++A   D+  N ++ Q G  GL 
Sbjct: 239 DSWLVRADSGLVDDLEKLPYVCAAMEQLEKRKKYWNEQKACHDDRF-NVSNSQKGSQGL- 296

Query: 300 STKIASNPSHLLNTLSPDISEQNQKLTKLTLNKPDSGSASGQNSALGELSDCDETSLSSS 359
                                    L+ LT             +A GE   C   S + S
Sbjct: 297 -------------------------LSSLT-------------TAKGEHKACSSRSATPS 318

Query: 360 YDESKSMQANETSLSSSYDESKSLQANETSLSSSYDESKSMQANETSLSSSYDESKSLQA 419
            D +   + ++  +    D  +S +  +++LSSSY+E+K+ Q                 A
Sbjct: 319 IDINNKNKGSDNVMG---DVVESPEDEDSALSSSYEENKNFQT---------------HA 360

Query: 420 NFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVT 479
           N  G  ++KDK+SYNFYQAIDGQHLILHPLN+KCLLHHYGSYD+LPHR+SG ILQLE++T
Sbjct: 361 N--GYRDVKDKESYNFYQAIDGQHLILHPLNMKCLLHHYGSYDLLPHRVSGTILQLETIT 418

Query: 480 QSEAMRRRYRYLSHFSLTTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANK 536
           QSEAMRRRYRYLSHFSLTTTFQLCEIDL  ALPP+AL PF+DEI+KREK RKQLANK
Sbjct: 419 QSEAMRRRYRYLSHFSLTTTFQLCEIDLNAALPPNALLPFMDEIKKREKLRKQLANK 475

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356571636\|ref\|XP_003553982.1\| PREDICTED: RING finger protein 10-like [Glycine max]	Back alignment and taxonomy information

>gi\|359488431\|ref\|XP_002275712.2\| PREDICTED: RING finger protein 10-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255543557\|ref\|XP_002512841.1\| conserved hypothetical protein [Ricinus communis] gi\|223547852\|gb\|EEF49344.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357508423\|ref\|XP_003624500.1\| RING finger protein [Medicago truncatula] gi\|355499515\|gb\|AES80718.1\| RING finger protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356560432\|ref\|XP_003548496.1\| PREDICTED: RING finger protein 10-like [Glycine max]	Back alignment and taxonomy information

>gi\|297814906\|ref\|XP_002875336.1\| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. lyrata] gi\|297321174\|gb\|EFH51595.1\| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|22331355|ref|NP_189307.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|11994306|dbj|BAB01736.1| unnamed protein product [Arabidopsis thaliana] gi|18377743|gb|AAL67021.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|27754738|gb|AAO22812.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|332643684|gb|AEE77205.1| RING/U-box domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|449492935\|ref\|XP_004159146.1\| PREDICTED: RING finger protein 10-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449455928\|ref\|XP_004145702.1\| PREDICTED: RING finger protein 10-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		549
TAIR\|locus:2090827		772	AT3G26730 "AT3G26730" [Arabido	0.661	0.470	0.592	1.5e-155
MGI\|MGI:1859162		804	Rnf10 "ring finger protein 10"	0.377	0.257	0.355	7.8e-49
UNIPROTKB\|Q32NQ8		756	rnf10 "RING finger protein 10"	0.336	0.244	0.382	8.3e-49
UNIPROTKB\|Q08E13		810	RNF10 "RING finger protein 10"	0.451	0.306	0.317	1.1e-48
RGD\|1309282		802	Rnf10 "ring finger protein 10"	0.377	0.258	0.346	4.1e-48
UNIPROTKB\|Q5XI59		802	Rnf10 "RING finger protein 10"	0.377	0.258	0.346	4.1e-48
UNIPROTKB\|Q8N5U6		811	RNF10 "RING finger protein 10"	0.451	0.305	0.309	1.2e-47
UNIPROTKB\|J9PBL6		749	RNF10 "Uncharacterized protein	0.377	0.276	0.342	2.3e-47
UNIPROTKB\|E2RE56		961	RNF10 "Uncharacterized protein	0.377	0.215	0.342	6.3e-47
ZFIN\|ZDB-GENE-030131-2969		778	rnf10 "ring finger protein 10"	0.449	0.317	0.330	4.2e-45

TAIR\|locus:2090827 AT3G26730 "AT3G26730" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1082 (385.9 bits), Expect = 1.5e-155, Sum P(2) = 1.5e-155
 Identities = 224/378 (59%), Positives = 271/378 (71%)

Query:     2 SGDSVSPRSQQRAGPVASQGSSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQR-K 60
             SG   SPR     G V+    +GRRA  ISGNHLLNFQYDPIS+PQ R PPPP RRQ+ K
Sbjct:   138 SGPFNSPR-----GGVSHHNPTGRRANMISGNHLLNFQYDPISQPQSRGPPPPQRRQQYK 192

Query:    61 IRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICLEYP 120
              RP+NKDLFL+ANYKFVVLDTGDH+P+SMDPDKMLQW+DIICVRYS P  VQCPICLEYP
Sbjct:   193 GRPFNKDLFLKANYKFVVLDTGDHSPDSMDPDKMLQWDDIICVRYSTPSPVQCPICLEYP 252

Query:   121 LCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHA 180
             LCPQITSCGHIFCFPCILQYLL G +++K DCFKRCPLCFVMIS +ELYT++IENV+Q++
Sbjct:   253 LCPQITSCGHIFCFPCILQYLLTGVDNHKVDCFKRCPLCFVMISPRELYTVYIENVKQYS 312

Query:   181 VGDTIEFMLLIREKDSFVPSRKNKQE-STTGSIDETYDPFSKFTFTSDVDLSVRKAMSDL 239
             VGD IEF+LL R+KDSF P+RKN+ + +     +E YDPFSKFTFT DVDLSVR+A+S+L
Sbjct:   313 VGDPIEFVLLTRKKDSFAPTRKNEHDLAVPNGENEIYDPFSKFTFTQDVDLSVRQAVSEL 372

Query:   240 DGWLAKADSGLVDDLEKLPYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQ 299
             D W+A+AD  LV+DLEK  YV AA+E+LEQRK YWNE + S   K    A  QT      
Sbjct:   373 DSWIARADPQLVEDLEKHLYVNAALERLEQRKLYWNEHKLSIYSKVCTTARNQTQSLSPP 432

Query:   300 STKIASNPSHLLNTLSPDISEQNQ-KLTK-LTLNKPDSGSAS----GQNSALGE-LSDCD 352
                     + +    +PD    +Q K T+  + +K D  S S    G ++ LG  L D D
Sbjct:   433 DVSRVGYQAPMGGHGAPDSGSNDQDKSTEDSSADKSDGESQSSLEKGCDNDLGHPLEDQD 492

Query:   353 ETSLSSSYDESKSMQANE 370
               S SSS + SK   +++
Sbjct:   493 APS-SSSCNGSKGFLSHQ 509

GO:0008150 "biological_process" evidence=ND

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0007131 "reciprocal meiotic recombination" evidence=RCA

GO:0033044 "regulation of chromosome organization" evidence=RCA

GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA

GO:0045132 "meiotic chromosome segregation" evidence=RCA

MGI\|MGI:1859162 Rnf10 "ring finger protein 10" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q32NQ8 rnf10 "RING finger protein 10" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|Q08E13 RNF10 "RING finger protein 10" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1309282 Rnf10 "ring finger protein 10" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5XI59 Rnf10 "RING finger protein 10" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N5U6 RNF10 "RING finger protein 10" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PBL6 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RE56 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2969 rnf10 "ring finger protein 10" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.XIV.3075.1	hypothetical protein (622 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		549
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	7e-11
smart00184		40	smart00184, RING, Ring finger	1e-10
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	8e-10
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	1e-08
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	1e-07
COG5574		271	COG5574, PEX10, RING-finger-containing E3 ubiquiti	6e-06
pfam12678		73	pfam12678, zf-rbx1, RING-H2 zinc finger	3e-04
PLN03208		193	PLN03208, PLN03208, E3 ubiquitin-protein ligase RM	7e-04
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	0.001
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	0.003

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

 Score = 57.1 bits (138), Expect = 7e-11
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 112 QCPICLEYPLCP-QITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLC 159
           +CPICLE    P  +  CGH+FC  CI ++L  G           CPLC
Sbjct: 1   ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGK--------NTCPLC 41

Length = 45

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|221705 pfam12678, zf-rbx1, RING-H2 zinc finger	Back alignment and domain information

>gnl\|CDD\|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		549
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	100.0
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.25
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	99.2
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	99.09
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.07
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	99.02
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.94
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.89
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.77
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.73
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.73
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	98.72
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.69
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.68
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.66
PHA02929		238	N1R/p28-like protein; Provisional	98.66
PHA02926		242	zinc finger-like protein; Provisional	98.62
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	98.59
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.54
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.52
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.45
PF14634		44	zf-RING_5: zinc-RING finger domain	98.43
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.4
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.39
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.22
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	98.18
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.1
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.04
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	98.03
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.99
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	97.78
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	97.71
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	97.71
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.68
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	97.65
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.63
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	97.53
KOG2660		331	consensus Locus-specific chromosome binding protei	97.46
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.43
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.28
COG5152		259	Uncharacterized conserved protein, contains RING a	97.2
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.07
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	97.07
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.02
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	96.98
KOG3039		303	consensus Uncharacterized conserved protein [Funct	96.94
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	96.77
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	96.7
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	96.69
KOG0297		391	consensus TNF receptor-associated factor [Signal t	96.65
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	96.51
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	96.48
KOG1001		674	consensus Helicase-like transcription factor HLTF/	96.48
PF04641		260	Rtf2: Rtf2 RING-finger	96.45
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	96.44
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	96.43
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	96.33
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	96.31
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.16
COG5219		1525	Uncharacterized conserved protein, contains RING Z	95.76
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	95.52
KOG0825		1134	consensus PHD Zn-finger protein [General function	95.48
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	95.16
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	94.85
KOG4739		233	consensus Uncharacterized protein involved in syna	94.84
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	94.73
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	94.25
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	93.86
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	93.71
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	93.5
KOG4367		699	consensus Predicted Zn-finger protein [Function un	93.43
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	93.26
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	93.22
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	93.16
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	93.05
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	92.98
COG5175		480	MOT2 Transcriptional repressor [Transcription]	92.8
KOG3039		303	consensus Uncharacterized conserved protein [Funct	92.66
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	92.38
COG5236		493	Uncharacterized conserved protein, contains RING Z	92.09
KOG3002		299	consensus Zn finger protein [General function pred	90.91
PF10377		129	ATG11: Autophagy-related protein 11; InterPro: IPR	90.87
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	90.8
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	89.86
KOG1941		518	consensus Acetylcholine receptor-associated protei	89.18
PHA03096		284	p28-like protein; Provisional	88.79
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	87.74
COG5109		396	Uncharacterized conserved protein, contains RING Z	87.37
KOG4445		368	consensus Uncharacterized conserved protein, conta	87.28
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	87.25
KOG0298		1394	consensus DEAD box-containing helicase-like transc	86.61
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	86.31
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	85.59
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	85.57
KOG3579		352	consensus Predicted E3 ubiquitin ligase [Posttrans	85.38
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	85.11
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	84.36
KOG0825		1134	consensus PHD Zn-finger protein [General function	83.89
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	82.94
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	81.19

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=1.8e-58  Score=482.85  Aligned_cols=367  Identities=35%  Similarity=0.567  Sum_probs=236.1

Q ss_pred             CCCCCccccCccccccCcccCCCCCCCCCCCCCCccccCCCCCCCcccccccCcEEEeCCCCCCCCCCCCcCcCCcchhh
Q 008905           21 GSSGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDI  100 (549)
Q Consensus        21 ~~~grK~q~~~~nhLlnf~~~~~~~~~~~~~~~~~r~~~~~~~~~k~~fl~an~~Fvv~~~~dy~~~~~dpd~~v~w~~i  100 (549)
                      ...|+++|+ |+||||||+|.+++ +.++... ++++.+..+.+.. +|++|||+|||+ .|+|..+..|||.+++|++|
T Consensus       104 ~e~~~a~~v-s~nhllnf~~~~~~-~~~q~~~-p~~~~~~~~~~~q-~f~~any~fvv~-~gd~~~qn~dpD~p~~~e~i  178 (513)
T KOG2164|consen  104 PEVNLANQV-SLNHLLNFQYAPIE-NSHQSSS-PPRRNRRRDEREQ-TFLNANYRFVVD-EGDYVLQNTDPDAPVDWEDI  178 (513)
T ss_pred             hhhhhhhhh-hhhhhhheeecccc-hhhccCC-Cccccccccccch-hhhccchheeec-ccchhhhccCCccccchHHh
Confidence            344578887 99999999999987 4433332 2233322222222 999999999999 99999999999999999999


Q ss_pred             hhhhcCCCCCCcccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCceeEEeecccccC
Q 008905          101 ICVRYSNPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIHIENVRQHA  180 (549)
Q Consensus       101 ~~v~~~~~~~~~CpICle~~~~P~~t~CGH~FC~~CI~~~~~~~~~~~k~~~~~~CP~Cr~~i~~~~l~~v~~~~~~~~~  180 (549)
                      .++...+  ...|||||+++..|.+|.|||+||++||++||..+.    ..+++.||+|+..|..++|.+|++++.+...
T Consensus       179 ~qv~~~t--~~~CPICL~~~~~p~~t~CGHiFC~~CiLqy~~~s~----~~~~~~CPiC~s~I~~kdl~pv~~e~~qkke  252 (513)
T KOG2164|consen  179 FQVYGST--DMQCPICLEPPSVPVRTNCGHIFCGPCILQYWNYSA----IKGPCSCPICRSTITLKDLLPVFIEDDQKKE  252 (513)
T ss_pred             hhhhcCc--CCcCCcccCCCCcccccccCceeeHHHHHHHHhhhc----ccCCccCCchhhhccccceeeeeeccccccH
Confidence            9988776  899999999999999999999999999999999862    2357999999999999999999998763211


Q ss_pred             CCCceEEEEeecCCCCccccccCCCCCCCCCCCCccccCCceeecccchHHHHHHHhhhHHHHHhhcCcchhccccc---
Q 008905          181 VGDTIEFMLLIREKDSFVPSRKNKQESTTGSIDETYDPFSKFTFTSDVDLSVRKAMSDLDGWLAKADSGLVDDLEKL---  257 (549)
Q Consensus       181 ~g~~v~l~L~~R~~~s~~p~~~~~~~~~~~~~~~~~~~Fskf~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~e~~---  257 (549)
                           .++++.++.| +.......       ..+.......|+  .+...+++.+...      +...+.. ++...   
T Consensus       253 -----~l~~~~~~ng-~~~~~r~F-------~~d~~r~~p~fl--~dl~~~a~~~i~~------~~~~~~l-~i~~~~~i  310 (513)
T KOG2164|consen  253 -----ELKLHQDPNG-IPDYNRRF-------SGDPARFVPDFL--MDLPTYARINIRN------MFNNHIL-TIVDQVCI  310 (513)
T ss_pred             -----HHHHHhcccC-CCccccce-------ecCcccccHHHH--HhHHHHHHHHHHH------hhcccce-eehhhHhH
Confidence                 1556666655 11111110       000000011121  1111122222111      0000100 01000   


Q ss_pred             --HHHHHHHHHHHHHHHHHHhhhhcCCCcccCCCCCCCCcCCcccccccCCCCcccCCCCcchhHHHHHhhhhccCCCCC
Q 008905          258 --PYVCAAMEQLEQRKKYWNERRASGSDKASNNADGQTGFHGLQSTKIASNPSHLLNTLSPDISEQNQKLTKLTLNKPDS  335 (549)
Q Consensus       258 --~~i~~a~~~l~~r~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  335 (549)
                        .|+.+++..+..++                   .     .+..    .+  +....+++.++++..            
T Consensus       311 ~~v~i~~~~~~~~~~~-------------------~-----~~q~----~~--~~is~lde~~~~~l~------------  348 (513)
T KOG2164|consen  311 AAVFICQYLSFLLPRR-------------------M-----VPQA----IK--GRISFLDECTNDQLI------------  348 (513)
T ss_pred             HHHHHHHHhcccchhh-------------------h-----cchh----hc--CccCchhhhcchhhh------------
Confidence              01111111000000                   0     0000    00  000000000110000            


Q ss_pred             CCCCCCCCccCCCCcccccccCCccchhhhhhcccccccCCcchhhhhhhccccccCCcccccccccccccccCcccccc
Q 008905          336 GSASGQNSALGELSDCDETSLSSSYDESKSMQANETSLSSSYDESKSLQANETSLSSSYDESKSMQANETSLSSSYDESK  415 (549)
Q Consensus       336 ~~~s~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~  415 (549)
                               +.+.+.                      ...   +.      ..+...+-+                   .
T Consensus       349 ---------ls~~s~----------------------~dn---e~------n~s~~~~~~-------------------~  369 (513)
T KOG2164|consen  349 ---------LSEMSR----------------------IDN---EY------NASRGLGRD-------------------D  369 (513)
T ss_pred             ---------hhhhhh----------------------hhh---hh------hhhhccccc-------------------c
Confidence                     000000                      000   00      000001100                   0


Q ss_pred             cccccCCCCccCCCCCceEEEecCCCCceeechhcHHHHHHhhCCCCCCCccceeeEEEEEeeccCHHHHhhhccccccC
Q 008905          416 SLQANFTGSTEIKDKDSYNFYQAIDGQHLILHPLNLKCLLHHYGSYDMLPHRISGRILQLESVTQSEAMRRRYRYLSHFS  495 (549)
Q Consensus       416 ~~~~~~~~~~~~~~~~~yyFYQa~dgq~ifLhPLdiKiL~~~fGsy~~~P~~I~~kV~eie~~~~~e~~Rkr~kyLsHLP  495 (549)
                      ++        .....++|||||..|||||||||||||||+++| +|+.| +.|.++|++||+  |+|++|+|||||+|||
T Consensus       370 dl--------~~~~~~~y~fyq~~~~~~i~L~pldvk~L~~~~-~yd~f-~~i~~~i~~m~~--~~e~~rrr~~~i~hlp  437 (513)
T KOG2164|consen  370 DL--------LSVSGDAYYFYQSVDGQHIYLHPLDVKILLACY-SYDLF-DEIEAQIENMEQ--VDEELRRRFKYIGHLP  437 (513)
T ss_pred             cc--------cCccccceeeecccccceeeecccchhHhhhhh-hhhhH-HHHHHHHHHHHH--HhHHHHhhhhheeecc
Confidence            00        012238899999999999999999999999999 99999 999999999999  9999999999999999


Q ss_pred             CCceEEEEEecCCCCCChhhHhhhHHHHHHHHHHHHHHHhh
Q 008905          496 LTTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANK  536 (549)
Q Consensus       496 l~~~~~f~EiDl~~~V~~e~L~~F~~eL~kR~k~R~~k~r~  536 (549)
                      +|   +++||||..+|++++|..|+.||++|+|+|++|+++
T Consensus       438 ~~---t~~~~d~~ki~p~~i~~~f~~ei~~r~k~r~~r~~~  475 (513)
T KOG2164|consen  438 LG---TVLECDWQKILPKEILKLFKHEIKKRRKQRKRRDRK  475 (513)
T ss_pred             Cc---eeEEeeccccCCHHHHHHhHHHHHHHHHHHHHHHHH
Confidence            99   899999999999999999999999999999999883

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>PF10377 ATG11: Autophagy-related protein 11; InterPro: IPR019460 This family consists of proteins involved in telomere maintenance	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		549
2ysj_A		63	Solution Structure Of The Ring Domain (1-56) From T		9e-04

>pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63

Back alignment and structure

Iteration: 1
 Score = 42.0 bits (97), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 8/50 (16%)
Query: 111 VQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDC-FKRCPLC 159
           V CPICL+    P    CGH FC  CI Q   +G+      C F +CPLC
Sbjct: 21  VICPICLDILQKPVTIDCGHNFCLKCITQ---IGET----SCGFFKCPLC 63

PyMOL of 2ysj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		549
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	1e-11
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	7e-11
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	1e-10
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	2e-10
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-10
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	2e-10
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	3e-10
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	4e-10
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	6e-10
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	9e-10
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	1e-09
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	1e-09
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	1e-09
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	2e-09
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	2e-09
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	3e-09
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	4e-09
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	1e-08
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	1e-08
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-08
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	1e-08
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	2e-08
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	5e-08
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	6e-08
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	7e-08
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	7e-08
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	9e-08
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	2e-07
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	3e-07
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	4e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	4e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	1e-06
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	3e-06
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	3e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	4e-06
1z6u_A		150	NP95-like ring finger protein isoform B; structura	5e-06
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	2e-05
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	7e-05
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	2e-04
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	4e-04
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	4e-04
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	7e-04
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	7e-04

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

 Score = 59.5 bits (144), Expect = 1e-11
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 9/48 (18%)

Query: 112 QCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLC 159
           +C ICL+  + P    C H+FC+ C+                KRC LC
Sbjct: 17  ECAICLQTCVHPVSLPCKHVFCYLCVKGAS---------WLGKRCALC 55

PyMOL of 2d8t

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		549
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.26
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.22
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.21
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.2
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.18
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.18
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.18
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.17
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.16
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.16
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.15
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.14
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.13
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.12
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.12
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.11
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.11
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.11
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.1
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.09
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.09
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.09
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.09
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.08
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.05
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.04
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.03
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.03
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.02
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.01
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.01
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.0
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.98
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.98
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.98
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.96
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.96
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.95
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.94
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.94
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.92
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.92
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	98.89
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.89
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.89
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.88
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.88
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.87
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.86
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.85
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.82
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.82
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.81
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	98.75
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.74
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.67
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.66
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.63
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.59
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.59
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.46
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.45
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.45
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.37
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.22
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.16
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.1
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.7
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	97.54
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	97.27
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	97.13
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	95.16
3nw0_A		238	Non-structural maintenance of chromosomes element	93.53
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	93.19
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	88.05
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	88.03
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	86.38
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	83.63

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

Probab=99.26  E-value=4.4e-12  Score=103.23  Aligned_cols=56  Identities=30%  Similarity=0.437  Sum_probs=49.1

Q ss_pred             CCCCCcccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCcee
Q 008905          107 NPLSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYT  170 (549)
Q Consensus       107 ~~~~~~CpICle~~~~P~~t~CGH~FC~~CI~~~~~~~~~~~k~~~~~~CP~Cr~~i~~~~l~~  170 (549)
                      .++.+.||||++.+.+|++++|||+||..||..|+..+        ...||+|+..+...++.+
T Consensus         5 ~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~~~--------~~~CP~C~~~~~~~~l~~   60 (78)
T 1t1h_A            5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAG--------HKTCPKSQETLLHAGLTP   60 (78)
T ss_dssp             CSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTT--------CCBCTTTCCBCSSCCCEE
T ss_pred             CcccCCCCCccccccCCEEcCCCCeecHHHHHHHHHHC--------cCCCCCCcCCCChhhCcc
Confidence            35688999999999999999999999999999999752        278999999998777665

PyMOL of 1t1h

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		549
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	2e-11
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	2e-10
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	4e-09
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	3e-08
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	5e-08
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	2e-07
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	1e-06
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	3e-06
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-06
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	8e-06
d2c2la2		80	g.44.1.2 (A:225-304) STIP1 homology and U box-cont	4e-05
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	4e-05
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	4e-05
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	5e-04
d1v87a_		114	g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou	0.001
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	0.003

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.7 bits (139), Expect = 2e-11
 Identities = 15/60 (25%), Positives = 21/60 (35%), Gaps = 8/60 (13%)

Query: 113 CPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYTIH 172
           C IC E     +I  CGH+ C  C+  +             + CP C   I   E   + 
Sbjct: 26  CKICAENDKDVKIEPCGHLMCTSCLTSWQESEG--------QGCPFCRCEIKGTEPIVVD 77

PyMOL of d1fbva4

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		549
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.33
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.26
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.25
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.24
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.24
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.21
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.17
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.12
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.02
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.97
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.96
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.95
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.9
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.77
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.45
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.41
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.06
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	91.5

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.33  E-value=3.2e-13  Score=110.61  Aligned_cols=54  Identities=35%  Similarity=0.637  Sum_probs=47.4

Q ss_pred             CCCcccccCcCCCCceEcCCCCcccHHHHHHHHHcCCCCCCCCCcCCCCCCcccccCCCcee
Q 008905          109 LSVQCPICLEYPLCPQITSCGHIFCFPCILQYLLMGDEDYKGDCFKRCPLCFVMISSKELYT  170 (549)
Q Consensus       109 ~~~~CpICle~~~~P~~t~CGH~FC~~CI~~~~~~~~~~~k~~~~~~CP~Cr~~i~~~~l~~  170 (549)
                      +.+.||||++.+.+|++++|||+||+.||.+|+....        ..||+||.++...++.+
T Consensus        22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~--------~~CP~Cr~p~~~~~l~~   75 (86)
T d1rmda2          22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMG--------SYCPSCRYPCFPTDLES   75 (86)
T ss_dssp             HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTC--------SBCTTTCCBCCGGGCBC
T ss_pred             cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCC--------CcCcccCCCCChhhccC
Confidence            3578999999999999999999999999999997632        68999999998777653

PyMOL of d1rmda2

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure