Citrus Sinensis ID: 008948

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55

MYLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGESRNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEEENDLENGRDTGVNTTIIIIDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLVRLV

cHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEccccccEEEEEEEccEEEEEEHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEcccccccccccEEEEEccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccEEEEEEEcccccHHHHHHHHHHHHcccccEEEc

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHccHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcHHHHHccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEcccccEEcccEEEEEEcccccccccccEEEcccccccEEEEEEEEccHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEcccccHHHHHHHEEEEcccccEEEEc

MYLQIISLSASANKLSNIQKQAEEYAALIMEEldpdhlgciMIDNLEMLLlqapaqsvkggesrnlshmlsqklkptqfdnpirrccdstmYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRnktklsgvvpfddnlnfHKVIAVGISIGVGIHAIshlacdfprlinaseekyepmepyfgdqpknyWHFVKSVEGVTGIVMVVLMAIAFTLAtpwfrrnklnlpkplkkltgfnafwySHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLalhmskpdrfryksgqymfvncaavspfewhpfsitsapdddylsVHIRTLGDWTRQLRTVFsevcrpppngisgllraeghnnpdfprvlidgpygapaqdykEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEeendlengrdtgvnTTIIIIdnnyepfffwtqkkgpiqdkkSILLLGYKRARLVRLV

MYLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGESRNLSHMlsqklkptqfdnpIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSikavsiqkvaVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSitsapdddyLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEeendlengrdtgVNTTIIIIDNNYEPFFFWTQkkgpiqdkksilllgykrarlvrlv

MYLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGESRNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKviavgisigvgihaishLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRnklnlpkplkklTGFNAFWYSHHLFVIVYTLLIVHGQylyltkkwykkttwmylAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIeeeeeNDLENGRDTGVNTTIIIIDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLVRLV

**********************EEYAALIMEELDPDHLGCIMIDNLEMLLLQA*************************FDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAI*************TGVNTTIIIIDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLV***

*YLQIISLS************AEEYAALIMEELDPDHLGCIMIDNLEM***************************************DSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCR***********AEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAI****************NTTIIIIDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLVRLV

MYLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPA**********LSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEEENDLENGRDTGVNTTIIIIDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLVRLV

MYLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSV*GGESRNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRP*****SGLLRA***NNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAI**********************IDNNYEPFFFWTQKKGPIQDKKSILLLGYKRARLVRLV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		548	2.2.26 [Sep-21-2011]
Q2HXL0		938	Respiratory burst oxidase	N/A	no	0.903	0.527	0.788	0.0
Q9FIJ0		921	Respiratory burst oxidase	yes	no	0.959	0.571	0.726	0.0
O81210		905	Respiratory burst oxidase	no	no	0.970	0.587	0.706	0.0
Q2HXK9		858	Respiratory burst oxidase	N/A	no	0.936	0.597	0.725	0.0
O81209		902	Respiratory burst oxidase	no	no	0.888	0.539	0.731	0.0
Q948T9		867	Respiratory burst oxidase	N/A	no	0.954	0.603	0.644	0.0
Q9SW17		849	Putative respiratory burs	no	no	0.939	0.606	0.644	0.0
Q5ZAJ0		905	Respiratory burst oxidase	yes	no	0.881	0.533	0.651	0.0
Q6J2K5		905	Respiratory burst oxidase	N/A	no	0.881	0.533	0.651	0.0
Q9SBI0		843	Respiratory burst oxidase	no	no	0.943	0.613	0.605	0.0

>sp\|Q2HXL0\|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2	Back alignment and function desciption

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/500 (78%), Positives = 446/500 (89%), Gaps = 5/500 (1%)

Query: 4   QIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSV-KGGE 62
           +II LSASAN+LS IQKQ++EYAA+IMEELDP++LG IMI+NLEMLLLQAP QSV +GGE
Sbjct: 272 EIIGLSASANRLSTIQKQSDEYAAMIMEELDPNNLGYIMIENLEMLLLQAPNQSVQRGGE 331

Query: 63  SRNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQY 122
           SRNLS MLSQKLK TQ  NP+ R   S MYFLLDNWQRVWV+  WIG+MA LFT+KYIQY
Sbjct: 332 SRNLSQMLSQKLKHTQEPNPLVRWYKSFMYFLLDNWQRVWVLLLWIGIMAVLFTWKYIQY 391

Query: 123 KNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNF 182
           K +AA++VMG CVC+AKGAAET+K NMA+ILLPVCRNTITWLRNKT+L   VPFDDNLNF
Sbjct: 392 KQKAAYDVMGPCVCLAKGAAETIKLNMAIILLPVCRNTITWLRNKTRLGSAVPFDDNLNF 451

Query: 183 HKVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVT 242
           HKVIAV I++GV IH ++HL CDFP+L+NASEE YEPM  YFG+QP++YW FV+ VEGVT
Sbjct: 452 HKVIAVAIALGVAIHGLAHLTCDFPKLLNASEEAYEPMIYYFGEQPESYWWFVRGVEGVT 511

Query: 243 GIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYL 302
           GI+MVVLMAIAFTLATPWFRR +++ PKP  KLTGFNAFWYSHHLF+IVYTLLIVHG+ L
Sbjct: 512 GIIMVVLMAIAFTLATPWFRRGRVSFPKPFHKLTGFNAFWYSHHLFIIVYTLLIVHGEKL 571

Query: 303 YLTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDR 362
           Y+TK WYK++TWMYL +P+ LYA ERL+RA RSSIKAV I KVAVYPGNVLALHMSKP  
Sbjct: 572 YITKDWYKRSTWMYLTVPLVLYAGERLLRAFRSSIKAVKILKVAVYPGNVLALHMSKPQG 631

Query: 363 FRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPP 422
           ++YKSGQYMFVNCAAVSPFEWHPFSITSAP DD+LSVHIRTLGDWTRQL+TVFSEVC+PP
Sbjct: 632 YKYKSGQYMFVNCAAVSPFEWHPFSITSAPGDDHLSVHIRTLGDWTRQLKTVFSEVCQPP 691

Query: 423 PNGISGLLRA---EGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVK 479
           PNG SGLLRA   +G NNP+FPRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVK
Sbjct: 692 PNGKSGLLRADYLQGENNPNFPRVLIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVK 751

Query: 480 DIVNNMKAIEEEEENDLENG 499
           DIVNNMKA+ +EEEN LENG
Sbjct: 752 DIVNNMKAM-DEEENSLENG 770

Calcium-dependent NADPH oxidase that generates superoxide. May be responsible for the oxidative burst in response to pathogen attack in the leaves.
Solanum tuberosum (taxid: 4113)
EC: 1EC: .EC: 6EC: .EC: 3EC: .EC: -

>sp\|Q9FIJ0\|RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana GN=RBOHD PE=1 SV=1	Back alignment and function description

>sp\|O81210\|RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2	Back alignment and function description

>sp\|Q2HXK9\|RBOHD_SOLTU Respiratory burst oxidase homolog protein D OS=Solanum tuberosum GN=RBOHD PE=1 SV=2	Back alignment and function description

>sp\|O81209\|RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2	Back alignment and function description

>sp\|Q948T9\|RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1	Back alignment and function description

>sp\|Q9SW17\|RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana GN=RBOHG PE=2 SV=2	Back alignment and function description

>sp\|Q5ZAJ0\|RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica GN=RBOHB PE=1 SV=1	Back alignment and function description

>sp\|Q6J2K5\|RBOHB_ORYSI Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica GN=RBOHB PE=2 SV=1	Back alignment and function description

>sp\|Q9SBI0\|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		548
224122270		906	predicted protein [Populus trichocarpa]	0.965	0.583	0.775	0.0
255539989		910	respiratory burst oxidase, putative [Ric	0.905	0.545	0.834	0.0
20805911		938	NADPH oxidase [Nicotiana tabacum] gi\|125	0.912	0.533	0.805	0.0
28268680		939	respiratory burst oxidase homolog [Nicot	0.912	0.532	0.8	0.0
159078850		937	NADPH oxidase [Nicotiana attenuata]	0.908	0.531	0.801	0.0
19715905		939	NADPH oxidase [Nicotiana tabacum]	0.912	0.532	0.794	0.0
224072447		726	predicted protein [Populus trichocarpa]	0.972	0.734	0.738	0.0
166199749		938	RecName: Full=Respiratory burst oxidase	0.903	0.527	0.788	0.0
350536915		938	whitefly-induced gp91-phox [Solanum lyco	0.903	0.527	0.786	0.0
224136376		915	predicted protein [Populus trichocarpa]	0.916	0.548	0.795	0.0

>gi\|224122270\|ref\|XP_002318793.1\| predicted protein [Populus trichocarpa] gi\|222859466\|gb\|EEE97013.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/547 (77%), Positives = 469/547 (85%), Gaps = 18/547 (3%)

Query: 4   QIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGES 63
           +II+LSASANKLSNIQKQAEEYAALIMEELDP++ G I+I+NLEMLLLQ   QSV+G ES
Sbjct: 249 EIITLSASANKLSNIQKQAEEYAALIMEELDPENHGYILIENLEMLLLQGSNQSVRG-ES 307

Query: 64  RNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYK 123
           RNLSHMLSQKLKPT   NP+ R C ST YFLLDNWQRVWVMA WI  MA LF YKYIQY+
Sbjct: 308 RNLSHMLSQKLKPTLDSNPLNRWCRSTKYFLLDNWQRVWVMALWIVFMASLFAYKYIQYR 367

Query: 124 NRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFH 183
            R A+EVMGHCVCMAKGAAETLK NMALILLPVCRNT+TWLRNKTKL  VVPFDDNLNFH
Sbjct: 368 RREAYEVMGHCVCMAKGAAETLKLNMALILLPVCRNTLTWLRNKTKLGVVVPFDDNLNFH 427

Query: 184 KVIAVGISIGVGIHAISHLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTG 243
           KVIAVGI++GVGIH ISHLACDFPRL+ ASEEK+E M+ +FGDQP +YWHFVKS EGVTG
Sbjct: 428 KVIAVGIAVGVGIHGISHLACDFPRLLQASEEKWELMQQFFGDQPSSYWHFVKSKEGVTG 487

Query: 244 IVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLY 303
           IVMVVLMAIAFTLATPWFRRNKLNLP  LKKLTGFNAFWYSHHLFVIVYTLL+VHG YLY
Sbjct: 488 IVMVVLMAIAFTLATPWFRRNKLNLPTWLKKLTGFNAFWYSHHLFVIVYTLLVVHGYYLY 547

Query: 304 LTKKWYKKTTWMYLAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRF 363
           LT KWYKKTTWMYLA+P+ LY +ERLIRALRSSIKAV+IQKVA+YPGNVLALHMSKP  F
Sbjct: 548 LTHKWYKKTTWMYLAVPVILYGSERLIRALRSSIKAVTIQKVAIYPGNVLALHMSKPQGF 607

Query: 364 RYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPP 423
           RYKSGQYMFVNCAAVSPFEWHPFSITSAP DDYLSVHIRTLGDWTRQLRTVFSEVC+PPP
Sbjct: 608 RYKSGQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRTVFSEVCQPPP 667

Query: 424 NGISGLLRA---EGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKD 480
           +G SGLLR+   +GHN+ + PRVLIDGPYGAPAQDYK+YEVVLLVGLGIGATPMISIVKD
Sbjct: 668 DGKSGLLRSDCFQGHNS-NLPRVLIDGPYGAPAQDYKKYEVVLLVGLGIGATPMISIVKD 726

Query: 481 IVNNMKAIEEEEENDLENGRDTGVNTTIIIIDNNY-----------EPFFFW-TQKKGPI 528
           IV+N++ + EEEEN +ENG     N+    I + Y             +F+W T+++G  
Sbjct: 727 IVSNIRTM-EEEENAVENGAGGIGNSPSTKIPSPYTQKRKENFKTRRAYFYWVTREQGSF 785

Query: 529 QDKKSIL 535
              K ++
Sbjct: 786 DWFKGVM 792

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255539989\|ref\|XP_002511059.1\| respiratory burst oxidase, putative [Ricinus communis] gi\|223550174\|gb\|EEF51661.1\| respiratory burst oxidase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|20805911\|gb\|AAM28891.1\| NADPH oxidase [Nicotiana tabacum] gi\|125971776\|gb\|ABN58915.1\| rbohD [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|28268680\|dbj\|BAC56865.1\| respiratory burst oxidase homolog [Nicotiana benthamiana]	Back alignment and taxonomy information

>gi\|159078850\|gb\|ABW87870.1\| NADPH oxidase [Nicotiana attenuata]	Back alignment and taxonomy information

>gi\|19715905\|emb\|CAC84140.1\| NADPH oxidase [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|224072447\|ref\|XP_002303736.1\| predicted protein [Populus trichocarpa] gi\|222841168\|gb\|EEE78715.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|166199749\|sp\|Q2HXL0.2\|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC gi\|146219363\|dbj\|BAE79344.2\| NADPH oxidase [Solanum tuberosum]	Back alignment and taxonomy information

>gi\|350536915\|ref\|NP_001234271.1\| whitefly-induced gp91-phox [Solanum lycopersicum] gi\|8131846\|gb\|AAF73104.1\|AF147783_1 whitefly-induced gp91-phox [Solanum lycopersicum] gi\|8131890\|gb\|AAF73124.1\|AF148534_1 whitefly-induced gp91-phox [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|224136376\|ref\|XP_002322314.1\| predicted protein [Populus trichocarpa] gi\|222869310\|gb\|EEF06441.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		548
TAIR\|locus:2160917		921	RBOHD "respiratory burst oxida	0.959	0.571	0.662	7.1e-187
TAIR\|locus:2157348		905	RHD2 "ROOT HAIR DEFECTIVE 2" [	0.968	0.586	0.642	4.2e-182
TAIR\|locus:2183309		902	RBOHA "respiratory burst oxida	0.885	0.537	0.656	2.8e-169
TAIR\|locus:2117258		849	AT4G25090 [Arabidopsis thalian	0.952	0.614	0.569	6.1e-158
UNIPROTKB\|Q5ZAJ0		905	RBOHB "Respiratory burst oxida	0.879	0.532	0.593	6.3e-156
TAIR\|locus:2036104		843	RBOHB "respiratory burst oxida	0.943	0.613	0.553	4e-154
TAIR\|locus:2024603		944	RBOH F "respiratory burst oxid	0.965	0.560	0.524	4.2e-143
TAIR\|locus:2128248		941	AT4G11230 [Arabidopsis thalian	0.868	0.505	0.515	2.4e-124
TAIR\|locus:2168113		886	AT5G60010 [Arabidopsis thalian	0.874	0.540	0.44	2.1e-107
TAIR\|locus:2077192		912	AT3G45810 [Arabidopsis thalian	0.875	0.526	0.433	1.4e-105

TAIR\|locus:2160917 RBOHD "respiratory burst oxidase homologue D" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1812 (642.9 bits), Expect = 7.1e-187, P = 7.1e-187
 Identities = 354/534 (66%), Positives = 407/534 (76%)

Query:     4 QIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGES 63
             +IISLSASANKLSNIQKQA+EYAALIMEELDPD+ G IMI+NLEMLLLQAP QSV+ G+S
Sbjct:   280 EIISLSASANKLSNIQKQAKEYAALIMEELDPDNAGFIMIENLEMLLLQAPNQSVRMGDS 339

Query:    64 RNLSHMLSQKLKPTQFDNPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYK 123
             R LS MLSQKL+P +  NP+ R  +   YF+LDNWQR+W+M  W+G+  GLFTYK+IQYK
Sbjct:   340 RILSQMLSQKLRPAKESNPLVRWSEKIKYFILDNWQRLWIMMLWLGICGGLFTYKFIQYK 399

Query:   124 NRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNTITWLRNKTKLSGVVPFDDNLNFH 183
             N+AA+ VMG+CVC+AKG AETLKFNMALILLPVCRNTITWLRNKTKL  VVPFDD+LNFH
Sbjct:   400 NKAAYGVMGYCVCVAKGGAETLKFNMALILLPVCRNTITWLRNKTKLGTVVPFDDSLNFH 459

Query:   184 KXXXXXXXXXXXXXXXXXLACDFPRLINASEEKYEPMEPYFGDQPKNYWHFVKSVEGVTG 243
             K                 L CDFPRLI A E+ YEPME YFGDQP +YW FVK VEG TG
Sbjct:   460 KVIASGIVVGVLLHAGAHLTCDFPRLIAADEDTYEPMEKYFGDQPTSYWWFVKGVEGWTG 519

Query:   244 IVMVVLMAIAFTLATPWFRRXXXXXXXXXXXXTGFNAFWYSHHLFVIVYTLLIVHGQXXX 303
             IVMVVLMAIAFTLATPWFRR            TGFNAFWY+HHLF+IVY LLIVHG    
Sbjct:   520 IVMVVLMAIAFTLATPWFRRNKLNLPNFLKKLTGFNAFWYTHHLFIIVYALLIVHGIKLY 579

Query:   304 XXXXXXXXXXXXXXAIPICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRF 363
                           A+PI LYA+ERL+RA RSSIK V + KVAVYPGNVL+LHM+KP  F
Sbjct:   580 LTKIWYQKTTWMYLAVPILLYASERLLRAFRSSIKPVKMIKVAVYPGNVLSLHMTKPQGF 639

Query:   364 RYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSVHIRTLGDWTRQLRTVFSEVCRPPP 423
             +YKSGQ+M VNC AVSPFEWHPFSITSAP DDYLSVHIRTLGDWTR+LRTVFSEVC+PP 
Sbjct:   640 KYKSGQFMLVNCRAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRKLRTVFSEVCKPPT 699

Query:   424 NGISGLLRAEGHN-NPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIV 482
              G SGLLRA+G + N  FP+VLIDGPYGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDI+
Sbjct:   700 AGKSGLLRADGGDGNLPFPKVLIDGPYGAPAQDYKKYDVVLLVGLGIGATPMISILKDII 759

Query:   483 NNMKAIXXXXXNDLENGRDTGVNTTIIIIDNNYEPFFFW-TQKKGPIQDKKSIL 535
             NNMK       +D+EN      +          + +F+W T+++G  +  K I+
Sbjct:   760 NNMKG--PDRDSDIENNNSNNNSKGF----KTRKAYFYWVTREQGSFEWFKGIM 807

GO:0004601 "peroxidase activity" evidence=IEA

GO:0005506 "iron ion binding" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0009055 "electron carrier activity" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0016021 "integral to membrane" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

GO:0050664 "oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor" evidence=IEA

GO:0006952 "defense response" evidence=IMP

GO:0072593 "reactive oxygen species metabolic process" evidence=IMP;TAS

GO:0016174 "NAD(P)H oxidase activity" evidence=IMP;TAS

GO:0009408 "response to heat" evidence=IMP

GO:0043069 "negative regulation of programmed cell death" evidence=IGI

GO:0005886 "plasma membrane" evidence=IDA

GO:0050832 "defense response to fungus" evidence=IMP

GO:0009611 "response to wounding" evidence=IEP

GO:0007231 "osmosensory signaling pathway" evidence=IMP

GO:0033500 "carbohydrate homeostasis" evidence=IMP

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA

TAIR\|locus:2157348 RHD2 "ROOT HAIR DEFECTIVE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2183309 RBOHA "respiratory burst oxidase homolog A" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2117258 AT4G25090 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZAJ0 RBOHB "Respiratory burst oxidase homolog protein B" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2036104 RBOHB "respiratory burst oxidase homolog B" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2024603 RBOH F "respiratory burst oxidase protein F" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2128248 AT4G11230 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2168113 AT5G60010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077192 AT3G45810 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9FIJ0	RBOHD_ARATH	1, ., 6, ., 3, ., -	0.7265	0.9598	0.5711	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.6.3	LOW CONFIDENCE prediction!
3rd Layer	1.11.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		548
pfam08022		103	pfam08022, FAD_binding_8, FAD-binding domain	5e-43
cd06186		210	cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NO	8e-35
PLN02844		722	PLN02844, PLN02844, oxidoreductase/ferric-chelate	3e-22
PLN02631		699	PLN02631, PLN02631, ferric-chelate reductase	1e-19
PLN02292		702	PLN02292, PLN02292, ferric-chelate reductase	3e-18
cd06198		216	cd06198, FNR_like_3, NAD(P) binding domain of ferr	1e-16
cd00322		223	cd00322, FNR_like, Ferredoxin reductase (FNR), an	2e-13
pfam01794		122	pfam01794, Ferric_reduct, Ferric reductase like tr	1e-10
COG4097		438	COG4097, COG4097, Predicted ferric reductase [Inor	4e-09
pfam08030		149	pfam08030, NAD_binding_6, Ferric reductase NAD bin	1e-06
cd06187		224	cd06187, O2ase_reductase_like, The oxygenase reduc	4e-05
cd06196		218	cd06196, FNR_like_1, Ferredoxin reductase-like pro	4e-05
PRK00054		250	PRK00054, PRK00054, dihydroorotate dehydrogenase e	6e-05
cd06194		222	cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulf	8e-05
cd06189		224	cd06189, flavin_oxioreductase, NAD(P)H dependent f	8e-05
COG0543		252	COG0543, UbiB, 2-polyprenylphenol hydroxylase and	9e-05
cd06221		253	cd06221, sulfite_reductase_like, Anaerobic sulfite	1e-04
cd06192		243	cd06192, DHOD_e_trans_like, FAD/NAD binding domain	8e-04
COG1018		266	COG1018, Hmp, Flavodoxin reductases (ferredoxin-NA	0.001

>gnl\|CDD\|219702 pfam08022, FAD_binding_8, FAD-binding domain	Back alignment and domain information

 Score =  148 bits (375), Expect = 5e-43
 Identities = 53/118 (44%), Positives = 69/118 (58%), Gaps = 16/118 (13%)

Query: 337 IKAVSIQKVAVYPGNVLALHMSKP-DRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDD 395
           I  V   KV++ P NV+ L +SKP   F+YK GQY+F+N   +S  + HPF+ITSAP+DD
Sbjct: 1   IFGVPKAKVSLLPDNVVELIVSKPKKPFKYKPGQYIFINFPPISFLQSHPFTITSAPEDD 60

Query: 396 YLSVHIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPA 453
            LSVHI+  G WT++L    S                   NN D PRVLI+GPYG P+
Sbjct: 61  KLSVHIKAKGGWTKKLAKYLSSS---------------PENNKDKPRVLIEGPYGPPS 103

Length = 103

>gnl\|CDD\|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide	Back alignment and domain information

>gnl\|CDD\|215453 PLN02844, PLN02844, oxidoreductase/ferric-chelate reductase	Back alignment and domain information

>gnl\|CDD\|178238 PLN02631, PLN02631, ferric-chelate reductase	Back alignment and domain information

>gnl\|CDD\|215165 PLN02292, PLN02292, ferric-chelate reductase	Back alignment and domain information

>gnl\|CDD\|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain	Back alignment and domain information

>gnl\|CDD\|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I	Back alignment and domain information

>gnl\|CDD\|216705 pfam01794, Ferric_reduct, Ferric reductase like transmembrane component	Back alignment and domain information

>gnl\|CDD\|226582 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|203841 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain	Back alignment and domain information

>gnl\|CDD\|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant	Back alignment and domain information

>gnl\|CDD\|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain	Back alignment and domain information

>gnl\|CDD\|234601 PRK00054, PRK00054, dihydroorotate dehydrogenase electron transfer subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain	Back alignment and domain information

>gnl\|CDD\|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins	Back alignment and domain information

>gnl\|CDD\|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases	Back alignment and domain information

>gnl\|CDD\|99789 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins	Back alignment and domain information

>gnl\|CDD\|223949 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		548
KOG0039		646	consensus Ferric reductase, NADH/NADPH oxidase and	100.0
PLN02631		699	ferric-chelate reductase	100.0
PLN02292		702	ferric-chelate reductase	100.0
PLN02844		722	oxidoreductase/ferric-chelate reductase	100.0
COG4097		438	Predicted ferric reductase [Inorganic ion transpor	100.0
cd06186		210	NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz	99.91
cd06189		224	flavin_oxioreductase NAD(P)H dependent flavin oxid	99.91
PRK08051		232	fre FMN reductase; Validated	99.91
cd06210		236	MMO_FAD_NAD_binding Methane monooxygenase (MMO) re	99.9
cd06211		238	phenol_2-monooxygenase_like Phenol 2-monooxygenase	99.89
cd06209		228	BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD	99.89
cd06191		231	FNR_iron_sulfur_binding Iron-sulfur binding Ferred	99.89
cd06190		232	T4MO_e_transfer_like Toluene-4-monoxygenase electr	99.89
cd06212		232	monooxygenase_like The oxygenase reductase FAD/NAD	99.89
cd06217		235	FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr	99.89
cd06187		224	O2ase_reductase_like The oxygenase reductase FAD/N	99.89
cd06216		243	FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr	99.89
cd06215		231	FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr	99.89
PRK07609		339	CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat	99.89
cd06184		247	flavohem_like_fad_nad_binding FAD_NAD(P)H binding	99.88
cd06195		241	FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c	99.88
cd06213		227	oxygenase_e_transfer_subunit The oxygenase reducta	99.88
cd06188		283	NADH_quinone_reductase Na+-translocating NADH:quin	99.88
PRK11872		340	antC anthranilate dioxygenase reductase; Provision	99.88
cd06214		241	PA_degradation_oxidoreductase_like NAD(P) binding	99.87
cd00322		223	FNR_like Ferredoxin reductase (FNR), an FAD and NA	99.87
PRK10684		332	HCP oxidoreductase, NADH-dependent; Provisional	99.87
cd06221		253	sulfite_reductase_like Anaerobic sulfite reductase	99.87
cd06197		220	FNR_like_2 FAD/NAD(P) binding domain of ferredoxin	99.87
cd06196		218	FNR_like_1 Ferredoxin reductase-like proteins cata	99.86
PRK10926		248	ferredoxin-NADP reductase; Provisional	99.86
cd06194		222	FNR_N-term_Iron_sulfur_binding Iron-sulfur binding	99.86
cd06198		216	FNR_like_3 NAD(P) binding domain of ferredoxin red	99.86
PRK13289		399	bifunctional nitric oxide dioxygenase/dihydropteri	99.86
PRK08345		289	cytochrome-c3 hydrogenase subunit gamma; Provision	99.85
PRK08221		263	anaerobic sulfite reductase subunit B; Provisional	99.85
PRK00054		250	dihydroorotate dehydrogenase electron transfer sub	99.85
PLN03116		307	ferredoxin--NADP+ reductase; Provisional	99.85
TIGR02160		352	PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase,	99.85
cd06183		234	cyt_b5_reduct_like Cytochrome b5 reductase catalyz	99.85
PRK06222		281	ferredoxin-NADP(+) reductase subunit alpha; Review	99.84
cd06219		248	DHOD_e_trans_like1 FAD/NAD binding domain in the e	99.84
PTZ00274		325	cytochrome b5 reductase; Provisional	99.84
cd06208		286	CYPOR_like_FNR These ferredoxin reductases are rel	99.84
cd06218		246	DHOD_e_trans FAD/NAD binding domain in the electro	99.84
cd06192		243	DHOD_e_trans_like FAD/NAD binding domain (electron	99.84
TIGR02911		261	sulfite_red_B sulfite reductase, subunit B. Member	99.83
COG1018		266	Hmp Flavodoxin reductases (ferredoxin-NADPH reduct	99.83
PRK05464		409	Na(+)-translocating NADH-quinone reductase subunit	99.82
PF08022		105	FAD_binding_8: FAD-binding domain; InterPro: IPR01	99.82
cd06220		233	DHOD_e_trans_like2 FAD/NAD binding domain in the e	99.82
PTZ00319		300	NADH-cytochrome B5 reductase; Provisional	99.82
PLN03115		367	ferredoxin--NADP(+) reductase; Provisional	99.81
TIGR01941		405	nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo	99.81
COG0543		252	UbiB 2-polyprenylphenol hydroxylase and related fl	99.8
PRK05713		312	hypothetical protein; Provisional	99.8
PRK05802		320	hypothetical protein; Provisional	99.8
cd06200		245	SiR_like1 Cytochrome p450- like alpha subunits of	99.79
cd06182		267	CYPOR_like NADPH cytochrome p450 reductase (CYPOR)	99.77
PLN02252		888	nitrate reductase [NADPH]	99.77
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	99.77
KOG0534		286	consensus NADH-cytochrome b-5 reductase [Coenzyme	99.75
cd06185		211	PDR_like Phthalate dioxygenase reductase (PDR) is	99.75
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	99.74
cd06201		289	SiR_like2 Cytochrome p450- like alpha subunits of	99.74
PRK12779		944	putative bifunctional glutamate synthase subunit b	99.71
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	99.69
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	99.66
cd06193		235	siderophore_interacting Siderophore interacting pr	99.61
PF01794		125	Ferric_reduct: Ferric reductase like transmembrane	99.44
PF00970		99	FAD_binding_6: Oxidoreductase FAD-binding domain;	99.38
COG2871		410	NqrF Na+-transporting NADH:ubiquinone oxidoreducta	99.31
PRK06567		1028	putative bifunctional glutamate synthase subunit b	99.29
cd06199		360	SiR Cytochrome p450- like alpha subunits of E. col	99.28
TIGR01931		597	cysJ sulfite reductase [NADPH] flavoprotein, alpha	99.27
cd06203		398	methionine_synthase_red Human methionine synthase	99.18
cd06207		382	CyPoR_like NADPH cytochrome p450 reductase (CYPOR)	99.17
cd06206		384	bifunctional_CYPOR These bifunctional proteins fus	99.09
PRK06214		530	sulfite reductase; Provisional	99.05
PRK10953		600	cysJ sulfite reductase subunit alpha; Provisional	99.02
cd06204		416	CYPOR NADPH cytochrome p450 reductase (CYPOR) serv	98.91
cd06202		406	Nitric_oxide_synthase The ferredoxin-reductase (FN	98.86
KOG3378		385	consensus Globins and related hemoproteins [Energy	98.77
PF00175		109	NAD_binding_1: Oxidoreductase NAD-binding domain ;	98.49
PF08030		156	NAD_binding_6: Ferric reductase NAD binding domain	98.07
COG0369		587	CysJ Sulfite reductase, alpha subunit (flavoprotei	97.87
KOG1158		645	consensus NADP/FAD dependent oxidoreductase [Energ	97.52
PRK05419		205	putative sulfite oxidase subunit YedZ; Reviewed	97.51
COG2717		209	Predicted membrane protein [Function unknown]	96.86
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	96.81
KOG1159		574	consensus NADP-dependent flavoprotein reductase [E	96.21
COG2375		265	ViuB Siderophore-interacting protein [Inorganic io	96.08
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	95.67
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	95.53
PF08021		117	FAD_binding_9: Siderophore-interacting FAD-binding	95.31
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	95.11
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	94.88
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	94.12
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	92.48
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	91.86
KOG0038		189	consensus Ca2+-binding kinase interacting protein	90.42
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	89.68
KOG4065		144	consensus Uncharacterized conserved protein [Funct	88.16
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	88.14
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	87.67
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	87.38
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	87.34
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	86.6
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	85.36
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	85.34
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	85.3
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	84.02
cd00213		88	S-100 S-100: S-100 domain, which represents the la	83.75
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	83.45
cd00052		67	EH Eps15 homology domain; found in proteins implic	83.28
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	82.32
cd00213		88	S-100 S-100: S-100 domain, which represents the la	81.53
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	80.24

>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

Probab=100.00  E-value=6.1e-77  Score=660.97  Aligned_cols=455  Identities=52%  Similarity=0.892  Sum_probs=395.7

Q ss_pred             ceeeeeeeecccccccchhhHHHHHHHHHHhcCCCCCCceeHHHHHHHHhcCccccccCCCCc-chhHHHhhhcCCCCCC
Q 008948            2 YLQIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVKGGESR-NLSHMLSQKLKPTQFD   80 (548)
Q Consensus         2 ~~~~~~~~~~~n~~~~~~~~~~~~~~~~~e~~d~~~~g~i~~~~l~~~l~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~   80 (548)
                      ++|+|+.|+++|.++.+++|+++|++.+||++|+++.||+++++++.+|.+.+.......... +++....+.+++.. +
T Consensus        39 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~  117 (646)
T KOG0039|consen   39 VRELIMSSISANWLSLIKKQTEEYAALIMEELDPDHKGYITNEDLEILLLQIPTLLFAILLSFANLSLLLSQPLKPTR-R  117 (646)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhhHHHHHhhhhccccccceeeecchhHHHHhchHHHHHHHHHHHHHHhhhcccccccc-c
Confidence            467889999999999999999999999999999999999999999999998875532111111 23344555554433 3


Q ss_pred             CccchhhhhhhHhhhcCceeeehhHHHHHHHHHHHHHHhhccccchhhhhhccceeecccchhhhhhhhHHHHHhhhhhh
Q 008948           81 NPIRRCCDSTMYFLLDNWQRVWVMAQWIGVMAGLFTYKYIQYKNRAAFEVMGHCVCMAKGAAETLKFNMALILLPVCRNT  160 (548)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~i~~l~~~~~i~~~lf~~~~~~y~~~~~~~~~g~~~~~arg~a~~l~~n~~lill~~~Rn~  160 (548)
                      .+..+..++...+++++|++.+++++|+++++++|.|++.+|...+.+++||.+++.++++|+++++||+++++|+|||.
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~lf~~~~~~y~~~~~~~~~g~~~~~~~~~~~~l~~~~~~ill~~~R~~  197 (646)
T KOG0039|consen  118 KPLLRNLVRMGAFLPNLWLRVWVLFLWLGLNVGLFTWRFLQYVYLGTRHILGLCLALARGSAETLNFNMALILLPVCRNR  197 (646)
T ss_pred             cccchheeeeeeeeccceEeeeeehHHHHHHHHHHHHHHHHHHhhhhhhhhhheeeeeccccccchhhHHHHHHHHHHHH
Confidence            45556677778899999999999999999999999999999988888999999999999999999999999999999999


Q ss_pred             hhhccccccccccccCcchhhHHHHHHHHHHHHHHHHHhhhhccccceeeecCcccc-CCCCcccCCCCCccccccccch
Q 008948          161 ITWLRNKTKLSGVVPFDDNLNFHKVIAVGISIGVGIHAISHLACDFPRLINASEEKY-EPMEPYFGDQPKNYWHFVKSVE  239 (548)
Q Consensus       161 it~Lr~~~~l~~~ip~d~~~~fHk~ig~~~~~~~~iH~~~hl~~~f~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  239 (548)
                      ++|||..+.+...+|+|+++.|||.+|..+..++.+|..+|.+|.++.++++....+ ......++  ++.|+++..+..
T Consensus       198 ~~~L~~~~fl~~~~p~~~n~~fh~l~g~~~~~~~~~H~w~~~~~~~~~~ih~~~~~~~~~~~~~~~--~~~~~~~~~~~~  275 (646)
T KOG0039|consen  198 LTFLRCSTFLFSYLPFDRNLNFHKLVALTIAVFILLHIWLHLVNFFPFLVHGLEYTISLASELFFL--PKTYKWLLLGVV  275 (646)
T ss_pred             HHHHHHhhhhheEeeccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHhccc--chhhhhhhcCCC
Confidence            999995555778899999999999999999999999999999999988877643222 11222232  556788899999


Q ss_pred             hHHHHHHHHHHHHHHHhcchhhhhccCCCCCCcccccchhHHHHHHHHHHHHHHHHHhhccccccccccccceeeehhhH
Q 008948          240 GVTGIVMVVLMAIAFTLATPWFRRNKLNLPKPLKKLTGFNAFWYSHHLFVIVYTLLIVHGQYLYLTKKWYKKTTWMYLAI  319 (548)
Q Consensus       240 g~tGii~lv~l~i~~~~s~~~~Rr~~~~~~~~~~~~~~ye~F~~~H~l~~~~~~ll~~H~~~~~l~~~w~~~~~w~~~~~  319 (548)
                      ++||++++++|.+|+++|++++||+            .||+|||+||+++++|+++++||...+.+      .+|+|+++
T Consensus       276 ~~tGv~~~i~~~im~v~s~~~fRR~------------~~e~F~ytH~l~~v~~illi~hg~~~~~~------~~w~~~~~  337 (646)
T KOG0039|consen  276 GLTGVILLILMLIMFVLSLPFFRRR------------FYEAFWYTHHLYIVFYILLIIHGGFRLLG------TTWMYIAV  337 (646)
T ss_pred             cchhHHHHHHHHHHHHHhhHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHhcccccc------cchhHHHH
Confidence            9999999999999999999999999            79999999999999999999999876543      68999999


Q ss_pred             HHHHHHHHHHHHHhhcccccEEEEEEEEecCCEEEEEEECCCCcccCCCCEEEEEecCCCCCeeeeeecccCCCCCeEEE
Q 008948          320 PICLYATERLIRALRSSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDDDYLSV  399 (548)
Q Consensus       320 ~~~ly~~dr~~R~~r~~~~~~~v~~v~~l~~~v~~l~l~~p~~~~~~pGQyv~L~~p~~~~~e~hPFSIaS~p~~~~l~l  399 (548)
                      |+++|++||++|..|+ ..+++++++..+|+|++++++++|++|+|+||||++|+||.++.+|||||||+|+|+||++++
T Consensus       338 p~~ly~~dR~~r~~r~-~~~~~i~~~~llp~~vi~L~~~Kp~~f~y~~Gqyifv~~p~ls~~qwHPFTItSsp~dd~lsv  416 (646)
T KOG0039|consen  338 PVLLYILDRILRFLRS-QKNVKIAKVVLLPSDVLELIMSKPPGFKYKPGQYIFVNCPSLSKLEWHPFTITSAPEDDFLSV  416 (646)
T ss_pred             HHHHHHHHHHHHHHHH-hcCceEEEEEEcCCCeEEEEEeCCCCCCCCCCCEEEEECccccccccCCceeecCCCCCEEEE
Confidence            9999999999999998 578999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCcchHHHHHhhhccCCCCCCCcccccccCCCCCCCCEEEEecccCCCCCCCCCCCeEEEEEcccCHHHHHHHHH
Q 008948          400 HIRTLGDWTRQLRTVFSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVK  479 (548)
Q Consensus       400 ~Ir~~g~~T~~L~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~v~I~GPyG~~~~~~~~~~~vvlIagGiGITP~lsil~  479 (548)
                      |||++||||++|++.++..+++++.+.          ....+++.||||||.+.+++.++|++++||||+|+||++|+++
T Consensus       417 hIk~~g~wT~~L~~~~~~~~~~~~~~~----------~~~~~~i~IdGPYG~~s~d~~~~e~~vLV~~GiGvtPf~sil~  486 (646)
T KOG0039|consen  417 HIKALGDWTEKLRNAFSEVSQPPESDK----------SYPFPKILIDGPYGAPSQDVFKYEVLVLVGGGIGVTPFASILK  486 (646)
T ss_pred             EEEecCcHHHHHHHHHhhhcccccccc----------cccCceEEEECCCCCCchhhhhcceEEEEccCcccCccHHHHH
Confidence            999999999999999875333211110          0125899999999999999999999999999999999999999


Q ss_pred             HHHHhcccC
Q 008948          480 DIVNNMKAI  488 (548)
Q Consensus       480 ~l~~~~~~~  488 (548)
                      +++++.+..
T Consensus       487 ~l~~~~~~~  495 (646)
T KOG0039|consen  487 DLLNKISLG  495 (646)
T ss_pred             HHHhhccCC
Confidence            999886544

>PLN02631 ferric-chelate reductase	Back alignment and domain information

>PLN02292 ferric-chelate reductase	Back alignment and domain information

>PLN02844 oxidoreductase/ferric-chelate reductase	Back alignment and domain information

>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide	Back alignment and domain information

>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins	Back alignment and domain information

>PRK08051 fre FMN reductase; Validated	Back alignment and domain information

>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol	Back alignment and domain information

>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol	Back alignment and domain information

>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain	Back alignment and domain information

>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain	Back alignment and domain information

>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system	Back alignment and domain information

>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons	Back alignment and domain information

>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain	Back alignment and domain information

>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant	Back alignment and domain information

>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain	Back alignment and domain information

>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain	Back alignment and domain information

>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated	Back alignment and domain information

>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin	Back alignment and domain information

>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin	Back alignment and domain information

>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons	Back alignment and domain information

>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain	Back alignment and domain information

>PRK11872 antC anthranilate dioxygenase reductase; Provisional	Back alignment and domain information

>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase	Back alignment and domain information

>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I	Back alignment and domain information

>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional	Back alignment and domain information

>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases	Back alignment and domain information

>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins	Back alignment and domain information

>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain	Back alignment and domain information

>PRK10926 ferredoxin-NADP reductase; Provisional	Back alignment and domain information

>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain	Back alignment and domain information

>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain	Back alignment and domain information

>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional	Back alignment and domain information

>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional	Back alignment and domain information

>PRK08221 anaerobic sulfite reductase subunit B; Provisional	Back alignment and domain information

>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed	Back alignment and domain information

>PLN03116 ferredoxin--NADP+ reductase; Provisional	Back alignment and domain information

>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit	Back alignment and domain information

>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor	Back alignment and domain information

>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed	Back alignment and domain information

>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins	Back alignment and domain information

>PTZ00274 cytochrome b5 reductase; Provisional	Back alignment and domain information

>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain	Back alignment and domain information

>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase	Back alignment and domain information

>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins	Back alignment and domain information

>TIGR02911 sulfite_red_B sulfite reductase, subunit B	Back alignment and domain information

>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion]	Back alignment and domain information

>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional	Back alignment and domain information

>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245	Back alignment and domain information

>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins	Back alignment and domain information

>PTZ00319 NADH-cytochrome B5 reductase; Provisional	Back alignment and domain information

>PLN03115 ferredoxin--NADP(+) reductase; Provisional	Back alignment and domain information

>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit	Back alignment and domain information

>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK05713 hypothetical protein; Provisional	Back alignment and domain information

>PRK05802 hypothetical protein; Provisional	Back alignment and domain information

>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E	Back alignment and domain information

>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases	Back alignment and domain information

>PLN02252 nitrate reductase [NADPH]	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family	Back alignment and domain information

>PF01794 Ferric_reduct: Ferric reductase like transmembrane component; InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana	Back alignment and domain information

>PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain	Back alignment and domain information

>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>cd06199 SiR Cytochrome p450- like alpha subunits of E	Back alignment and domain information

>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component	Back alignment and domain information

>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate	Back alignment and domain information

>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases	Back alignment and domain information

>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR)	Back alignment and domain information

>PRK06214 sulfite reductase; Provisional	Back alignment and domain information

>PRK10953 cysJ sulfite reductase subunit alpha; Provisional	Back alignment and domain information

>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases	Back alignment and domain information

>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain	Back alignment and domain information

>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion]	Back alignment and domain information

>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes	Back alignment and domain information

>PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins	Back alignment and domain information

>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1158 consensus NADP/FAD dependent oxidoreductase [Energy production and conversion]	Back alignment and domain information

>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed	Back alignment and domain information

>COG2717 Predicted membrane protein [Function unknown]	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion]	Back alignment and domain information

>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>PF08021 FAD_binding_9: Siderophore-interacting FAD-binding domain; InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		548
3a8r_A		179	The Structure Of The N-Terminal Regulatory Domain O		2e-13
3a1f_A		186	The Crystal Structure Of Nadph Binding Domain Of Gp		3e-06

>pdb|3A8R|A Chain A, The Structure Of The N-Terminal Regulatory Domain Of A Plant Nadph Oxidase Length = 179

Back alignment and structure

Iteration: 1
 Score = 74.3 bits (181), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/54 (62%), Positives = 48/54 (88%)
Query: 4   QIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQS 57
           +II+LSASANKLS I+++A+EY ALIMEELDP +LG I +++LE LLLQ+P+++
Sbjct: 122 EIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLLQSPSEA 175

PyMOL of 3a8r

>pdb|3A1F|A Chain A, The Crystal Structure Of Nadph Binding Domain Of Gp91(Phox) Length = 186

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		548
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	1e-18
3a1f_A		186	Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi	5e-14
1qfj_A		232	Protein (flavin reductase); riboflavin, ferredoxin	8e-07
1krh_A		338	Benzoate 1,2-dioxygenase reductase; alpha-beta, FA	2e-06
2qdx_A		257	Ferredoxin reductase; oxidoreductase; HET: FAD; 1.	3e-06
2bgi_A		272	Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi	3e-06
1cqx_A		403	Flavohemoprotein; globin fold, six-stranded antipa	3e-05
1gvh_A		396	Flavohemoprotein; oxidoreductase, NADP, heme, flav	9e-05
4fk8_A		271	Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st	9e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
4eh1_A		243	Flavohemoprotein; structural genomics, niaid, nati	2e-04
1tvc_A		250	Methane monooxygenase component C, methane monooxy	3e-04
3lyu_A		142	Putative hydrogenase; the C-terminal has AN alpha-	6e-04

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179	Back alignment and structure

 Score = 82.8 bits (204), Expect = 1e-18
 Identities = 34/56 (60%), Positives = 48/56 (85%)

Query: 4   QIISLSASANKLSNIQKQAEEYAALIMEELDPDHLGCIMIDNLEMLLLQAPAQSVK 59
           +II+LSASANKLS I+++A+EY ALIMEELDP +LG I +++LE LLLQ+P+++  
Sbjct: 122 EIIALSASANKLSKIKERADEYTALIMEELDPTNLGYIEMEDLEALLLQSPSEAAA 177

PyMOL of 3a8r

>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186	Back alignment and structure

>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232	Back alignment and structure

>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338	Back alignment and structure

>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257	Back alignment and structure

>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272	Back alignment and structure

>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403	Back alignment and structure

>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396	Back alignment and structure

>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Length = 271	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Length = 243	Back alignment and structure

>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250	Back alignment and structure

>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Length = 142	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		548
1qfj_A		232	Protein (flavin reductase); riboflavin, ferredoxin	99.9
1tvc_A		250	Methane monooxygenase component C, methane monooxy	99.9
4fk8_A		271	Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st	99.89
4eh1_A		243	Flavohemoprotein; structural genomics, niaid, nati	99.89
2eix_A		243	NADH-cytochrome B5 reductase; flavoprotein, FAD-bi	99.89
3lo8_A		311	Ferredoxin--NADP reductase; electron transport, ox	99.88
1fdr_A		248	Flavodoxin reductase; ferredoxin reductase, flavin	99.87
3jqq_A		316	Ferredoxin NADP reductase; FAD, oxidoreductase; HE	99.87
3vo2_A		310	Putative uncharacterized protein; rossmann fold, o	99.87
1umk_A		275	B5R, NADH-cytochrome B5 reductase; flavoprotein, b	99.87
2r6h_A		290	NADH:ubiquinone oxidoreductase, Na translocating,	99.86
1krh_A		338	Benzoate 1,2-dioxygenase reductase; alpha-beta, FA	99.86
2qdx_A		257	Ferredoxin reductase; oxidoreductase; HET: FAD; 1.	99.86
2cnd_A		270	NADH-dependent nitrate reductase; nitrate assimila	99.86
2bgi_A		272	Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi	99.85
1gvh_A		396	Flavohemoprotein; oxidoreductase, NADP, heme, flav	99.85
4g1v_A		399	Flavohemoglobin; three domains: globin fold, antip	99.85
1fnb_A		314	Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(	99.85
1cqx_A		403	Flavohemoprotein; globin fold, six-stranded antipa	99.84
1ep3_B		262	Dihydroorotate dehydrogenase B (PYRK subunit); het	99.84
2bmw_A		304	Ferredoxin--NADP reductase; oxidoreductase, flavop	99.84
2rc5_A		314	Ferredoxin-NADP reductase; FAD, oxidoreductase; HE	99.83
2b5o_A		402	FNR, ferredoxin--NADP reductase; complex with FAD,	99.83
2pia_A		321	Phthalate dioxygenase reductase; HET: FMN; 2.00A {	99.79
2gpj_A		252	Siderophore-interacting protein; structural genomi	99.63
1ddg_A		374	Sulfite reductase (NADPH) flavoprotein alpha- comp	99.46
2qtl_A		539	MSR;, methionine synthase reductase; alpha-beta-al	99.28
4dql_A		393	Bifunctional P-450/NADPH-P450 reductase; rossmann	99.26
1f20_A		435	Nitric-oxide synthase; nitric-xoide synthase, redu	99.17
1tll_A		688	Nitric-oxide synthase, brain; reductase module, FM	99.1
2bpo_A		682	CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-	99.06
3qfs_A		458	CPR, P450R, NADPH--cytochrome P450 reductase; flav	99.04
3qe2_A		618	CPR, P450R, NADPH--cytochrome P450 reductase; cypo	98.98
3lyu_A		142	Putative hydrogenase; the C-terminal has AN alpha-	98.95
3a1f_A		186	Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi	98.92
3lrx_A		158	Putative hydrogenase; alpha-beta protein, structur	98.9
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	94.07
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	93.1
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	92.7
3li6_A		66	Calcium-binding protein; calcium signaling protein	92.38
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	92.29
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	92.07
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	91.74
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	91.58
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	91.55
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	91.46
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	91.42
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	91.4
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	91.33
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	91.27
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	91.14
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	91.11
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	90.9
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	90.88
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	90.76
1c07_A		95	Protein (epidermal growth factor receptor pathway	90.68
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	90.51
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	90.01
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	89.81
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	89.72
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	89.54
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	89.26
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	89.26
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	88.9
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	88.88
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	88.87
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	88.77
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	88.73
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	88.64
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	88.53
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	88.46
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	88.42
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	88.41
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	88.36
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	88.31
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	88.3
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	87.98
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	87.95
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	87.82
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	87.8
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	87.78
2jq6_A		139	EH domain-containing protein 1; metal binding prot	87.77
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	87.76
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	87.69
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	87.67
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	87.49
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	87.49
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	87.39
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	87.37
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	87.28
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	87.06
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	87.05
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	86.73
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	86.71
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	86.36
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	86.27
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	86.16
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	86.04
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	85.81
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	85.77
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	85.77
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	85.74
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	85.71
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	85.58
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	85.54
3li6_A		66	Calcium-binding protein; calcium signaling protein	85.51
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	85.49
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	85.41
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	85.33
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	85.27
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	85.23
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	85.07
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	85.06
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	84.94
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	84.9
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	84.82
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	84.82
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	84.71
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	84.65
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	84.64
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	84.34
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	84.32
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	84.29
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	84.11
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	84.07
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	83.99
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	83.98
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	83.89
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	83.83
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	83.73
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	83.49
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	83.47
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	83.33
2jnf_A		158	Troponin C; stretch activated muscle contraction,	83.26
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	83.24
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	83.18
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	83.1
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	83.09
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	83.03
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	82.93
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	82.78
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	82.77
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	82.71
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	82.44
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	82.4
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	82.36
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	82.34
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	82.27
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	82.14
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	81.94
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	81.91
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	81.59
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	81.52
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	81.5
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	81.45
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	81.4
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	81.36
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	81.17
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	80.98
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	80.77
1c07_A		95	Protein (epidermal growth factor receptor pathway	80.26
2hps_A		186	Coelenterazine-binding protein with bound coelent;	80.2
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	80.1
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	80.02

>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1	Back alignment and structure

Probab=99.90  E-value=3.3e-23  Score=202.70  Aligned_cols=171  Identities=16%  Similarity=0.270  Sum_probs=134.8

Q ss_pred             ccEEEEEEEEecCCEEEEEEECCCCcccCCCCEEEEEecCCCCCeeeeeecccCCCC-CeEEEEEEEcC--CcchHHHHH
Q 008948          338 KAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDD-DYLSVHIRTLG--DWTRQLRTV  414 (548)
Q Consensus       338 ~~~~v~~v~~l~~~v~~l~l~~p~~~~~~pGQyv~L~~p~~~~~e~hPFSIaS~p~~-~~l~l~Ir~~g--~~T~~L~~~  414 (548)
                      ..++|++++.+++++.+++++.|..+.|+||||+.|.+|.   .++|||||+|.|.+ +.++++||..+  ++|+.+.+.
T Consensus         3 ~~~~V~~~~~~~~~~~~l~l~~~~~~~~~pGq~v~l~~~~---~~~R~ySi~s~~~~~~~l~l~i~~~~~G~~s~~~~~~   79 (232)
T 1qfj_A            3 LSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQYLMVVMDE---RDKRPFSMASTPDEKGFIELHIGASEINLYAKAVMDR   79 (232)
T ss_dssp             EEEEEEEEEESSSSCEEEEEEESSCCCCCTTCEEEEESSS---SCEEEEECCSCTTSTTCEEEEEC------CCHHHHHH
T ss_pred             eEEEEEEEEecCCCEEEEEEecCCCCCcCCCCEEEEECCC---CceeeeecCCCCCCCCcEEEEEEEccCCchhHHHHHh
Confidence            4678999999999999999998877899999999999986   37999999999874 68999999974  577776555


Q ss_pred             hhhccCCCCCCCcccccccCCCCCCCCEEEEecccCCCCCCCCCCCeEEEEEcccCHHHHHHHHHHHHHhcccCc-----
Q 008948          415 FSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIE-----  489 (548)
Q Consensus       415 ~~~~~~~~~~g~~~~~~~~~~~~~~~~~v~I~GPyG~~~~~~~~~~~vvlIagGiGITP~lsil~~l~~~~~~~~-----  489 (548)
                      ++.                      ++++.|+||||.+..+...++++||||||+||||++|+++++..+....+     
T Consensus        80 l~~----------------------Gd~v~v~gP~G~~~~~~~~~~~~vliagG~GitP~~~~l~~l~~~~~~~~v~l~~  137 (232)
T 1qfj_A           80 ILK----------------------DHQIVVDIPHGEAWLRDDEERPMILIAGGTGFSYARSILLTALARNPNRDITIYW  137 (232)
T ss_dssp             HHH----------------------HSEEEEEEEECSCCCCSCSSSCEEEEEETTCHHHHHHHHHHHHHHCTTCCEEEEE
T ss_pred             CCC----------------------CCEEEEeCCccceEeCCCCCCcEEEEEecccHhHHHHHHHHHHhcCCCCcEEEEE
Confidence            532                      47999999999987654457899999999999999999999987642211     


Q ss_pred             -------HHHHHHHHhhhhcCCCEEEE-EecCCCCCCCcccCccccCCHHHHHHH
Q 008948          490 -------EEEENDLENGRDTGVNTTII-IIDNNYEPFFFWTQKKGPIQDKKSILL  536 (548)
Q Consensus       490 -------~~~~~eL~~l~~~~~~~~v~-vt~~~~~~~~~w~g~~G~I~~~~~~~~  536 (548)
                             ..+.++|++++.+..+..++ +.+.++++   |.|.+|+|++.+.+.+
T Consensus       138 ~~r~~~~~~~~~el~~l~~~~~~~~~~~~~s~~~~~---~~g~~g~v~~~~~~~~  189 (232)
T 1qfj_A          138 GGREEQHLYDLCELEALSLKHPGLQVVPVVEQPEAG---WRGRTGTVLTAVLQDH  189 (232)
T ss_dssp             EESSGGGCTTHHHHHHHHHHCTTEEEEEEESSCCTT---CCSEESCHHHHHHHHC
T ss_pred             eeCCHHHhhhHHHHHHHHHHCCCeEEEEEEcCCCCC---cCCceeeHHHHHHHhc
Confidence                   13678999987766675554 45555555   8899999988776644

PyMOL of 1qfj

>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2	Back alignment and structure

>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A*	Back alignment and structure

>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum}	Back alignment and structure

>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A*	Back alignment and structure

>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A*	Back alignment and structure

>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A*	Back alignment and structure

>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A*	Back alignment and structure

>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A*	Back alignment and structure

>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis}	Back alignment and structure

>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2	Back alignment and structure

>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A*	Back alignment and structure

>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A*	Back alignment and structure

>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A*	Back alignment and structure

>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5	Back alignment and structure

>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A*	Back alignment and structure

>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A*	Back alignment and structure

>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A*	Back alignment and structure

>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B*	Back alignment and structure

>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ...	Back alignment and structure

>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A*	Back alignment and structure

>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP}	Back alignment and structure

>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2	Back alignment and structure

>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens}	Back alignment and structure

>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A*	Back alignment and structure

>2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A*	Back alignment and structure

>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A*	Back alignment and structure

>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4	Back alignment and structure

>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4	Back alignment and structure

>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A*	Back alignment and structure

>3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A*	Back alignment and structure

>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A*	Back alignment and structure

>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus}	Back alignment and structure

>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens}	Back alignment and structure

>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		548
d1a8pa1		99	b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi	3e-11
d1qfja1		97	b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {E	7e-04
d1fdra1		99	b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi	0.004

>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Length = 99	Back information, alignment and structure


class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Ferredoxin reductase FAD-binding domain-like
domain: Ferredoxin reductase (flavodoxin reductase) N-terminal domain
species: Azotobacter vinelandii [TaxId: 354]

 Score = 58.1 bits (140), Expect = 3e-11
 Identities = 12/82 (14%), Positives = 34/82 (41%), Gaps = 2/82 (2%)

Query: 335 SSIKAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPDD 394
           S++    +  V  +   + +   ++    R+++GQ++ +            +SI S   +
Sbjct: 1   SNLNVERVLSVHHWNDTLFSFKTTRNPSLRFENGQFVMIGLEVDGRPLMRAYSIASPNYE 60

Query: 395 DYLSVHIRTL--GDWTRQLRTV 414
           ++L      +  G  T +L+ +
Sbjct: 61  EHLEFFSIKVQNGPLTSRLQHL 82

PyMOL of d1a8pa1

>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 97	Back information, alignment and structure

>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Length = 99	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		548
d1qfja1		97	NAD(P)H:flavin oxidoreductase {Escherichia coli [T	99.64
d1a8pa1		99	Ferredoxin reductase (flavodoxin reductase) N-term	99.59
d1fdra1		99	Ferredoxin reductase (flavodoxin reductase) N-term	99.54
d1krha1		100	Benzoate dioxygenase reductase {Acinetobacter sp.	99.53
d1tvca1		109	Methane monooxygenase component C, MmoC {Methyloco	99.49
d1cqxa2		111	Flavohemoglobin, central domain {Alcaligenes eutro	99.42
d1gvha2		107	Flavohemoglobin, central domain {Escherichia coli	99.36
d1ep3b1		101	Dihydroorotate dehydrogenase B, PyrK subunit {Lact	99.36
d2piaa1		103	Phthalate dioxygenase reductase {Pseudomonas cepac	99.22
d2cnda1		114	Nitrate reductase core domain {Corn (Zea mays) [Ta	99.14
d1umka1		124	cytochrome b5 reductase {Human (Homo sapiens) [Tax	99.06
d1fnda1		136	Ferredoxin reductase (flavodoxin reductase) N-term	98.98
d1tvca2		141	Methane monooxygenase component C, MmoC {Methyloco	98.93
d1umka2		147	cytochrome b5 reductase {Human (Homo sapiens) [Tax	98.91
d2bmwa1		133	Ferredoxin reductase (flavodoxin reductase) N-term	98.89
d1krha2		133	Benzoate dioxygenase reductase {Acinetobacter sp.	98.79
d1qfja2		135	NAD(P)H:flavin oxidoreductase {Escherichia coli [T	98.76
d2cnda2		146	Nitrate reductase {Corn (Zea mays) [TaxId: 4577]}	98.55
d1fnda2		160	Ferredoxin reductase (flavodoxin reductase) {Spina	98.3
d1jb9a1		157	Ferredoxin reductase (flavodoxin reductase) N-term	98.29
d1fdra2		148	Ferredoxin reductase (flavodoxin reductase) {Esche	98.29
d1ddga2		153	Sulfite reductase flavoprotein {Escherichia coli [	98.26
d1jb9a2		154	Ferredoxin reductase (flavodoxin reductase) {Maize	98.26
d2bmwa2		162	Ferredoxin reductase (flavodoxin reductase) {Cyano	98.18
d1cqxa3		142	Flavohemoglobin, C-terminal domain {Alcaligenes eu	98.16
d1ep3b2		160	Dihydroorotate dehydrogenase B, PyrK subunit {Lact	98.15
d1f20a2		165	Neuronal nitric-oxide synthase FAD/NADP+ domain {R	98.04
d1gvha3		143	Flavohemoglobin, C-terminal domain {Escherichia co	97.94
d2piaa2		120	Phthalate dioxygenase reductase {Pseudomonas cepac	97.87
d1ja1a3		160	NADPH-cytochrome p450 reductase {Rat (Rattus norve	97.69
d1a8pa2		158	Ferredoxin reductase (flavodoxin reductase) {Azoto	97.65
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	96.57
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	95.4
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	95.25
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	95.19
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	95.09
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	95.07
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	94.53
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	93.9
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	93.69
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	93.43
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	93.3
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	93.26
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	92.78
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	92.73
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	92.73
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	92.42
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	92.37
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	92.37
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	92.27
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	92.2
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	92.1
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	91.97
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	91.9
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	91.48
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	91.46
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	91.43
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	91.36
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	91.26
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	91.08
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	90.68
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	90.66
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	90.66
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	90.61
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	90.56
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	90.48
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	90.27
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	90.26
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	90.24
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	89.93
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	89.89
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	89.82
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	89.73
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	89.64
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	89.63
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	89.32
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	89.11
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	88.98
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	88.6
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	88.48
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	88.13
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	88.06
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	87.36
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	87.33
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	87.24
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	87.1
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	87.05
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	86.95
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	86.92
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	86.86
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	86.85
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	86.81
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	86.47
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	86.33
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	86.25
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	86.04
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	85.75
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	85.57
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	85.55
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	84.87
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	84.63
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	84.52
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	84.34
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	83.98
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	83.81
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	83.51
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	82.58
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	82.56
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	82.55
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	82.39
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	82.17
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	81.8
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	81.79
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	81.68
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	81.59
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	81.52
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	81.33
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	81.06
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	80.72
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	80.34
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	80.01

>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Ferredoxin reductase FAD-binding domain-like
domain: NAD(P)H:flavin oxidoreductase
species: Escherichia coli [TaxId: 562]

Probab=99.64  E-value=2.7e-16  Score=131.07  Aligned_cols=91  Identities=20%  Similarity=0.415  Sum_probs=77.7

Q ss_pred             ccEEEEEEEEecCCEEEEEEECCCCcccCCCCEEEEEecCCCCCeeeeeecccCCC-CCeEEEEEEEc--CCcchHHHHH
Q 008948          338 KAVSIQKVAVYPGNVLALHMSKPDRFRYKSGQYMFVNCAAVSPFEWHPFSITSAPD-DDYLSVHIRTL--GDWTRQLRTV  414 (548)
Q Consensus       338 ~~~~v~~v~~l~~~v~~l~l~~p~~~~~~pGQyv~L~~p~~~~~e~hPFSIaS~p~-~~~l~l~Ir~~--g~~T~~L~~~  414 (548)
                      .+++|.+++.+++++++++++.|+++.|+||||+.|.+|..   ++|||||+|+|+ +++++|+||..  |.+|+.|.+.
T Consensus         3 l~~~V~~i~~lt~~v~~~~l~~~~~~~f~~GQ~v~l~~~~~---~~r~ySias~p~~~~~l~l~ir~~~~g~~s~~l~~~   79 (97)
T d1qfja1           3 LSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQYLMVVMDER---DKRPFSMASTPDEKGFIELHIGASEINLYAKAVMDR   79 (97)
T ss_dssp             EEEEEEEEEESSSSCEEEEEEESSCCCCCTTCEEEEESSSS---CEEEEECCSCTTSTTCEEEEEC------CCHHHHHH
T ss_pred             EEEEEEEEEEcCCCEEEEEEeCCccCccCCCCEEEEEEcCC---CcEEEEEEEcCCCCcEEEEEEeEccCCchhHhHhhc
Confidence            46899999999999999999999899999999999999865   689999999995 67899999977  7799999876


Q ss_pred             hhhccCCCCCCCcccccccCCCCCCCCEEEEecccCCCC
Q 008948          415 FSEVCRPPPNGISGLLRAEGHNNPDFPRVLIDGPYGAPA  453 (548)
Q Consensus       415 ~~~~~~~~~~g~~~~~~~~~~~~~~~~~v~I~GPyG~~~  453 (548)
                      ++.                      ++++.|+||||.++
T Consensus        80 l~~----------------------G~~v~v~gP~G~~~   96 (97)
T d1qfja1          80 ILK----------------------DHQIVVDIPHGEAW   96 (97)
T ss_dssp             HHH----------------------HSEEEEEEEECSCC
T ss_pred             CCC----------------------CCEEEEeccCCceE
Confidence            643                      47999999999875

PyMOL of d1qfja1

>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}	Back information, alignment and structure

>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]}	Back information, alignment and structure

>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]}	Back information, alignment and structure

>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}	Back information, alignment and structure

>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]}	Back information, alignment and structure

>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}	Back information, alignment and structure

>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]}	Back information, alignment and structure

>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}	Back information, alignment and structure

>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]}	Back information, alignment and structure

>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]}	Back information, alignment and structure

>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]}	Back information, alignment and structure

>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]}	Back information, alignment and structure

>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}	Back information, alignment and structure

>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}	Back information, alignment and structure

>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}	Back information, alignment and structure

>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]}	Back information, alignment and structure

>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure