Citrus Sinensis ID: 008969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLGTKQDEEKSSDGNSVQATLCAGGQQFNSETEHGESLSDSGDDKIKNSNPVLDLAKDDLLAQLKWKSSRKRRRGGGSSVHRLHCSDPEGKHTRAVVGSGFCERFLFPASIKVDDNCKYMRGSLFKSSVVSPLTSLVMSR
cccccccccccEEEccEEEEEccEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEEccccccccccccccccEEEEcccccccccEEEEEEEEEccHHHHHHcccccccccccEEEEEcccccccccEEEccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEEEEEEEcccEEEEEEccccccccccccEEEEEEcEEccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEccccEEEEEEcccccEEEEEccccccccEEcccEEEEEccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccEEcc
ccHHHHHHHHHHHcccEEEEEEcEEEEEccccccEEEEEEEccHccccccEEEEEEEEcccEEEEEccccccccEEEEEcccEEEEEEEEcccEEEEcHHHHHHHHHccccccccEEEEEEEEcccccccccHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEEEEcccEEEEEEEcccccccccccEEEEEEcEccccccccccEEcccccccccccccccccccEEEcccEEEEEEccccEEEEEEEEccccEEEEEEcccccEEEEcHHHccccEEcccccEEcccccHHHHHHHHcccccccccEEccccccccccccccccccccHHcccccccccccccccccccccccccHccHHHccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccEEEcc
msrkkrkhyqsfcrngvkvsVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDevgiflphnfndrEIFFSLCLQDLSIECIDGlatvlspqhfekfmneatypqlqpficdkqfenddvkpfdiTLVKGYWRQEIIRHLftftspkncsssqqpfdgqrAEKIVNDVVEtrpkkrlrqskdadvcdytnrkepmdaacmdlkistkssvdggvgtlAGVGGAAllskkeadpssqylkvgshvevlsqdsgmrgcwyRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASrvaapdqlglrvsgrrivrpspeshkgrvsWAIDVGTIVDAWWHDGWWEGIViqkdsedklhvyfpgekqksifsrgdlrhsqewfgnGWMFIKERSDVVSSILCClgtkqdeekssdgnsvQATLcaggqqfnsetehgeslsdsgddkiknsnpvldlAKDDLLAQLKWKssrkrrrgggssvhrlhcsdpegkhtravvgsgfcerflfpasikvddnckymrgslfkssvvspltslvmsr
msrkkrkhyqsfcrngvkvsvHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKncsssqqpfdgqraEKIVNDvvetrpkkrlrqskdadvcdytnrkepmdaACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVevlsqdsgmrgCWYRAsvikkhkdkvKVRYNDVQDAADEVNLLEEWVLAsrvaapdqlglrvsgrrivrpspeshkgrvswaIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGekqksifsrgdLRHSQEWFGNGWMFIKERSDVVSSILCCLGTKqdeekssdgNSVQATLCAGGQQFNSETEHGESLSDSGDDKIKNSNPVLDLAKDDLLAQLkwkssrkrrrgggssvhrlhcsdpegkhTRAVVGSGFCERFLFPASIKVDDNCKYMRGslfkssvvspltslvmsr
MSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSvdggvgtlagvggaallSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLGTKQDEEKSSDGNSVQATLCAGGQQFNSETEHGESLSDSGDDKIKNSNPVldlakddllaqlkWkssrkrrrgggssVHRLHCSDPEGKHTRAVVGSGFCERFLFPASIKVDDNCKYMRGSLFKSSVVSPLTSLVMSR
********YQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFT******************************************************CMDLKI*****VDGGVGTLAGVGGAAL***********YLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIV********GRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLG*****************************************************************************************TRAVVGSGFCERFLFPASIKVDDNCKYMRGSLFKSSVV**********
*****RKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVG****HNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEI****************************************************************************************************YLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASR*****************************WAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIK**************************************************************************************************************************KVDDNCKYMRGSLF**SVVSPLTSLVMSR
**********SFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSP************QRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLGTK***********VQATLCAGGQQFN*************DDKIKNSNPVLDLAKDDLLAQLKWK**************RLHCSDPEGKHTRAVVGSGFCERFLFPASIKVDDNCKYMRGSLFKSSVVSPLTSLVMSR
MSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTF*******************************************************************************************SQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLG************************************************VLDLAKDDLLAQLKW*****************************************PASIKVDDNCKYMRGSLFKSSVVSPLTS***SR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLGTKQDEEKSSDGNSVQATLCAGGQQFNSETEHGESLSDSGDDKIKNSNPVLDLAKDDLLAQLKWKSSRKRRRGGGSSVHRLHCSDPEGKHTRAVVGSGFCERFLFPASIKVDDNCKYMRGSLFKSSVVSPLTSLVMSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
359472972 731 PREDICTED: uncharacterized protein LOC10 0.992 0.742 0.568 1e-180
147856929 669 hypothetical protein VITISV_000033 [Viti 0.950 0.777 0.587 1e-177
224108500598 predicted protein [Populus trichocarpa] 0.994 0.909 0.575 1e-175
224101713629 predicted protein [Populus trichocarpa] 0.914 0.794 0.560 1e-168
255576463 685 DNA binding protein, putative [Ricinus c 0.987 0.788 0.558 1e-168
356577654 669 PREDICTED: uncharacterized protein LOC10 0.970 0.793 0.523 1e-150
449467377 692 PREDICTED: uncharacterized protein LOC10 0.961 0.760 0.518 1e-146
449520461 692 PREDICTED: uncharacterized protein LOC10 0.961 0.760 0.518 1e-146
357488501 685 Agenet and bromo-adjacent homology (BAH) 0.970 0.775 0.509 1e-145
357488503502 Agenet and bromo-adjacent homology (BAH) 0.899 0.980 0.496 1e-126
>gi|359472972|ref|XP_002279093.2| PREDICTED: uncharacterized protein LOC100242253 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 334/587 (56%), Positives = 408/587 (69%), Gaps = 44/587 (7%)

Query: 3   RKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDE 62
           RK+R HYQSF RNG+K+SVHDFVYVLAEE+KRL+AYLEDMYEDSRGN+MVVVRWFHKIDE
Sbjct: 147 RKRRNHYQSFRRNGIKISVHDFVYVLAEEDKRLVAYLEDMYEDSRGNRMVVVRWFHKIDE 206

Query: 63  VGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQ 122
           VGI LP NFNDREIFFSLC QDLSIECIDGLATVL PQHFEKF+NEAT+ QL+PF+C KQ
Sbjct: 207 VGIVLPLNFNDREIFFSLCHQDLSIECIDGLATVLGPQHFEKFLNEATHTQLEPFVCHKQ 266

Query: 123 FENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPK 182
           F+ND+VKPFDIT VKGYW+QEI+R+++T T   +  S  Q  D    E  +ND   +RP 
Sbjct: 267 FDNDEVKPFDITQVKGYWKQEILRYMYTSTLMPDVRS--QSSDDVGVEGNLNDASGSRPN 324

Query: 183 KRLRQSKDADVC-DYTNRKEPMDAACMDLKISTKSSVD--GGVGTLAGVGGAAL--LSKK 237
           KR  +S+DAD C   TN++E +D +  + +  + S +D      T A   G+A+  + +K
Sbjct: 325 KRHCRSEDADACLQLTNKEESVDTSRANFQNISNSLIDYRNEPETCALKDGSAVPFIHRK 384

Query: 238 EA--DPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLL 295
           EA      Q+L +GS VEVLSQDSG+RGCW RA +IKKH+ KVKVRY D+ DAADE + L
Sbjct: 385 EAIIQKLPQFLAIGSQVEVLSQDSGIRGCWLRALIIKKHRCKVKVRYQDIMDAADETSNL 444

Query: 296 EEWVLASRVAAPDQLGLRVSGRRIVRPSPE-SHKGRVSWAIDVGTIVDAWWHDGWWEGIV 354
           EEW+LASRVA PD+ GLR+ GR  +RP P  S+KGRVSWA DVG++VDAWWHDGWWEGIV
Sbjct: 445 EEWILASRVAVPDESGLRICGRTTIRPPPPGSNKGRVSWAFDVGSVVDAWWHDGWWEGIV 504

Query: 355 IQKDSEDKLHVYFP---------------------------------GEKQKSIFSRGDL 381
           +QK+SED++HVYFP                                 GEKQ+ +F R DL
Sbjct: 505 VQKESEDRIHVYFPGLKRYPFQILNAMLMQNGNQRVVHILKLLYFFAGEKQELVFGRSDL 564

Query: 382 RHSQEWFGNGWMFIKERSDVVSSILCCLGTKQDEEKSSDGNSVQATLCAGGQQFNSETEH 441
           RHS+EW+ N W  +KER D+V+SIL    +K    KSSDG   Q  +C  G     E   
Sbjct: 565 RHSEEWYENSWKHMKERPDLVTSILSGRESKHVVSKSSDGKLAQTAICDIGWSKKDEGGC 624

Query: 442 GESLSDSGDDKIKNSNPVLDLAKDDLLAQLKWKSSRKRRRGGGSSVHRLHCSDPEGKHTR 501
             S  DSG+DK+K    V DL KDD L+QLKWK+SRKRRR  G SV +LH +    K   
Sbjct: 625 VNSQLDSGNDKLKGLGFVPDLLKDDTLSQLKWKTSRKRRRVSGGSVQKLHVNVNTSKSAS 684

Query: 502 AVVGSGFCERFLFPASIKVD-DNCKYMRGSLFKSSVVSPLTSLVMSR 547
            ++GS  C+RF  P S+KVD +NCKY+  SLF SSVV PLT+LVMSR
Sbjct: 685 EIMGSHACDRFFIPKSLKVDCENCKYVGDSLFSSSVVPPLTNLVMSR 731

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147856929|emb|CAN78632.1| hypothetical protein VITISV_000033 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224108500|ref|XP_002314870.1| predicted protein [Populus trichocarpa] gi|222863910|gb|EEF01041.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101713|ref|XP_002312391.1| predicted protein [Populus trichocarpa] gi|222852211|gb|EEE89758.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255576463|ref|XP_002529123.1| DNA binding protein, putative [Ricinus communis] gi|223531402|gb|EEF33236.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356577654|ref|XP_003556939.1| PREDICTED: uncharacterized protein LOC100817358 [Glycine max] Back     alignment and taxonomy information
>gi|449467377|ref|XP_004151400.1| PREDICTED: uncharacterized protein LOC101211122 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520461|ref|XP_004167252.1| PREDICTED: uncharacterized protein LOC101229627 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357488501|ref|XP_003614538.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] gi|355515873|gb|AES97496.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357488503|ref|XP_003614539.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] gi|355515874|gb|AES97497.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
TAIR|locus:2026874648 AT1G68580 [Arabidopsis thalian 0.804 0.679 0.483 1.5e-106
TAIR|locus:2162117663 AT5G55600 [Arabidopsis thalian 0.689 0.568 0.344 2.3e-55
TAIR|locus:2203018 517 AT1G09320 [Arabidopsis thalian 0.347 0.367 0.305 4.8e-11
TAIR|locus:2130878 2037 G2484-1 "G2484-1 protein" [Ara 0.279 0.075 0.307 8.6e-11
TAIR|locus:2200146 604 DUF2 "DOMAIN OF UNKNOWN FUNCTI 0.276 0.25 0.269 1.2e-06
TAIR|locus:2197985 695 AT1G26540 [Arabidopsis thalian 0.235 0.185 0.281 6.6e-06
TAIR|locus:2202295134 AT1G06340 [Arabidopsis thalian 0.106 0.432 0.322 0.00057
TAIR|locus:2026874 AT1G68580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1054 (376.1 bits), Expect = 1.5e-106, P = 1.5e-106
 Identities = 222/459 (48%), Positives = 289/459 (62%)

Query:     3 RKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDE 62
             RK+RKHYQS+ RNGV++SV+DFVYVLAE++KRL+AY+ED+YEDS+G KMVVVRWFHK +E
Sbjct:   135 RKRRKHYQSYLRNGVRISVNDFVYVLAEQHKRLVAYIEDLYEDSKGKKMVVVRWFHKTEE 194

Query:    63 VGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQ 122
             VG  L  + NDREIFFSL  QD+SIECID LATVLSPQH+EKF+    + Q   F C K 
Sbjct:   195 VGSVLSDDDNDREIFFSLNRQDISIECIDYLATVLSPQHYEKFLKVPMHVQTVAFFCQKL 254

Query:   123 FENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPK 182
             + +D +KP+DIT ++GYWRQE++R+L   +  K+   +Q P      +  +   V  R +
Sbjct:   255 YGDDGLKPYDITQLEGYWRQEMLRYL-NVSILKSFEGAQAPGTDPGLKAPLVGCVGIRSR 313

Query:   183 KRLRQSKDADV-CDYTNRKEPMDAACMDLKISTKSSXXXXXXXXXXXXXXXXXSKKEADP 241
             KR R S    +   Y            D+K   KSS                  K + D 
Sbjct:   314 KRRRPSPVGTLNVSYAG----------DMKGDCKSSPDSVLAVTDASIF-----KGDEDG 358

Query:   242 SSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLA 301
             SS ++K GS +EVLS+DSG+RGCW++A V+KKHKDKVKV+Y D+QDA DE   LEEW+L 
Sbjct:   359 SSHHIKKGSLIEVLSEDSGIRGCWFKALVLKKHKDKVKVQYQDIQDADDESKKLEEWILT 418

Query:   302 SRVAAPDQLG-LRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSE 360
             SRVAA D LG LR+ GR++VRP  +  K      I VG  VD WW DGWWEGIV+Q+ SE
Sbjct:   419 SRVAAGDHLGDLRIKGRKVVRPMLKPSKENDVCVIGVGMPVDVWWCDGWWEGIVVQEVSE 478

Query:   361 DKLHVYFPGEKQKSIFSRGDLRHSQEWFGNGWMFIKERSDVVSSILCCLGTKQDEEKSSD 420
             +K  VY PGEK+ S F R DLR S+EW  + W+ I+ RSD+VSS+L  L  K++ E   D
Sbjct:   479 EKFEVYLPGEKKMSAFHRNDLRQSREWLDDEWLNIRSRSDIVSSVLS-LTKKKEMEVKHD 537

Query:   421 GNSVQATLCAGGQQFNSETEHGESLSDSGDDKIKNSNPV 459
               S    +C G     +E +   SL  +   K     P+
Sbjct:   538 EKSSDVGVCNGRMSPKTEAKRTISLPVATTKKSLPKRPI 576
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
TAIR|locus:2162117 AT5G55600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203018 AT1G09320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130878 G2484-1 "G2484-1 protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200146 DUF2 "DOMAIN OF UNKNOWN FUNCTION 724 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197985 AT1G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202295 AT1G06340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 2e-58
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 7e-14
smart0074359 smart00743, Agenet, Tudor-like domain present in p 2e-11
pfam0564166 pfam05641, Agenet, Agenet domain 3e-11
pfam01426120 pfam01426, BAH, BAH domain 2e-10
smart00439121 smart00439, BAH, Bromo adjacent homology domain 2e-09
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 2e-06
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 5e-04
cd04719128 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent 0.002
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information 
 Score =  189 bits (483), Expect = 2e-58
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 2/130 (1%)

Query: 12  FCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFL-PHN 70
           FCRNGV +SVHDFVYVL+EE  R +AY+ED+YED +G+KMV VRWFH  DEVG  L P +
Sbjct: 1   FCRNGVTISVHDFVYVLSEEEDRYVAYIEDLYEDKKGSKMVKVRWFHTTDEVGAALSPDS 60

Query: 71  FNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYP-QLQPFICDKQFENDDVK 129
            N REIF S  LQ +S+ECIDGLATVL+ +H+EKF +      +LQ + C +Q +N+ VK
Sbjct: 61  VNPREIFLSPNLQVISVECIDGLATVLTREHYEKFQSVPKNSSELQAYFCYRQIDNNKVK 120

Query: 130 PFDITLVKGY 139
           PFDIT ++GY
Sbjct: 121 PFDITQLRGY 130

BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 130
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|214798 smart00743, Agenet, Tudor-like domain present in plant sequences Back     alignment and domain information
>gnl|CDD|218672 pfam05641, Agenet, Agenet domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 100.0
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.87
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 99.84
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 99.76
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.71
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.62
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 99.57
smart00439120 BAH Bromo adjacent homology domain. 99.53
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.34
smart0074361 Agenet Tudor-like domain present in plant sequence 99.33
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.17
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 99.05
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.83
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 98.81
smart0074361 Agenet Tudor-like domain present in plant sequence 98.7
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 98.69
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 98.68
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 98.59
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 98.55
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 98.32
KOG1886464 consensus BAH domain proteins [Transcription] 97.78
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.36
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 96.91
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 96.62
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 96.38
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 95.55
PF15057124 DUF4537: Domain of unknown function (DUF4537) 95.38
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 95.12
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 94.86
PF07039130 DUF1325: SGF29 tudor-like domain; InterPro: IPR010 94.09
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 93.65
PF1214885 DUF3590: Protein of unknown function (DUF3590); In 93.18
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 92.87
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 92.57
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 90.3
cd0583587 Dnmt3b_related The PWWP domain is an essential com 89.06
PF06003264 SMN: Survival motor neuron protein (SMN); InterPro 88.8
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 88.8
cd0583483 HDGF_related The PWWP domain is an essential part 88.75
smart0029363 PWWP domain with conserved PWWP motif. conservatio 88.3
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 86.65
PLN00104450 MYST -like histone acetyltransferase; Provisional 85.12
PF00567121 TUDOR: Tudor domain; InterPro: IPR008191 There are 82.61
PF00567121 TUDOR: Tudor domain; InterPro: IPR008191 There are 80.64
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information 
Probab=100.00  E-value=2.8e-39  Score=294.72  Aligned_cols=128  Identities=59%  Similarity=1.065  Sum_probs=124.5

Q ss_pred             cccCCeEEEEeeEEEEEeccccchhhhhHHHhhcccCCeeEEEEEeeeccceeeecCCC-CCCceEEeeccccccceeee
Q 008969           12 FCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHN-FNDREIFFSLCLQDLSIECI   90 (547)
Q Consensus        12 F~rnG~ti~vh~FV~v~~ee~~~~vaYlEdmYED~~g~k~v~vRWFh~~~ev~~~lp~~-~~~rEvf~s~~~Q~is~Eci   90 (547)
                      |||||++|+|+|||||++++++.||||||+||||.+|.|||+||||++.+|+...+|+. ++++|||+|++.|+|++|||
T Consensus         1 ~~r~~~~i~vGD~V~v~~~~~~~~va~Ie~i~ed~~g~~~v~v~WF~~p~E~~~~~~~~~~~~~EvFlS~~~d~i~~~~I   80 (130)
T cd04721           1 FCRNGVTISVHDFVYVLSEEEDRYVAYIEDLYEDKKGSKMVKVRWFHTTDEVGAALSPDSVNPREIFLSPNLQVISVECI   80 (130)
T ss_pred             CccCCEEEECCCEEEEeCCCCCcEEEEEEEEEEcCCCCEEEEEEEecCHHHhccccCCCCCCCCeEEEcCCccccchHHe
Confidence            89999999999999999999999999999999999999999999999999999999987 99999999999999999999


Q ss_pred             cccccccChHHHHHHhhhhCC-CCcceeeEEeeecCCCcceeeeccccee
Q 008969           91 DGLATVLSPQHFEKFMNEATY-PQLQPFICDKQFENDDVKPFDITLVKGY  139 (547)
Q Consensus        91 dg~AtVL~peH~ek~~~~a~~-~~~~~~~C~rq~~~~~vkPFdltqL~GY  139 (547)
                      +|.|+|||++||+|+.+...+ +...+|+|.|++++++++|||+++||||
T Consensus        81 ~gk~~Vls~~~y~k~~~~~~~~~~~~~f~C~~~~d~~~~~~fd~~~~~g~  130 (130)
T cd04721          81 DGLATVLTREHYEKFQSVPKNSSELQAYFCYRQIDNNKVKPFDITQLRGY  130 (130)
T ss_pred             eeeeEECCHHHHhhhhccccCccccccEEEEEEecCCCCceeeeeccccC
Confidence            999999999999999998877 5579999999999999999999999999

BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>PF07039 DUF1325: SGF29 tudor-like domain; InterPro: IPR010750 SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PF00567 TUDOR: Tudor domain; InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins [] Back     alignment and domain information
>PF00567 TUDOR: Tudor domain; InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 5e-27
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 5e-21
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 9e-11
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.76
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 99.51
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.39
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.32
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 98.87
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 98.79
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 98.28
3swr_A1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 98.1
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 97.96
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 97.32
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 97.26
3sd4_A69 PHD finger protein 20; tudor domain, transcription 97.1
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.04
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 97.04
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 97.0
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 96.92
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 96.92
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 96.85
3qii_A85 PHD finger protein 20; tudor domain, structural ge 96.81
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 96.81
2lcc_A76 AT-rich interactive domain-containing protein 4A; 96.8
2d9t_A78 Tudor domain-containing protein 3; structural geno 96.77
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 96.75
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 96.74
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 96.65
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 96.61
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 96.59
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 96.52
3s6w_A54 Tudor domain-containing protein 3; methylated argi 96.5
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 96.48
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 96.44
3s6w_A54 Tudor domain-containing protein 3; methylated argi 96.43
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 96.41
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 96.38
2eqk_A85 Tudor domain-containing protein 4; structural geno 96.32
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 96.2
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 96.11
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.05
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 95.97
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 95.95
2d9t_A78 Tudor domain-containing protein 3; structural geno 95.81
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 95.77
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 95.72
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 95.55
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 94.52
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 95.42
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 94.34
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 95.25
3qii_A85 PHD finger protein 20; tudor domain, structural ge 95.19
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 95.15
2lcd_A118 AT-rich interactive domain-containing protein 4A; 94.13
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 95.12
3mea_A180 SAGA-associated factor 29 homolog; structural geno 95.09
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 94.06
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 95.03
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 94.9
3mp6_A522 MBP, SGF29, maltose-binding periplasmic protein, l 94.9
2eqk_A85 Tudor domain-containing protein 4; structural geno 94.81
2diq_A110 Tudor and KH domain-containing protein; tudor doma 94.68
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 94.58
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 94.48
2diq_A110 Tudor and KH domain-containing protein; tudor doma 94.44
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 94.16
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 93.58
2bud_A92 Males-absent on the first protein; transferase, MO 93.55
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 93.41
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 93.29
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 93.09
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 92.78
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 92.11
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 91.97
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 91.52
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 91.49
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 91.3
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 91.08
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 90.95
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 90.33
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 89.55
3sd4_A69 PHD finger protein 20; tudor domain, transcription 89.42
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 89.22
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 89.14
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 88.65
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 88.4
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 87.82
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 87.6
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 87.59
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 87.35
3qby_A94 Hepatoma-derived growth factor-related protein 2; 87.33
1ssf_A156 Transformation related protein 53 binding protein 86.97
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 86.7
2k3y_A136 Chromatin modification-related protein EAF3; dimet 86.45
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 86.03
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 85.52
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 85.4
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 85.37
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 85.34
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 85.21
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 84.62
2eqj_A66 Metal-response element-binding transcription facto 83.69
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 82.49
3bdl_A570 Staphylococcal nuclease domain-containing protein 82.37
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 82.21
2l89_A108 PWWP domain-containing protein 1; histone binding, 82.17
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 82.11
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 81.61
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 81.39
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 80.99
2eqj_A66 Metal-response element-binding transcription facto 80.94
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 80.63
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 80.38
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>3mea_A SAGA-associated factor 29 homolog; structural genomics consortium, SGC, nucleus, transcription, transcription regulation, chromosomal protein, DNA-binding; HET: M3L; 1.26A {Homo sapiens} PDB: 3meu_A* 3met_A* 3me9_A* 3mev_A* 3lx7_A 3mew_A Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 2e-06
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 46.5 bits (110), Expect = 2e-06
 Identities = 25/177 (14%), Positives = 46/177 (25%), Gaps = 29/177 (16%)

Query: 2   SRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYL---------------------- 39
              K +HY     +G+K+   D V +  E       Y+                      
Sbjct: 36  RGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLR 95

Query: 40  --EDMYEDSRGNKMVVVRWFHKIDE-VGIFLPHNFNDREIFFSLCLQDLSIECIDGLATV 96
             E                 ++             N  E++ +  L +L +     +A V
Sbjct: 96  WFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANV 155

Query: 97  LSPQHFEKFMNEATYPQLQPFICDKQFENDDVK--PFDITLVKGYWRQEIIRHLFTF 151
           +    +E         +   F      E    K    +I  VK Y ++   R    +
Sbjct: 156 MDGSKWEVLKGNVDPERD--FTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEY 210

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 98.26
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 97.06
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.7
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 96.37
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.14
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 95.56
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 95.47
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 95.17
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 95.07
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 94.45
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 94.19
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 93.75
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 93.66
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 93.63
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 93.53
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 93.37
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 93.27
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 93.04
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 91.35
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 89.94
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 87.35
d1wjra_127 Scm-like with four MBT domains protein 2, SFMBT2 ( 85.78
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 84.05
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 83.03
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 80.8
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.26  E-value=1.5e-08  Score=96.82  Aligned_cols=132  Identities=15%  Similarity=0.190  Sum_probs=99.0

Q ss_pred             ccccccccCCeEEEEeeEEEEEeccccc-hhhhhHHH-----------------------hhcccCCeeEEEEEeeeccc
Q 008969            7 KHYQSFCRNGVKVSVHDFVYVLAEENKR-LIAYLEDM-----------------------YEDSRGNKMVVVRWFHKIDE   62 (547)
Q Consensus         7 khY~sF~rnG~ti~vh~FV~v~~ee~~~-~vaYlEdm-----------------------YED~~g~k~v~vRWFh~~~e   62 (547)
                      ++|-.-.--|+++.+-|.|||-+++.+. .|+-++++                       -...-++++++++||-+.+|
T Consensus        41 ~~~~~r~~D~~e~~~GD~Vlvk~~~~~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~~~p~e  120 (217)
T d1m4za_          41 EHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLN  120 (217)
T ss_dssp             EEEEEETTTCCEECTTCEEEEEETTTTEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHSCCCHH
T ss_pred             cEEEEEecCCeEEecCCEEEEeCCCCCCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeeecCchh
Confidence            3444433369999999999999887654 44444443                       22233567788888888877


Q ss_pred             e-eeecCCCCCCceEEeeccccccceeeecccccccChHHHHHHhhhhCCCCcceeeEEeeecC--CCcceeeeccccee
Q 008969           63 V-GIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFEN--DDVKPFDITLVKGY  139 (547)
Q Consensus        63 v-~~~lp~~~~~rEvf~s~~~Q~is~Ecidg~AtVL~peH~ek~~~~a~~~~~~~~~C~rq~~~--~~vkPFdltqL~GY  139 (547)
                      . .-...+.++++|+|+|+.+-+|.+++|-|.|.||++..|+......  .....|+|.+.++.  ++++|+||..+.++
T Consensus       121 ~~~~k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~--~~~~~F~cr~~~D~~~~~f~~id~~~~~~~  198 (217)
T d1m4za_         121 YYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNV--DPERDFTVRYICEPTGEKFVDINIEDVKAY  198 (217)
T ss_dssp             HHHHHHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGC--CTTTEEEEEEECCTTSCCCEECCHHHHHHH
T ss_pred             hhhhccccccCcceeEecCccceeehhheeeeEEEecHHHhcchhhcc--CCCCeEEEEEEEcCCCCceeeccHHHhhhh
Confidence            4 3444567899999999999999999999999999999998543332  33578999999997  58999998877655


Q ss_pred             h
Q 008969          140 W  140 (547)
Q Consensus       140 w  140 (547)
                      .
T Consensus       199 ~  199 (217)
T d1m4za_         199 I  199 (217)
T ss_dssp             H
T ss_pred             c
Confidence            4
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure