Citrus Sinensis ID: 009006

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------

MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGSFVV

ccccccccccEEEEccccccccccccHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHccccccccccccccccccHHHHHHHcccccccc

cccccccccEEEEEEcccccccccccHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHccccccHHHHHcccccccccccccHHHcccccccccccccccc

MSPEVRPQQFAVLVRdlpdlpkgqsrkeQVDSYFKaiypdtfyrSMVVTNNKEANKIYEELEGYKKKLARAEAVYAesksagkpegtrptiktgFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVdtwtvsdapesreLIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLsktegipaVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKtfksiekdpnsIVDVLanslpgnatFFLTYVALQFFVGyglelsriVPLIIYHLKRKYLCKTEAELkeawfpgdlgygtrvpsdMLIVTIVFCYsciapliipFGVVYFALGWLILRNQALKVYVPAyesygrmwPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVASRelketpsmehifrsyiplslnsekvdddQFEDALSqasrsgsfvv

MSPEVRPQQFAVLvrdlpdlpkgqsrkeqvdSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYaesksagkpegtrptiktgflgllGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELkeawfpgdlgygtRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVAsrelketpsmehIFRSYIPLSLNSEKVDDDQFEDAlsqasrsgsfvv

MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAieyynekikeiiPKLEAEQKITLKEKQLGAALVFFTSRvaaasaaqslhaqlvDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIAlivflallpklllflSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFliplpilsliFVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGSFVV

*****************************VDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARA******************TIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVA***********HIFRSYIPL***************************

*****RP*QFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYA*************TIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTAL**************************************************

MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAE**************TRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVD*******************

*****RPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLN************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKExxxxxxxxxxxxxxxxxxxxxxxxxxxxGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQASRSGSFVV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		546	2.2.26 [Sep-21-2011]
Q09809		793	Uncharacterized membrane	yes	no	0.714	0.491	0.266	3e-41
Q03516		953	Uncharacterized protein R	yes	no	0.793	0.454	0.278	2e-33
Q09766		871	Uncharacterized membrane	no	no	0.672	0.421	0.266	6e-32
Q06538		782	Uncharacterized membrane	no	no	0.723	0.505	0.257	9e-29
Q12252		991	Phosphate metabolism prot	no	no	0.800	0.440	0.240	1e-28
Q5T3F8		832	Transmembrane protein 63B	yes	no	0.782	0.513	0.238	8e-21
Q91YT8		804	Transmembrane protein 63A	yes	no	0.716	0.486	0.251	2e-20
Q3TWI9		832	Transmembrane protein 63B	no	no	0.783	0.514	0.230	4e-20
O94886		807	Transmembrane protein 63A	no	no	0.721	0.488	0.248	7e-19
Q5R826		807	Transmembrane protein 63A	yes	no	0.721	0.488	0.242	4e-18

>sp\|Q09809\|YAB9_SCHPO Uncharacterized membrane protein C2G11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2	Back alignment and function desciption

 Score =  170 bits (430), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 106/398 (26%), Positives = 209/398 (52%), Gaps = 8/398 (2%)

Query: 87  TRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAA 146
             P IKT F G+ G+++DAI++Y+ K+ +I  ++E  +  +      G A + F S   A
Sbjct: 340 CHPLIKTHFFGIFGQKIDAIDFYSAKLYKISQQIENAR--SFDYPTTGQAFITFESMATA 397

Query: 147 ASAAQS-LHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIP 205
              AQ+ + ++ +    +  AP + ++ W+N  I  + +  + + + ++  + I+ + +P
Sbjct: 398 QIVAQTHIDSKSLMGLHIELAPAANDIQWHNTYIGRWHKFFQGWFITLVTFMIILLWTVP 457

Query: 206 IGLISALTTLDNLKKILPFLKPVI-NITALKTVLEAYLPQIALIVFLALLPKLLLFLSKT 264
           +G I+    LD ++++ P L  +I ++  L ++L  +LP +   +F+++ P L  +LS  
Sbjct: 458 VGAIAVFINLDTIRRLWPELGRMIEDLPFLNSLLRTFLPTLVYSLFISISPFLFRWLSSM 517

Query: 265 EGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSLPGN 324
           +G+ + +     A GK + +  +N F+   + G+   +   + KD  S    LAN LP  
Sbjct: 518 QGLSSRAEEEIYAVGKNYAYLFVNFFLVYVIAGS--TSIWELAKDTTSFAHFLANRLPHQ 575

Query: 325 ATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTRVPS 384
           A FF+  + LQ    + L+L ++  L  Y ++R ++  + A  K+   P     G  +P 
Sbjct: 576 AQFFIDLIVLQGIGMFPLKLIQLGKLSSYFVRRSFVPYSIAS-KKFETPDSFSVGIFLPQ 634

Query: 385 DMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLV 444
            M I+ I  CYS I+PLI+ FG++YF +G+L+ + + +        S G +W  +FLR++
Sbjct: 635 PMFIMLICLCYSIISPLILVFGLIYFIIGFLVYKYELIYQMEHPQHSTGELWSTIFLRMI 694

Query: 445 AALLLYQITMLGYFGSKKFIYVGFLI-PLPILSLIFVY 481
              ++ Q+TM+G    +K  ++  +I PL   ++I  Y
Sbjct: 695 FGCVIMQLTMMGLMSLRKAYWLSTVIFPLLCFTVISAY 732

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|Q03516\|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1	Back alignment and function description

>sp\|Q09766\|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1	Back alignment and function description

>sp\|Q06538\|YL241_YEAST Uncharacterized membrane protein YLR241W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR241W PE=1 SV=1	Back alignment and function description

>sp\|Q12252\|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1	Back alignment and function description

>sp\|Q5T3F8\|TM63B_HUMAN Transmembrane protein 63B OS=Homo sapiens GN=TMEM63B PE=1 SV=1	Back alignment and function description

>sp\|Q91YT8\|TM63A_MOUSE Transmembrane protein 63A OS=Mus musculus GN=Tmem63a PE=2 SV=1	Back alignment and function description

>sp\|Q3TWI9\|TM63B_MOUSE Transmembrane protein 63B OS=Mus musculus GN=Tmem63b PE=1 SV=1	Back alignment and function description

>sp\|O94886\|TM63A_HUMAN Transmembrane protein 63A OS=Homo sapiens GN=TMEM63A PE=2 SV=3	Back alignment and function description

>sp\|Q5R826\|TM63A_PONAB Transmembrane protein 63A OS=Pongo abelii GN=TMEM63A PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		546
224061057		724	predicted protein [Populus trichocarpa]	0.996	0.751	0.783	0.0
357447203		722	Early-responsive to dehydration [Medicag	0.996	0.753	0.713	0.0
297740775		679	unnamed protein product [Vitis vinifera]	0.994	0.799	0.744	0.0
225443962		724	PREDICTED: uncharacterized membrane prot	0.994	0.75	0.744	0.0
449433557		725	PREDICTED: uncharacterized membrane prot	0.998	0.751	0.722	0.0
449490576		725	PREDICTED: LOW QUALITY PROTEIN: uncharac	0.998	0.751	0.721	0.0
356555504		723	PREDICTED: uncharacterized membrane prot	0.989	0.746	0.743	0.0
356549126		724	PREDICTED: uncharacterized membrane prot	0.990	0.747	0.738	0.0
18397470		724	Early-responsive to dehydration stress p	0.970	0.732	0.664	0.0
15375406		640	ERD4 protein [Arabidopsis thaliana]	0.970	0.828	0.664	0.0

>gi\|224061057\|ref\|XP_002300337.1\| predicted protein [Populus trichocarpa] gi\|222847595\|gb\|EEE85142.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/545 (78%), Positives = 489/545 (89%), Gaps = 1/545 (0%)

Query: 1   MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEE 60
           MSPE+ P+QFAVLVRD+P +P+G++RKEQVDSYFK+IYP+TFYRSMVVTNNKE NKIY E
Sbjct: 179 MSPELTPEQFAVLVRDIPPVPEGRTRKEQVDSYFKSIYPETFYRSMVVTNNKEVNKIYIE 238

Query: 61  LEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKL 120
           LEGYKKKLA AEAVY ESK  GKPEG RPTI+TG LG++G++VD+IE+YNEKIKE+IPKL
Sbjct: 239 LEGYKKKLAHAEAVYDESKKTGKPEGLRPTIRTGPLGIVGRKVDSIEHYNEKIKELIPKL 298

Query: 121 EAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIK 180
           EAEQK+TL+E Q   A  FFT+RV AASAAQSLHAQ+VDTWTV +APE R++IW+NL IK
Sbjct: 299 EAEQKVTLRENQQACAFAFFTNRVTAASAAQSLHAQMVDTWTVMEAPEPRQIIWSNLKIK 358

Query: 181 FFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEA 240
           +FQR IRQYVV  IVALTI+FYMIPIGLISALTTLDNLKKILPFLKP++NI A+KTVLEA
Sbjct: 359 YFQRIIRQYVVCFIVALTILFYMIPIGLISALTTLDNLKKILPFLKPIVNIVAVKTVLEA 418

Query: 241 YLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLF 300
           YLPQIALIVFLALLPKLLL LSK EGIP+V HAVRA SGKYFYFT+LNVFIGVT+GGTLF
Sbjct: 419 YLPQIALIVFLALLPKLLLALSKAEGIPSVGHAVRATSGKYFYFTILNVFIGVTLGGTLF 478

Query: 301 KTFKSIEKDPNSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYL 360
            TFKSIE+ PNSIV +LA+SLPGNATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KYL
Sbjct: 479 TTFKSIEEKPNSIVSLLASSLPGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYL 538

Query: 361 CKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQ 420
           CKTEAELKEAWFPGDLGY TR+P DML++TIV CYS IAPLIIPFGVVYF LGWL+LRNQ
Sbjct: 539 CKTEAELKEAWFPGDLGYATRIPGDMLVLTIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQ 598

Query: 421 ALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGF-LIPLPILSLIF 479
           ALKVY P++E+YGRMWPH+  R++AAL+L+Q+TM GYF  KKF +  F LIPLPILSL+F
Sbjct: 599 ALKVYAPSFETYGRMWPHIHTRVIAALILFQVTMFGYFVVKKFSFSTFLLIPLPILSLLF 658

Query: 480 VYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQAS 539
            Y+C K+FY+SFSDTALEVA RELKE P+ME I+RS+IP SL+SEK DDD FEDALSQ S
Sbjct: 659 AYVCHKKFYRSFSDTALEVACRELKEIPNMERIYRSFIPPSLSSEKADDDHFEDALSQVS 718

Query: 540 RSGSF 544
           R GSF
Sbjct: 719 RVGSF 723

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|357447203\|ref\|XP_003593877.1\| Early-responsive to dehydration [Medicago truncatula] gi\|355482925\|gb\|AES64128.1\| Early-responsive to dehydration [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297740775\|emb\|CBI30957.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225443962\|ref\|XP_002280109.1\| PREDICTED: uncharacterized membrane protein C24H6.13-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449433557\|ref\|XP_004134564.1\| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449490576\|ref\|XP_004158645.1\| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein C2G11.09-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356555504\|ref\|XP_003546071.1\| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine max]	Back alignment and taxonomy information

>gi\|356549126\|ref\|XP_003542948.1\| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine max]	Back alignment and taxonomy information

>gi|18397470|ref|NP_564354.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana] gi|12322128|gb|AAG51102.1|AC025295_10 unknown protein [Arabidopsis thaliana] gi|14334838|gb|AAK59597.1| unknown protein [Arabidopsis thaliana] gi|17104683|gb|AAL34230.1| unknown protein [Arabidopsis thaliana] gi|332193088|gb|AEE31209.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|15375406\|dbj\|BAB63915.1\| ERD4 protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		546
TAIR\|locus:2204227		724	ERD4 "early-responsive to dehy	0.970	0.732	0.588	1.8e-172
TAIR\|locus:2031735		806	AT1G32090 "AT1G32090" [Arabido	0.904	0.612	0.340	2.8e-73
TAIR\|locus:2140210		785	AT4G02900 [Arabidopsis thalian	0.901	0.626	0.324	3.7e-71
TAIR\|locus:2089850		756	AT3G21620 "AT3G21620" [Arabido	0.824	0.595	0.326	1.1e-64
TAIR\|locus:2120673		771	AT4G22120 [Arabidopsis thalian	0.957	0.678	0.286	7.6e-64
TAIR\|locus:2008860		771	AT1G11960 "AT1G11960" [Arabido	0.954	0.675	0.291	1.6e-63
TAIR\|locus:2134882		772	AT4G04340 [Arabidopsis thalian	0.902	0.638	0.300	2.6e-63
TAIR\|locus:2130130		761	AT4G15430 "AT4G15430" [Arabido	0.822	0.590	0.318	4.8e-62
TAIR\|locus:2027119		769	AT1G62320 "AT1G62320" [Arabido	0.891	0.633	0.286	1.9e-58
TAIR\|locus:2102117		703	HYP1 "hypothetical protein 1"	0.866	0.672	0.270	7e-46

TAIR\|locus:2204227 ERD4 "early-responsive to dehydration 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1676 (595.0 bits), Expect = 1.8e-172, P = 1.8e-172
 Identities = 317/539 (58%), Positives = 400/539 (74%)

Query:     1 MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEE 60
             MS +V+P+QFA+LVRD+P  P GQ++KE +DSYF+ IYP+TFYRS+V T N + NKI+E+
Sbjct:   183 MSADVKPEQFAILVRDMPAPPDGQTQKEFIDSYFREIYPETFYRSLVATENSKVNKIWEK 242

Query:    61 LEGYKKKLARAEAVYAESKSAGKPEGTRPTIKTGFLGLLGKRVDAXXXXXXXXXXXXPKL 120
             LEGYKKKLARAEA+ A + +       RPT KTGF GL+GK+VD+             KL
Sbjct:   243 LEGYKKKLARAEAILAATNN-------RPTNKTGFCGLVGKQVDSIEYYTELINESVAKL 295

Query:   121 EAEQKITLKEKQLGAALVFFTSRXXXXXXXXXXXXXXXDTWTVSDAPESRELIWNNLNIK 180
             E EQK  L EKQ  AA+VFFT+R               D WTV++APE R+L+W NLNIK
Sbjct:   296 ETEQKAVLAEKQQTAAVVFFTTRVAAASAAQSLHCQMVDKWTVTEAPEPRQLLWQNLNIK 355

Query:   181 FFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLEA 240
              F R IRQY +Y  VA+TI+FYMIPI  +SA+TTL NL++I+PF+KPV+ ITA++TVLE+
Sbjct:   356 LFSRIIRQYFIYFFVAVTILFYMIPIAFVSAITTLKNLQRIIPFIKPVVEITAIRTVLES 415

Query:   241 YLPQIAXXXXXXXXXXXXXXXSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLF 300
             +LPQIA               SK EGIP+ SHA+RAASGKYFYF+V NVFIGVT+ GTLF
Sbjct:   416 FLPQIALIVFLAMLPKLLLFLSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLF 475

Query:   301 KTFKSIEKDP--NSIVDVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRK 358
              T K I K+P  + I+++LA SLP +ATFFLTYVAL+FF+GYGLELSRI+PLII+HLK+K
Sbjct:   476 NTVKDIAKNPKLDMIINLLATSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKK 535

Query:   359 YLCKTEAELKEAWFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILR 418
             YLCKTEAE+KEAW+PGDL Y TRVP DMLI+TI FCYS IAPLI+ FG+ YF LGWL+LR
Sbjct:   536 YLCKTEAEVKEAWYPGDLSYATRVPGDMLILTITFCYSVIAPLILIFGITYFGLGWLVLR 595

Query:   419 NQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFXXXXXXXXXX 478
             NQALKVYVP+YESYGRMWPH+  R++AAL L+Q+ M GY G+K F Y             
Sbjct:   596 NQALKVYVPSYESYGRMWPHIHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLI 655

Query:   479 FVYICQKRFYKSFSDTALEVASRELKETPSMEHIFRSYIPLSLNSEKVDDDQFEDALSQ 537
             F Y+C+++FY  F  TALEVA RELK++P +E IFR+YIP SL+S K ++ +F+ A+S+
Sbjct:   656 FGYVCRQKFYGGFEHTALEVACRELKQSPDLEEIFRAYIPHSLSSHKPEEHEFKGAMSR 714

GO:0005576 "extracellular region" evidence=ISM

GO:0016020 "membrane" evidence=IEA;IDA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0005773 "vacuole" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

TAIR\|locus:2031735 AT1G32090 "AT1G32090" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2140210 AT4G02900 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2089850 AT3G21620 "AT3G21620" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2120673 AT4G22120 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008860 AT1G11960 "AT1G11960" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2134882 AT4G04340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2130130 AT4G15430 "AT4G15430" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2027119 AT1G62320 "AT1G62320" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2102117 HYP1 "hypothetical protein 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		546
pfam02714		325	pfam02714, DUF221, Domain of unknown function DUF2	1e-107
COG5594		827	COG5594, COG5594, Uncharacterized integral membran	2e-68

>gnl\|CDD\|190398 pfam02714, DUF221, Domain of unknown function DUF221	Back alignment and domain information

 Score =  324 bits (833), Expect = e-107
 Identities = 130/325 (40%), Positives = 194/325 (59%), Gaps = 2/325 (0%)

Query: 136 ALVFFTSRVAAASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIV 195
           A V F S+ AA  AAQ+L       W    APE R++IW NL++  ++R +R+ +V +++
Sbjct: 1   AFVTFKSQAAAQMAAQALQHHNPLKWPTYLAPEPRDIIWENLSLSRWERWLRRLIVNLLL 60

Query: 196 ALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINI-TALKTVLEAYLPQIALIVFLALL 254
            L I+F+ IP+  +  L+ L+ L K+ PFLK ++++   L  ++   LP + L + +ALL
Sbjct: 61  FLLIIFWAIPVAFVGLLSNLETLTKVWPFLKWILDLPPVLLGLVTGLLPTLLLSLLMALL 120

Query: 255 PKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIV 314
           P +L FLSK +G P+ S    +   KYF F V+NVF+ VT+  T       I  +P SI 
Sbjct: 121 PIILRFLSKLQGHPSRSDVELSVQSKYFAFLVVNVFLVVTLASTASSLITEIIDNPTSIP 180

Query: 315 DVLANSLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWF-P 373
            +LA +LP  + FF++Y+ LQ   G   EL ++ PLI+Y+++RK+L KT  +  E +  P
Sbjct: 181 TLLATNLPKASNFFISYILLQGLSGAAGELLQLGPLILYYIRRKFLDKTPRDKWERYTTP 240

Query: 374 GDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYG 433
               YGT  P  +LI TI   YS IAPLI+PFG+VYF LG+ + + Q L VYV  YES G
Sbjct: 241 PSFDYGTVYPVFLLIFTIGLIYSVIAPLILPFGLVYFGLGYFVYKYQLLYVYVTKYESGG 300

Query: 434 RMWPHMFLRLVAALLLYQITMLGYF 458
             WP    RL+  L L+Q+ ++G F
Sbjct: 301 LFWPRALNRLLVGLYLFQLCLIGLF 325

This family consists of hypothetical transmembrane proteins none of which have any function, the aligned region is at 538 residues at maximum length. Length = 325

>gnl\|CDD\|227881 COG5594, COG5594, Uncharacterized integral membrane protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		546
KOG1134		728	consensus Uncharacterized conserved protein [Gener	100.0
COG5594		827	Uncharacterized integral membrane protein [Functio	100.0
PF02714		325	DUF221: Domain of unknown function DUF221; InterPr	100.0
PF04547		452	Anoctamin: Calcium-activated chloride channel; Int	99.27
PF14703		85	DUF4463: Domain of unknown function (DUF4463)	99.14
KOG2513		647	consensus Protein required for meiotic chromosome	98.23
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	97.28
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	96.61
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	96.43
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	96.42
PLN03120		260	nucleic acid binding protein; Provisional	96.32
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	96.29
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	96.26
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	95.95
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	95.76
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	95.13
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	95.07
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	94.96
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	94.51
KOG0122		270	consensus Translation initiation factor 3, subunit	94.34
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	93.89
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	93.29
KOG2514		861	consensus Uncharacterized conserved protein [Funct	93.06
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	92.36
PLN03121		243	nucleic acid binding protein; Provisional	92.14
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	91.98
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	91.62
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	91.58
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	91.45
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	91.02
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	90.77
smart00362		72	RRM_2 RNA recognition motif.	90.18
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	90.12
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	90.02
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	89.34
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	88.4
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	86.88
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	86.15
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	85.7
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	85.52
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	84.42
PF07810		111	TMC: TMC domain; InterPro: IPR012496 These sequenc	84.16
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	82.1
KOG1548		382	consensus Transcription elongation factor TAT-SF1	82.0
KOG1457		284	consensus RNA binding protein (contains RRM repeat	80.68
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	80.17

>KOG1134 consensus Uncharacterized conserved protein [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.6e-91  Score=771.91  Aligned_cols=520  Identities=38%  Similarity=0.679  Sum_probs=481.4

Q ss_pred             CCCCCCCCcceEEEcCCCCCCCCCChHHHHHHHhhhhCCCceEEEEEecCcchHHHHHHHHHHHH-HHHHHHHHHHhhhc
Q 009006            1 MSPEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYK-KKLARAEAVYAESK   79 (546)
Q Consensus         1 ~~~~~~~s~yTV~V~~IP~~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~d~~~l~~L~~~r~~~~-~~Le~~~~~~~~~k   79 (546)
                      +++..+++++|+.++++|+ ..+++.....+++|+..+|+++.++++++|..++.++.+++++.. +++.+...+..   
T Consensus       179 ~~~~~~~~~~s~~~~~~~~-~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~k~~~~~l~~~~~~~~---  254 (728)
T KOG1134|consen  179 ASPKYRPDQSSVLVRNVPP-PDGVSVSVIVRHFFSLNHPVKVRSHQVVYNESKLSKLLSKLKKLRENKLYKEHKRLK---  254 (728)
T ss_pred             hCcCcCccccchhhhcccC-CCCCchhhHHhhhhhccCCceeehhHHHhhHHHHHHHHHHHHHHhHHHHHHhhhhhc---
Confidence            3677889999999999993 333455677788888888999999999999999999999999984 33333322211   


Q ss_pred             cCCCCCCCCCcccccccCCCCccccHHHHHHHHHHHHhHHHHHHHhhhhccCCCceEEEEeCCHHHHHHHHHhcccCCCC
Q 009006           80 SAGKPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQLVD  159 (546)
Q Consensus        80 ~~~~~~~~rP~~r~g~~~~~g~kvd~i~~~~~~l~~l~~~I~~~~~~~~~~~~~~~AFVtF~s~~~a~~a~q~~~~~~~~  159 (546)
                        ..+. +||++|.|+||++|+|||+||||++|+++++++|+++|+...+.+..+.|||||+|+.+|+.|+|..++.+++
T Consensus       255 --~~~~-~rP~~k~~~~~l~gkkvdai~yy~~kl~~l~~~i~~~~~~~~~~~~~~~aFVtf~sr~~A~~~aq~~~~~~~~  331 (728)
T KOG1134|consen  255 --SNPK-KRPKRKLGFCGLFGKKVDAIDYYSEKLQELSEDIEELRESLYEEKPLPAAFVTFKSRYGAAVAAQTQQSLNPT  331 (728)
T ss_pred             --cccc-cCCcceeeeeeeecceecHHHHHHHHHHHHHHHHHHHHHHHHhcCCCceEEEEEEeeHHHHHHHHhhhcCCCC
Confidence              1223 8999999999999999999999999999999999999998876678999999999999999999999999999


Q ss_pred             ceeeecCCCCCcceeccccchhHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhcchhhhhhhcccchhhhcchhHHHHHH
Q 009006          160 TWTVSDAPESRELIWNNLNIKFFQRQIRQYVVYVIVALTIMFYMIPIGLISALTTLDNLKKILPFLKPVINITALKTVLE  239 (546)
Q Consensus       160 ~~~v~~APeP~DI~W~Nl~~~~~~r~~R~~~~~~~~~~l~if~~iPv~~v~~l~~~~~l~~~~p~l~~~~~~~~~~~~i~  239 (546)
                      .|.++.||||+||.|+|+..+.++|+.|+++++++.+++++||++|+++|++++|++.|++.+||++++.+.++++++|+
T Consensus       332 ~w~~~~APeP~Di~W~nl~i~~~~~~~~~~~~~~~~~~li~f~~iPva~V~~l~nl~~l~~~~Pflk~i~~~~~i~~vI~  411 (728)
T KOG1134|consen  332 KWLTEFAPEPRDIYWDNLAISYVERYLRRFLVNVALFLLLFFWIIPVAFVQALTNLEGLSKVFPFLKPILEMKFISSVIT  411 (728)
T ss_pred             ceEEEecCCcccceecccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccchhhhhhhcchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998899999999


Q ss_pred             HHhHHHHHHHHHHHHHHHHHHHHhccCCCchhHHHHHHHhhHHHHHHHHHHHHHhhhhhHHHHHHHHhcCcchHHHHHHH
Q 009006          240 AYLPQIALIVFLALLPKLLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLAN  319 (546)
Q Consensus       240 ~~lP~lil~~~n~llp~il~~ls~~e~~~s~S~~~~s~~~k~f~f~~iN~~lv~~l~~~~~~~l~~~~~~p~~i~~~l~~  319 (546)
                      |+||++++.++++++|.++++++++|||.|+|+.|++.+.|+|+|+++|+|++++++|+.++.+..++++|.+++..+|.
T Consensus       412 gfLP~l~l~~~~~~lP~~l~~ls~~eG~~s~S~~e~~a~~k~~~F~~~nvFl~~~l~~sa~~~~~~~l~~p~~i~~~la~  491 (728)
T KOG1134|consen  412 GFLPTLALVIFLALLPPFLRYLSKLEGLISRSEEERSALNKYYIFLLVNVFLVVTLSGSALRQLLSILSTPRLIPKLLAA  491 (728)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhcCccchhHHHHHHHHhHHHHHHhhhHHHhhhhHHHHHHHHHHhcCHhHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999889999999999


Q ss_pred             hCCCchhHHHHHHHHHHhhhhhHHhhhHHHHHHHHHHHhhccCCHHHHHHhcCC-CCCCccccchHHHHHHHHHHHhhhh
Q 009006          320 SLPGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFP-GDLGYGTRVPSDMLIVTIVFCYSCI  398 (546)
Q Consensus       320 ~lp~~s~fFi~yii~~~~~~~~~~llr~~~l~~~~~~~~~~~~T~re~~~~~~~-~~f~~~~~y~~~l~~~~i~l~Ys~i  398 (546)
                      ++|++++||++|++++|+.|.+++++|+.+|+++++++.+..+|+|++++.+++ +.+++|..||..+++++||++||++
T Consensus       492 ~lP~~a~Ff~~yii~~g~~g~~~ellrl~~Li~~~i~~~~~~~t~~~~~e~~~p~~~~~~g~~yP~~~~~f~i~i~Ysvi  571 (728)
T KOG1134|consen  492 ALPKQASFFITYIITSGWAGFAGELLRLVPLIIYLLKKLFLKSTPRDREERYEPLSSFYFGTIYPRILLIFTIGICYSVI  571 (728)
T ss_pred             hChhhHHHHHHHHHHhccchhhHHHhcchhHHHHHHHHHHcccchhhhhhhcCCccccchhhhccHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999997 7899999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHHHhhheeeccCCcCCccccHHHHHHHHHHHHHHHHHHHHHHHhhccccch-hhhHHHHHHHH
Q 009006          399 APLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYV-GFLIPLPILSL  477 (546)
Q Consensus       399 ~Plil~~~~~yf~l~y~v~Ky~llyvy~~~~esgG~~~~~~~~~~~~~l~i~q~~~~g~f~lk~~~~~-~~~~~l~i~t~  477 (546)
                      +|+|+|||++||++.|+|||||++|||.++|||||++||.+++++++|++++|++|+|+|++|+.+.+ .+++|++++|+
T Consensus       572 aPlILpF~lvyF~l~y~vyr~ql~yvy~~~yes~g~~wp~ih~~ii~~l~l~ql~l~gl~~~k~~~~~s~~~~~l~~lTi  651 (728)
T KOG1134|consen  572 APLILPFGLVYFCLAYLVYRYQLIYVYNQKYESGGRFWPDIHRRIIFGLILFQLILFGLFSLKKGAVASVLLFPLIVLTI  651 (728)
T ss_pred             hHHHHHHHHHHHHHHHHHHhhhhheeecccccccccchHHHHHHHHHHHHHHHHHHHHHHHhccccccchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998654 59999999999


Q ss_pred             HHHHHHHhcccccccccchHHHhhhcccC----CCc----cccccccCCCCCCCCCCC
Q 009006          478 IFVYICQKRFYKSFSDTALEVASRELKET----PSM----EHIFRSYIPLSLNSEKVD  527 (546)
Q Consensus       478 ~f~~~~~~~~~~~~~~~pl~~~~~~d~~~----~~~----~~~~~~Y~~p~l~~~~~~  527 (546)
                      +||.+|..+|.|.+.++|++.+..+|..+    ++.    ....++|.+|++.+.+++
T Consensus       652 ~~~~~c~~rf~p~f~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  709 (728)
T KOG1134|consen  652 LFHIYCKGRFLPLFIAYPIEEAEVDDTLDEEREPNMENLYNYLKSAYVLPVFLSGSDS  709 (728)
T ss_pred             HHHHHHhhhccccccccchhhhhhccCCccccCCChhhccccccccccCccccccccc
Confidence            99999999999999999999999777543    222    457999999999988744

>COG5594 Uncharacterized integral membrane protein [Function unknown]	Back alignment and domain information

>PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length	Back alignment and domain information

>PF04547 Anoctamin: Calcium-activated chloride channel; InterPro: IPR007632 This family contains the anoctamin/TMEM16 proteins which are thought to be calcium-dependent chloride channel []	Back alignment and domain information

>PF14703 DUF4463: Domain of unknown function (DUF4463)	Back alignment and domain information

>KOG2513 consensus Protein required for meiotic chromosome segregation [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG2514 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PF07810 TMC: TMC domain; InterPro: IPR012496 These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 (Q7TN63 from SWISSPROT) and EVIN2 (Q8IU68 from SWISSPROT) - this region is termed the TMC domain []	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		546
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 66.0 bits (160), Expect = 2e-11
 Identities = 95/602 (15%), Positives = 174/602 (28%), Gaps = 195/602 (32%)

Query: 8   QQFAVLVRDLPDLPKGQ-SRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGY-- 64
           +Q   L  D     K   SR +      +A+              + A  +   ++G   
Sbjct: 114 EQRDRLYNDNQVFAKYNVSRLQPYLKLRQALL-----------ELRPAKNVL--IDGVLG 160

Query: 65  --KKKLARAEAVYAESKSAGKPEG---------TRPTIKTGFLGLLGKRVD----AIEYY 109
             K  +A  +   +                     P      L  L  ++D    +   +
Sbjct: 161 SGKTWVA-LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDH 219

Query: 110 NEKIKEIIPKLEAEQKITLKEKQLGAAL--------------------VFFTSR----VA 145
           +  IK  I  ++AE +  LK K     L                    +  T+R      
Sbjct: 220 SSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTD 279

Query: 146 AASAAQSLHAQLVDTWTVSDAPESRELIWNNLNIKFFQ--RQIRQYVVYVIVALTIMFYM 203
             SAA + H  L          E + L+   L+ +     R+           LT     
Sbjct: 280 FLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPRE----------VLTTN--- 326

Query: 204 IP--IGLISAL-----TTLDNLKKILPFLKPVINITALKTVLEAYLPQIALIVFLALLPK 256
            P  + +I+        T DN K +        N   L T++E+ L  +    +  +  +
Sbjct: 327 -PRRLSIIAESIRDGLATWDNWKHV--------NCDKLTTIIESSLNVLEPAEYRKMFDR 377

Query: 257 LLLFLSKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDV 316
           L +F   +  IP                 +L++                I+ D   +V+ 
Sbjct: 378 LSVF-PPSAHIPT---------------ILLSLIWF-----------DVIKSDVMVVVNK 410

Query: 317 LAN-SL----PGNATFFLTYVALQFFVGYGLELS-RIVPLIIYHLKRKYLCKTEAELKEA 370
           L   SL    P  +T  +            + L  ++     Y L R  +      + + 
Sbjct: 411 LHKYSLVEKQPKESTISI----------PSIYLELKVKLENEYALHRSIV--DHYNIPKT 458

Query: 371 WFPGDLGYGTRVPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGW-LILRNQALKVYVPAY 429
           +   DL        D         Y             Y  +G  L       ++     
Sbjct: 459 FDSDDL---IPPYLDQ--------Y------------FYSHIGHHLKNIEHPERM----- 490

Query: 430 ESYGRMWPHMFLRLVAALLLYQITMLGYFGSKKFIYVGFLI--PLPILSLIFVYICQKRF 487
                ++  +FL                F  +K  +          IL+ +     Q +F
Sbjct: 491 ----TLFRMVFLDF-------------RFLEQKIRHDSTAWNASGSILNTLQ----QLKF 529

Query: 488 YKSF---SDTALEVASRELKE-TPSME-HIFRS----YIPLSLNSEKVDDDQFEDALSQA 538
           YK +   +D   E     + +  P +E ++  S     + ++L +E  D+  FE+A  Q 
Sbjct: 530 YKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAE--DEAIFEEAHKQV 587

Query: 539 SR 540
            R
Sbjct: 588 QR 589

PyMOL of 1vt4

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		546
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	97.82
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	97.7
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	97.58
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	97.56
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.55
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	97.55
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	97.55
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	97.54
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	97.54
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	97.51
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	97.51
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	97.51
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	97.49
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	97.47
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	97.46
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	97.44
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.43
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	97.43
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	97.41
2div_A		99	TRNA selenocysteine associated protein; structural	97.41
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	97.39
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	97.38
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	97.38
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	97.38
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	97.38
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	97.36
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	97.36
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	97.35
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	97.34
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	97.33
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	97.33
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	97.32
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	97.31
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	97.31
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	97.3
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	97.3
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	97.29
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	97.28
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	97.28
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	97.28
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	97.27
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	97.25
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	97.25
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	97.23
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	97.23
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	97.22
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	97.21
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	97.21
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	97.2
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	97.2
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	97.17
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	97.17
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	97.17
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	97.16
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	97.16
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	97.14
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	97.13
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	97.13
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	97.12
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	97.12
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	97.11
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	97.11
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	97.1
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	97.09
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	97.09
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.07
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	97.07
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	97.06
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	97.06
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	97.04
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	97.04
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	97.04
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	97.03
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	97.03
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	97.02
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	97.01
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	97.01
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	97.01
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	96.98
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	96.98
1x4e_A		85	RNA binding motif, single-stranded interacting pro	96.97
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	96.96
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	96.96
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	96.95
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	96.95
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	96.95
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	96.95
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	96.95
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	96.92
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.87
1x5o_A		114	RNA binding motif, single-stranded interacting pro	96.87
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	96.85
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	96.84
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	96.84
2dis_A		109	Unnamed protein product; structural genomics, RRM	96.83
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	96.83
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	96.82
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	96.81
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	96.81
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	96.8
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	96.79
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	96.78
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	96.78
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	96.78
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	96.74
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	96.74
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	96.73
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	96.73
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	96.72
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	96.72
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	96.72
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	96.7
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	96.7
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	96.68
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	96.67
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	96.66
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	96.64
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	96.63
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	96.63
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	96.62
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	96.62
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	96.62
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	96.62
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	96.61
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	96.6
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	96.6
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	96.6
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	96.51
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	96.48
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	96.47
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	96.46
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	96.46
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	96.46
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	96.44
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	96.38
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	96.37
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	96.36
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	96.34
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	96.28
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	96.26
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	96.26
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	96.24
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	96.23
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	96.21
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	96.2
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	96.19
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.17
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	96.14
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	96.14
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	96.13
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	96.09
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	96.09
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	96.06
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	96.0
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	95.95
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	95.9
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	95.89
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	95.87
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	95.73
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	95.7
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	95.7
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	95.55
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	95.54
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	95.45
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	95.13
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	95.13
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	95.11
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	95.1
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	94.84
1x5p_A		97	Negative elongation factor E; structure genomics,	94.77
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	94.7
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	94.45
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	94.16
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	94.15
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	94.06
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	94.04
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	93.98
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	93.97
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	93.72
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	93.71
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	93.61
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	93.55
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	93.39
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	93.38
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	93.34
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	93.22
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	93.07
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	93.05
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	93.04
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	92.88
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	92.67
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	91.88
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	89.99
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	88.64
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	87.52
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	87.45
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	84.69
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	82.27
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	82.06
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	80.89

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

Probab=97.82  E-value=9.7e-05  Score=61.10  Aligned_cols=82  Identities=21%  Similarity=0.254  Sum_probs=61.4

Q ss_pred             CCCCCCcceEEEcCCCCCCCCCChHHHHHHHhhhhCCCceEEEEEecCcchHHHHHHHHHHHHHHHHHHHHHHhhhccCC
Q 009006            3 PEVRPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAG   82 (546)
Q Consensus         3 ~~~~~s~yTV~V~~IP~~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~d~~~l~~L~~~r~~~~~~Le~~~~~~~~~k~~~   82 (546)
                      ++...+..+|.|.|||.+++    +++|+++|+++  |.|.++.+.+|..                              
T Consensus        13 en~~~~gt~lfV~nLp~~~t----e~~L~~~F~~~--G~I~~v~i~~d~~------------------------------   56 (99)
T 4fxv_A           13 ENLYFQGTNLIVNYLPQNMT----QDELRSLFSSI--GEVESAKLIRDKV------------------------------   56 (99)
T ss_dssp             ---CCCCSEEEEESCCTTCC----HHHHHHHHHTT--SCEEEEEEEECSS------------------------------
T ss_pred             ccccCCCCEEEEeCCCCCCC----HHHHHHHHHhc--CCEEEeEeeecCC------------------------------
Confidence            45566778999999999987    79999999997  7899988875421                              


Q ss_pred             CCCCCCCcccccccCCCCccccHHHHHHHHHHHHhHHHHHHHhhhhccCCCceEEEEeCCHHHHHHHHHhcccC--CCCc
Q 009006           83 KPEGTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQ--LVDT  160 (546)
Q Consensus        83 ~~~~~rP~~r~g~~~~~g~kvd~i~~~~~~l~~l~~~I~~~~~~~~~~~~~~~AFVtF~s~~~a~~a~q~~~~~--~~~~  160 (546)
                                                                    .....|.|||+|.+..+|..|.+.++..  ....
T Consensus        57 ----------------------------------------------tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~   90 (99)
T 4fxv_A           57 ----------------------------------------------AGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKT   90 (99)
T ss_dssp             ----------------------------------------------SCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEE
T ss_pred             ----------------------------------------------CCcccccEEEEECCHHHHHHHHHHhCCCEECCEE
Confidence                                                          0123579999999999999999877543  3345


Q ss_pred             eeeecC
Q 009006          161 WTVSDA  166 (546)
Q Consensus       161 ~~v~~A  166 (546)
                      ++|+.|
T Consensus        91 l~V~~A   96 (99)
T 4fxv_A           91 IKVSYA   96 (99)
T ss_dssp             CEEEEC
T ss_pred             EEEEEe
Confidence            667766

PyMOL of 4fxv

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		546
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	97.99
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	97.92
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	97.88
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.85
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	97.81
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	97.79
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	97.77
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	97.75
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	97.73
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.7
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	97.65
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	97.64
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	97.64
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	97.64
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	97.62
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	97.62
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.6
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	97.59
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.57
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	97.56
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.55
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	97.53
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	97.52
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	97.51
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	97.51
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	97.5
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.5
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.4
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.39
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	97.36
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.35
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.35
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	97.32
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	97.32
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	97.3
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	97.27
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	97.26
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	97.23
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	97.22
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	97.22
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	97.22
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	97.22
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	97.18
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	97.16
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	97.15
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	97.14
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.13
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	97.12
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	97.11
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	97.09
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	97.07
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	97.01
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	97.01
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	97.01
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	96.98
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	96.96
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	96.94
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	96.94
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	96.92
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	96.9
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	96.88
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	96.81
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	96.77
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	96.74
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	96.71
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	96.69
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	96.69
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	96.64
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	96.61
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	96.35
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	96.19
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	96.03
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	96.02
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	96.01
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	95.77
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	95.61
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.56
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	94.55
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	93.14
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	90.51
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	89.88
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	87.67
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	84.59

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor 3B subunit 4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.99  E-value=2.1e-05  Score=62.47  Aligned_cols=84  Identities=17%  Similarity=0.148  Sum_probs=64.1

Q ss_pred             CCCcceEEEcCCCCCCCCCChHHHHHHHhhhhCCCceEEEEEecCcchHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCC
Q 009006            6 RPQQFAVLVRDLPDLPKGQSRKEQVDSYFKAIYPDTFYRSMVVTNNKEANKIYEELEGYKKKLARAEAVYAESKSAGKPE   85 (546)
Q Consensus         6 ~~s~yTV~V~~IP~~~~~~~~~~~l~~~F~~~~p~~v~~v~~~~d~~~l~~L~~~r~~~~~~Le~~~~~~~~~k~~~~~~   85 (546)
                      ...+.||.|.|||.+++    +++|+++|+++  |.|.++.+++|-.                                 
T Consensus         6 ~~~~~tlfV~nLp~~~t----~~~l~~~F~~~--G~v~~v~~~~d~~---------------------------------   46 (93)
T d1x5ua1           6 RNQDATVYVGGLDEKVS----EPLLWELFLQA--GPVVNTHMPKDRV---------------------------------   46 (93)
T ss_dssp             CCTTTEEEEECCCTTCC----HHHHHHHHHTT--SCEEEEECCBCSS---------------------------------
T ss_pred             CCCCCEEEEeCCCCcCC----HHHHHHHHHHh--CCccccceeeccc---------------------------------
Confidence            45678999999999987    79999999998  6788887765410                                 


Q ss_pred             CCCCcccccccCCCCccccHHHHHHHHHHHHhHHHHHHHhhhhccCCCceEEEEeCCHHHHHHHHHhcccC--CCCceee
Q 009006           86 GTRPTIKTGFLGLLGKRVDAIEYYNEKIKEIIPKLEAEQKITLKEKQLGAALVFFTSRVAAASAAQSLHAQ--LVDTWTV  163 (546)
Q Consensus        86 ~~rP~~r~g~~~~~g~kvd~i~~~~~~l~~l~~~I~~~~~~~~~~~~~~~AFVtF~s~~~a~~a~q~~~~~--~~~~~~v  163 (546)
                                                                 .....|.|||+|.+..+|..|.+.++..  ....++|
T Consensus        47 -------------------------------------------tg~~kg~afV~f~~~~~A~~Ai~~l~g~~~~g~~l~V   83 (93)
T d1x5ua1          47 -------------------------------------------TGQHQGYGFVEFLSEEDADYAIKIMDMIKLYGKPIRV   83 (93)
T ss_dssp             -------------------------------------------SCSBCSCEEEEESSHHHHHHHHHHSSSCBCSSCBCEE
T ss_pred             -------------------------------------------ccccccceEEEECCHHHHHHHHHHcCCCEECCEEEEE
Confidence                                                       0133579999999999999999987654  3456778


Q ss_pred             ecC-CCCCc
Q 009006          164 SDA-PESRE  171 (546)
Q Consensus       164 ~~A-PeP~D  171 (546)
                      +.| |..+|
T Consensus        84 ~~A~~~~~n   92 (93)
T d1x5ua1          84 NKASAHNKN   92 (93)
T ss_dssp             EETTTTSCC
T ss_pred             EEcCCCCCC
Confidence            777 44443

PyMOL of d1x5ua1

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure