Citrus Sinensis ID: 009053

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-----
MGKANSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYAQDSRRPKRLKY
ccccccEEEEcHHHHHccccccEEEEEccccccccccccccccccccEEEEccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccEEEcccccccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccEEEcccccccEEEccccccccccEEEEcccccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccEEEEEcccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEEEcccccccEEEEEcccccccccccEEEEEEEEcccccHHHcccccccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEEEccccccccccc
ccccccEEcccHHHHHHccccEEEEEEccccccccccccccccHccEEEEccccccccccccHHHHEEEcccccHHHHHcccccccccccEEEcccccHcccccccccccccHEEEccccccHcccccHHHHHHHHHEEEccccccccEccccccHHHHHEEEcccccccccccccccHcHHEEEcccccEEEccccHHHHcccEEEEccccccHHccccHHHcHHcccEEEccccccHccccHHHcccccccEEEccccccccccccHHccccccEEEcccccccccccccHHHHHcccEEEccccccHcccccccccccEEEcccccccEEccccccccccEEEEEcccHcccHHHHHHHHHHHHHHHHcccccccEEEEccccccHHEcccccccEEEEEcccccccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEEccccccEEEcccccccccccccEEEEEEcccccccccccccccccccccccEEEEEEEEEEEEEccccccccEEEEEcEEEEEEEccccccccccc
mgkanseiqinpytfskmTELRFLKfygsenkcmvsslegvpftevryfewhqyplktLDIHAENLvslkmpgskvKQLWDDVQNLVNLKKIDLWYSKLLtklpdlslaqnleildlggcssltetHSSIQYLnklevldldrceslrtlptsiQSKYLKRLVLRgcsnlknfpeisssgihrldlthvgikelpssidrlskldtlkihdctsleslpsslsmfksltsleiiycpklkrlpdeLGNLKALEELRvegtairrppeslgqlsslqilslsdnsnlerapesIRHLSKLTSLFISdckmlqtlpelpcnlhdldasgctslealpaslsskFYLSVDLSNCLKLDLSELSEIIKDRWMkqsynyascrgiyfpgdEILKLFRyqsmgssvtletppppppapagynklMGFAFCAVIafsvpdhhhywkGYLYcdlkvksegsyghlhswylgefsyleSDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFgircphsqcldcevkkcgidfvyaqdsrrpkrlky
mgkanseiqinpytfskmTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRtlptsiqskylkRLVLRGCSNLKnfpeisssgihrldLTHVGIKELPSSIDRLSKLDTLKIHDctsleslpsslSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRvegtairrppeslgqlssLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDfvyaqdsrrpkrlky
MGKANSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPEslgqlsslqilslsdnsnlERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETppppppapaGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLvesfeevyevyfGIRCPHSQCLDCEVKKCGIDFVYAQDSRRPKRLKY
********QINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRV*************************************HLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQ***********************LMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYA***********
****NSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYA***********
MGKANSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMG**********PPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYAQDS********
****NSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYAQD*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKANSEIQINPYTFSKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTLDIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDLDASGCTSLEALPASLSSKFYLSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFLKIISYVEADSVFLRSYLSDSEDLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYAQDSRRPKRLKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query545 2.2.26 [Sep-21-2011]
O23530 1301 Protein SUPPRESSOR OF npr no no 0.568 0.238 0.346 2e-35
Q9SZ67 1895 Probable WRKY transcripti no no 0.510 0.146 0.385 3e-35
Q403921144 TMV resistance protein N N/A no 0.666 0.317 0.295 8e-32
O825001095 Putative disease resistan no no 0.478 0.238 0.340 5e-28
Q9FL92 1372 Probable WRKY transcripti no no 0.847 0.336 0.243 5e-25
Q9FH83 1288 Probable WRKY transcripti no no 0.585 0.247 0.325 5e-24
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.858 0.290 0.240 2e-22
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.491 0.144 0.326 2e-18
P0CB16 1201 Putative disease resistan no no 0.508 0.230 0.314 1e-16
Q9BTT6524 Leucine-rich repeat-conta yes no 0.458 0.477 0.290 2e-11
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 121/349 (34%), Positives = 178/349 (51%), Gaps = 39/349 (11%)

Query: 10  INPYTFSKMTELRFLK--FYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTL--DIHAEN 65
           I+  +F  M  L++L+  +YG     +  SL  +P  ++R  +W   PLK+L     AE 
Sbjct: 537 IDKESFKGMRNLQYLEIGYYGD----LPQSLVYLPL-KLRLLDWDDCPLKSLPSTFKAEY 591

Query: 66  LVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTE 125
           LV+L M  SK+++LW+    L +LK+++L YS  L ++PDLSLA NLE LDL GC SL  
Sbjct: 592 LVNLIMKYSKLEKLWEGTLPLGSLKEMNLRYSNNLKEIPDLSLAINLEELDLVGCKSLVT 651

Query: 126 THSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLD 185
             SSIQ   KL  LD+  C+ L + PT +  + L+ L L GC NL+NFP           
Sbjct: 652 LPSSIQNATKLIYLDMSDCKKLESFPTDLNLESLEYLNLTGCPNLRNFP----------- 700

Query: 186 LTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDE 245
                IK   S +D     + + + DC   ++LP+ L     LT      C   +  P++
Sbjct: 701 ----AIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLTR-----CMPCEFRPEQ 751

Query: 246 LGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFIS 305
           L  L       V G    +  E +  L SL+ + LS++ NL   P+ +   +KL SL ++
Sbjct: 752 LAFLN------VRGYKHEKLWEGIQSLGSLEGMDLSESENLTEIPD-LSKATKLESLILN 804

Query: 306 DCKMLQTLPELPCNLH---DLDASGCTSLEALPASLSSKFYLSVDLSNC 351
           +CK L TLP    NLH    L+   CT LE LP  ++     ++DLS C
Sbjct: 805 NCKSLVTLPSTIGNLHRLVRLEMKECTGLEVLPTDVNLSSLETLDLSGC 853
Disease resistance protein of the TIR-NB-LRR-type. Part of the RPP5 locus that contains a cluster of several paralogous disease resistance (R) genes. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Regulated by RNA silencing. Expression regulated by MOS1 at chromatin level. Negatively regulated at the transcript level by BON1.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query545
255555349 1109 leucine-rich repeat containing protein, 0.833 0.409 0.364 4e-71
224127750 1018 tir-nbs-lrr resistance protein [Populus 0.913 0.489 0.351 5e-66
255537139 1137 leucine-rich repeat-containing protein, 0.950 0.455 0.346 1e-65
356557333 1158 PREDICTED: protein SUPPRESSOR OF npr1-1, 0.845 0.398 0.369 8e-64
255555353 1010 Disease resistance protein RPS2, putativ 0.853 0.460 0.358 2e-63
357454621 1169 Tir-nbs-lrr resistance protein [Medicago 0.836 0.390 0.359 8e-61
87162712 1006 Leucine-rich repeat; Leucine-rich [Medic 0.836 0.453 0.359 1e-60
255555357 1094 leucine-rich repeat-containing protein, 0.754 0.375 0.373 4e-59
224127754 1125 tir-nbs-lrr resistance protein [Populus 0.913 0.442 0.326 7e-59
225460354 1174 PREDICTED: TMV resistance protein N-like 0.924 0.429 0.324 4e-58
>gi|255555349|ref|XP_002518711.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223542092|gb|EEF43636.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  275 bits (703), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 189/518 (36%), Positives = 272/518 (52%), Gaps = 64/518 (12%)

Query: 1    MGKANSEIQINPYTFSKMTELRFLKFYGS------ENKCMVS--SLEGVPFTEVRYFEWH 52
            + KA SE+++   TF++M+ LRFL  Y S      ++K  +S   L+ +P TE+R+  W 
Sbjct: 549  ISKARSELRLRSNTFARMSRLRFLNLYRSPHDRDKKDKLQLSLDGLQTLP-TELRHLHWS 607

Query: 53   QYPLKTL--DIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQ 110
            ++PLK+L  +   ENLV L +P SK+K+LW  +QNLV LK+IDL  S+ L ++PDLS A 
Sbjct: 608  EFPLKSLPSNFTPENLVVLSLPDSKLKKLWTGIQNLVKLKEIDLSGSEYLYRIPDLSKAT 667

Query: 111  NLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNL 170
            N+E +DL GC SL E HSSIQYLNKLE LD+  C +LR LP  I S+ LK   +  C  +
Sbjct: 668  NIEKIDLWGCESLEEVHSSIQYLNKLEFLDIGECYNLRRLPGRIDSEVLKVFKVNDCPRI 727

Query: 171  KNFPEISSSGIHRLDLTHVGIKELPSSIDRL---SKLDTLKIHDCTSLESLPSSLSMFKS 227
            K  P+   + +  L+L    I ++ ++I  +   S L  L +++C  L SLPSS    KS
Sbjct: 728  KRCPQFQGN-LEELELDCTAITDVATTISSILISSTLVQLAVYNCGKLSSLPSSFYKLKS 786

Query: 228  LTSLE------------------------IIYCPKLKRLPDELGNLKALEELRVEGTAIR 263
            L SL+                        +  C +LKRLP+ + NLK+L  L VEG AI+
Sbjct: 787  LESLDLDNWSELESFPEILEPMINLEFITLRNCRRLKRLPNSICNLKSLAYLDVEGAAIK 846

Query: 264  RPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELPCNLHDL 323
              P S+  L  L  L L+D  +LE  P SI  L +L +L +  CK L++LPE P +L  L
Sbjct: 847  EIPSSIEHLILLTTLKLNDCKDLESLPCSIHKLPQLQTLELYSCKSLRSLPEFPLSLLRL 906

Query: 324  DASGCTSLEALPASLSSKFYLSV-DLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYF 382
             A  C SLE +  S +    L +   +NCL+LD   L  + +       +       + +
Sbjct: 907  LAMNCESLETISISFNKHCNLRILTFANCLRLDPKALGTVARAASSHTDF------FLLY 960

Query: 383  PGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIAFSVP-----DHHHY 437
            PG EI + F +QSMGSSVTL+        P    +    AFC V  F +P     D++  
Sbjct: 961  PGSEIPRWFSHQSMGSSVTLQ-------FPVNLKQFKAIAFCVVFKFKIPPKKSGDYYFI 1013

Query: 438  WKGYLYCDLKVKSEGSYGHLHSWYLGEFSYLESDHVFL 475
             +    CD  V      G         FS++E+ HV +
Sbjct: 1014 ARCVEDCDKAVFQPARLGSY------TFSFVETTHVLI 1045

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127750|ref|XP_002329168.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870949|gb|EEF08080.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356557333|ref|XP_003546971.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255555353|ref|XP_002518713.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223542094|gb|EEF43638.1| Disease resistance protein RPS2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357454621|ref|XP_003597591.1| Tir-nbs-lrr resistance protein [Medicago truncatula] gi|355486639|gb|AES67842.1| Tir-nbs-lrr resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|87162712|gb|ABD28507.1| Leucine-rich repeat; Leucine-rich [Medicago truncatula] Back     alignment and taxonomy information
>gi|255555357|ref|XP_002518715.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223542096|gb|EEF43640.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query545
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.825 0.375 0.325 6.2e-51
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.6 0.252 0.392 2.3e-46
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.933 0.413 0.304 1.2e-45
TAIR|locus:21584751217 RPS4 "RESISTANT TO P. SYRINGAE 0.961 0.430 0.294 2.4e-45
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.855 0.398 0.313 7.5e-45
TAIR|locus:21229851167 AT4G19530 [Arabidopsis thalian 0.924 0.431 0.293 1.8e-43
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.473 0.213 0.377 1.9e-43
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.678 0.293 0.323 1e-40
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.478 0.137 0.391 5.3e-39
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.605 0.271 0.341 2.7e-38
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 540 (195.1 bits), Expect = 6.2e-51, P = 6.2e-51
 Identities = 162/497 (32%), Positives = 244/497 (49%)

Query:    13 YTFSKMTELRFLKFYGS------ENKCMVSSLEGV--PFTEVRYFEWHQYPLKTL--DIH 62
             + F+ M +LR+LK Y +      E+   ++  EG+  P  EVRY  W ++PLK +  D +
Sbjct:   576 HAFAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFN 635

Query:    63 AENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSS 122
               NLV LK+P S+++++W+D ++   LK ++L +SK L  L  L  AQNL+ L+L GC++
Sbjct:   636 PGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTA 695

Query:   123 LTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISSSGIH 182
             L E H  ++ +  L  L+L  C SL++LP  IQ   LK L+L GCS  K F  IS   + 
Sbjct:   696 LKEMHVDMENMKFLVFLNLRGCTSLKSLP-EIQLISLKTLILSGCSKFKTFQVISDK-LE 753

Query:   183 RLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRL 242
              L L    IKELP  I RL +L  L +  C  L+ LP SL   K+L  L +  C KL   
Sbjct:   754 ALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEF 813

Query:   243 PDELGNLKALEELRVEGTAIRRPPEXXXXXXXXXXXXXXXXXXXERAPESIRHLSKLTSL 302
             P+  GN+  LE L ++ TAI+  P+                    R P+ +   S+L  L
Sbjct:   814 PETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKIS----RLPDLLNKFSQLQWL 869

Query:   303 FISDCKMLQTLPELPCNLHDLDASGCTSLEA----LPASLSSKFYLSVDL-SNCLKLDLS 357
              +  CK L  +P+LP NL  L+  GC+SL+     L  S+  K   S  + +NC +L+ +
Sbjct:   870 HLKYCKNLTHVPQLPPNLQYLNVHGCSSLKTVAKPLVCSIPMKHVNSSFIFTNCNELEQA 929

Query:   358 ELSEII-----KDRWMKQSYNYA--SC--RGIY---FPGDEILKLFRYQSMGSSVTLETX 405
                EI+     K   +  +      SC    ++   FPG E+   F + ++GS V  E  
Sbjct:   930 AKEEIVVYAERKCHLLASALKRCDESCVPEILFCTSFPGCEMPSWFSHDAIGSMVEFELP 989

Query:   406 XXXXXXXXGYNKLMGFAFCAVIAFSVPDHHHYWKGYLYCDLKVKSEGSYGHLHSWYLGEF 465
                      +N+L G A C V++F     H        C+     EGS   + +W +G  
Sbjct:   990 PHW-----NHNRLSGIALCVVVSFKNCKSHANLIVKFSCEQN-NGEGSSSSI-TWKVGSL 1042

Query:   466 -------SYLESDHVFL 475
                      +ESDHVF+
Sbjct:  1043 IEQDNQEETVESDHVFI 1059
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122985 AT4G19530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-57
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  207 bits (527), Expect = 2e-57
 Identities = 164/481 (34%), Positives = 234/481 (48%), Gaps = 81/481 (16%)

Query: 7    EIQINPYTFSKMTELRFLKFY----GSENKCMVSSLEGVPF--TEVRYFEWHQYPLKTL- 59
            E+ I+   F  M  L FLKFY      + +      EG  +   ++R   W +YPL+ + 
Sbjct: 546  ELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMP 605

Query: 60   -DIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLG 118
             +   ENLV L+M GSK+++LWD V +L  L+ IDL  SK L ++PDLS+A NLE L L 
Sbjct: 606  SNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLS 665

Query: 119  GCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQSKYLKRLVLRGCSNLKNFPEISS 178
             CSSL E  SSIQYLNKLE LD+ RCE+L  LPT I  K L RL L GCS LK+FP+IS+
Sbjct: 666  DCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDIST 725

Query: 179  SGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPK 238
            + I  LDL    I+E PS++ RL  LD L + +  S E L   +   + LT L  +  P 
Sbjct: 726  N-ISWLDLDETAIEEFPSNL-RLENLDELILCEMKS-EKLWERV---QPLTPLMTMLSPS 779

Query: 239  LKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSK 298
            L RL   L ++ +L EL          P S+  L  L+ L + +  NLE  P  I +L  
Sbjct: 780  LTRL--FLSDIPSLVEL----------PSSIQNLHKLEHLEIENCINLETLPTGI-NLES 826

Query: 299  LTSLFISDCKMLQTLPELPCNLHDL-----------------------DASGCTSLEALP 335
            L SL +S C  L+T P++  N+ DL                       D +GC +L+ + 
Sbjct: 827  LESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVS 886

Query: 336  ASLSSKFYLS-VDLSNCLKLDLSEL----SEIIKDRWMKQSY-------NYASC------ 377
             ++S   +L  VD S+C  L  +      SE+        S        N+ +C      
Sbjct: 887  LNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQE 946

Query: 378  ---------RGIYFPGDEILKLFRYQSMGSSVTLETPPPPPPAPAGYNKLMGFAFCAVIA 428
                     + +   G+E+   F +++ G+S+T    P    +P        F  CAV+ 
Sbjct: 947  ALLQQQSIFKQLILSGEEVPSYFTHRTTGASLT--NIPLLHISPC--QPFFRFRACAVVD 1002

Query: 429  F 429
             
Sbjct: 1003 S 1003

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 545
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.73
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.3
KOG4237498 consensus Extracellular matrix protein slit, conta 99.25
KOG4237498 consensus Extracellular matrix protein slit, conta 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.1
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.85
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.72
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.72
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
PRK15386426 type III secretion protein GogB; Provisional 98.63
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.63
PLN03150623 hypothetical protein; Provisional 98.61
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.57
KOG4341483 consensus F-box protein containing LRR [General fu 98.53
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.52
PLN03150623 hypothetical protein; Provisional 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG4341483 consensus F-box protein containing LRR [General fu 98.34
PRK15386426 type III secretion protein GogB; Provisional 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.05
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.89
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.58
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.57
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.37
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.19
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.13
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.54
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.66
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 95.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.62
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=4.1e-52  Score=482.35  Aligned_cols=496  Identities=33%  Similarity=0.517  Sum_probs=394.3

Q ss_pred             CCCCCcccccChhhhhCCCCCcEEEeeCCC-------CccccCCcCCCCCCCccEEEeCCCCCCcc--cccccCccEEEc
Q 009053            1 MGKANSEIQINPYTFSKMTELRFLKFYGSE-------NKCMVSSLEGVPFTEVRYFEWHQYPLKTL--DIHAENLVSLKM   71 (545)
Q Consensus         1 ~s~~~~~~~~~~~~f~~m~~Lr~L~l~~~~-------~~~l~~~l~~l~~~~Lr~L~l~~~~l~~l--~~~~~~L~~L~L   71 (545)
                      |+++ +++++++.+|.+|++|++|+++.+.       ...+|.++..+| .+||+|+|++|+++.+  .+.+.+|++|+|
T Consensus       541 ~~~~-~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp-~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L  618 (1153)
T PLN03210        541 IDEI-DELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLP-PKLRLLRWDKYPLRCMPSNFRPENLVKLQM  618 (1153)
T ss_pred             cCcc-ceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcC-cccEEEEecCCCCCCCCCcCCccCCcEEEC
Confidence            3556 5788999999999999999997642       356899999999 8999999999999999  788999999999


Q ss_pred             CCCCCccccccccCCCCccEEEecCCCCCCCCCCCCCCCCccEEEeeCCCCCccccccccCCCCCCEEEecCCCCCCccC
Q 009053           72 PGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLP  151 (545)
Q Consensus        72 ~~~~l~~l~~~~~~l~~L~~LdLs~~~~~~~~p~l~~l~~L~~L~L~~c~~l~~~~~~i~~l~~L~~L~L~~c~~l~~lp  151 (545)
                      ++++++.+|.+++.+++|+.|+|+++..++.+|+++.+++|+.|+|.+|..+..+|.+++.+++|+.|++++|..++.+|
T Consensus       619 ~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp  698 (1153)
T PLN03210        619 QGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILP  698 (1153)
T ss_pred             cCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccC
Confidence            99999999999999999999999999989999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCccccEEeecCCCCCCCCCccccCCccEEEcccccCcccCcccc------------------------------CC
Q 009053          152 TSIQSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSID------------------------------RL  201 (545)
Q Consensus       152 ~~~~l~~L~~L~L~~c~~l~~~p~~~~~~L~~L~l~~~~i~~lp~~~~------------------------------~l  201 (545)
                      ..+++++|+.|++++|..++.+|....+ |+.|++++|.+..+|..+.                              ..
T Consensus       699 ~~i~l~sL~~L~Lsgc~~L~~~p~~~~n-L~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~  777 (1153)
T PLN03210        699 TGINLKSLYRLNLSGCSRLKSFPDISTN-ISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLS  777 (1153)
T ss_pred             CcCCCCCCCEEeCCCCCCccccccccCC-cCeeecCCCccccccccccccccccccccccchhhccccccccchhhhhcc
Confidence            9889999999999999999999987665 9999999999998886431                              12


Q ss_pred             CCCCEEEecCCCCCccccccccCCCCCcEEEEeCCCCCCccccccCCCCCCcEEEecCcc-CcCCCccCCCCCCCcEEec
Q 009053          202 SKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTA-IRRPPESLGQLSSLQILSL  280 (545)
Q Consensus       202 ~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~Ls~c~~~~~lp~~l~~l~~L~~L~L~~n~-l~~lp~~l~~l~~L~~L~L  280 (545)
                      ++|+.|++++|.....+|..++++++|+.|++++|..++.+|..+ ++++|+.|++++|. +..+|..   .++|+.|+|
T Consensus       778 ~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~L  853 (1153)
T PLN03210        778 PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI---STNISDLNL  853 (1153)
T ss_pred             ccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc---ccccCEeEC
Confidence            467788888888888899999999999999999999888888776 78999999999874 4455542   468999999


Q ss_pred             cCCcCCCcchhhhcCCCCCCEEeccCCcCccccCCCC---CCccEEeccCCCCCCccCCcccC--------------Ccc
Q 009053          281 SDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPELP---CNLHDLDASGCTSLEALPASLSS--------------KFY  343 (545)
Q Consensus       281 ~~n~~~~~lp~~l~~l~~L~~L~L~~c~~l~~ip~~~---~sL~~L~l~~c~~L~~l~~~~~~--------------~~~  343 (545)
                      ++| .++.+|.++..+++|+.|++++|+.+..+|..+   ++|+.+++++|.+|+.++.....              ...
T Consensus       854 s~n-~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~  932 (1153)
T PLN03210        854 SRT-GIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPST  932 (1153)
T ss_pred             CCC-CCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCch
Confidence            999 889999999999999999999999999998754   56788899999999877542210              011


Q ss_pred             cEEEEcCCCCCChhhHHHHHHHHhhccccCCCceEEEEcCCCcccccccccCCCceee-eeCCCCCCCCCCCCCceeEEE
Q 009053          344 LSVDLSNCLKLDLSELSEIIKDRWMKQSYNYASCRGIYFPGDEILKLFRYQSMGSSVT-LETPPPPPPAPAGYNKLMGFA  422 (545)
Q Consensus       344 ~~l~l~~C~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~s~~-i~lp~~~~~~~~~~~~~~g~~  422 (545)
                      ..+.+.+|++|+..++       ..++.    ....+++||.++|.||.||..|++++ |.+|+.|..     ..|.||+
T Consensus       933 ~~l~f~nC~~L~~~a~-------l~~~~----~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~-----~~~~~f~  996 (1153)
T PLN03210        933 VCINFINCFNLDQEAL-------LQQQS----IFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPC-----QPFFRFR  996 (1153)
T ss_pred             hccccccccCCCchhh-------hcccc----cceEEECCCccCchhccCCcccceeeeeccCCcccC-----CCccceE
Confidence            3467899999987553       11111    23467899999999999999999998 999999986     6799999


Q ss_pred             EEEEEEecCCCC--CcceeEEEEecceeecCCCCCceeeeec---CCCCCCCCCcEEEEEeeccc-hhhHHHHhhccCCC
Q 009053          423 FCAVIAFSVPDH--HHYWKGYLYCDLKVKSEGSYGHLHSWYL---GEFSYLESDHVFLKIISYVE-ADSVFLRSYLSDSE  496 (545)
Q Consensus       423 ~c~v~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~sdh~~~~~~~~~~-~~~~~~~~~~~~~~  496 (545)
                      +|+|+++.....  ..+.+.|.|   +|+++.+.  .+....   ........+|+++|...... .|++.+       .
T Consensus       997 ~c~v~~~~~~~~~~~~~~~~~~c---~~~~~~~~--~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~-------~ 1064 (1153)
T PLN03210        997 ACAVVDSESFFIISVSFDIQVCC---RFIDRLGN--HFDSPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPL-------A 1064 (1153)
T ss_pred             EEEEEecCccccCCCceeEEEEE---EEECCCCC--ccccCCCceeEeeeccccceEEecccccccccccch-------h
Confidence            999998776432  244566655   77766422  111000   00011234455444321110 000000       1


Q ss_pred             ccccccceeEEEEEEEecCCCCcCceEEEeeecEEEeccCCC
Q 009053          497 DLVESFEEVYEVYFGIRCPHSQCLDCEVKKCGIDFVYAQDSR  538 (545)
Q Consensus       497 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~cg~~~~~~~~~~  538 (545)
                      .+  .|++ ++|+|.++...   ..++||+|||+++|+++..
T Consensus      1065 ~~--~~~~-~~~~f~~~~~~---~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1065 EL--NYDH-VDIQFRLTNKN---SQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             cc--CCce-eeEEEEEecCC---CCeEEEeeeEEEeccCCCc
Confidence            11  2666 88999987643   3479999999999966544

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 8e-07
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 60/128 (46%), Gaps = 6/128 (4%)
Query: 55  PLKTLDIHAE-----NLVSLKMPGSKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLA 109
           PL + D   E     NL SL++  + ++ L   + NL NLK + +  S L    P +   
Sbjct: 169 PLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHL 228
Query: 110 QNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQS-KYLKRLVLRGCS 168
             LE LDL GC++L            L+ L L  C +L TLP  I     L++L LRGC 
Sbjct: 229 PKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCV 288
Query: 169 NLKNFPEI 176
           NL   P +
Sbjct: 289 NLSRLPSL 296
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-50
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-49
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  173 bits (442), Expect = 6e-50
 Identities = 65/316 (20%), Positives = 118/316 (37%), Gaps = 26/316 (8%)

Query: 62  HAENLVSLKMPG-SKVKQLWDDVQNLVNLKKIDLWYSKLLTKLPDLSLAQNLEILDLGGC 120
           H+    +L   G + ++   D +         D        +  + +   N +I      
Sbjct: 10  HSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN---NPQIETRT-G 65

Query: 121 SSLTETHSSIQYLN--KLEVLDLDRCESLRTLPTSIQS-KYLKRLVLRGCSNLKNFP-EI 176
            +L  T   ++         L+L     L   P       +L+ + +     L   P  +
Sbjct: 66  RALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAG-LMELPDTM 123

Query: 177 SS-SGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSL------SMFKSLT 229
              +G+  L L    ++ LP+SI  L++L  L I  C  L  LP  L         + L 
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLV 183

Query: 230 SLEIIY--CPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLE 287
           +L+ +      ++ LP  + NL+ L+ L++  + +     ++  L  L+ L L   + L 
Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR 243

Query: 288 RAPESIRHLSKLTSLFISDCKMLQTLPE----LPCNLHDLDASGCTSLEALPASLSSKFY 343
             P      + L  L + DC  L TLP     L   L  LD  GC +L  LP+ ++    
Sbjct: 244 NYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLT-QLEKLDLRGCVNLSRLPSLIAQLPA 302

Query: 344 LSV-DLSNCLKLDLSE 358
             +  +   L+  L +
Sbjct: 303 NCIILVPPHLQAQLDQ 318
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query545
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.47
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.37
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.22
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.21
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.02
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.99
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.75
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.51
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.33
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.34
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.94
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.98  E-value=3.4e-32  Score=305.87  Aligned_cols=333  Identities=18%  Similarity=0.202  Sum_probs=211.5

Q ss_pred             CCCCCcEEEeeCCCCc-cccCCcCCCCCCCccEEEeCCCCCC-cc----cccccCccEEEcCCCCCc-cccccccCCC-C
Q 009053           17 KMTELRFLKFYGSENK-CMVSSLEGVPFTEVRYFEWHQYPLK-TL----DIHAENLVSLKMPGSKVK-QLWDDVQNLV-N   88 (545)
Q Consensus        17 ~m~~Lr~L~l~~~~~~-~l~~~l~~l~~~~Lr~L~l~~~~l~-~l----~~~~~~L~~L~L~~~~l~-~l~~~~~~l~-~   88 (545)
                      .+++|+.|++++|... .+|..+..++  +|+.|++++|.+. .+    ...+++|++|++++|.+. .+|..+..++ +
T Consensus       292 ~~~~L~~L~Ls~n~l~~~~p~~~~~l~--~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~  369 (768)
T 3rgz_A          292 ACDTLTGLDLSGNHFYGAVPPFFGSCS--LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSAS  369 (768)
T ss_dssp             TCTTCSEEECCSSEEEECCCGGGGGCT--TCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTT
T ss_pred             hcCcCCEEECcCCcCCCccchHHhcCC--CccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcC
Confidence            3477777777766443 4566677776  7777777777665 33    345667777777777776 6666666665 6


Q ss_pred             ccEEEecCCCCCCCCCC-CCC--CCCccEEEeeCCCCCccccccccCCCCCCEEEecCCCCCCccCCcc-CCccccEEee
Q 009053           89 LKKIDLWYSKLLTKLPD-LSL--AQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSI-QSKYLKRLVL  164 (545)
Q Consensus        89 L~~LdLs~~~~~~~~p~-l~~--l~~L~~L~L~~c~~l~~~~~~i~~l~~L~~L~L~~c~~l~~lp~~~-~l~~L~~L~L  164 (545)
                      |+.|++++|.+.+.+|. +..  +++|++|++++|...+.+|..++.+++|++|++++|...+.+|..+ .+++|+.|++
T Consensus       370 L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L  449 (768)
T 3rgz_A          370 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL  449 (768)
T ss_dssp             CSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEEC
T ss_pred             CcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEEC
Confidence            77777777766554443 333  5667777777766655666666667777777777665555566555 6666777777


Q ss_pred             cCCCCCCCCCccccCC--ccEEEcccccCc-ccCccccCCCCCCEEEecCCCCCccccccccCCCCCcEEEEeCCCCCCc
Q 009053          165 RGCSNLKNFPEISSSG--IHRLDLTHVGIK-ELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEIIYCPKLKR  241 (545)
Q Consensus       165 ~~c~~l~~~p~~~~~~--L~~L~l~~~~i~-~lp~~~~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~Ls~c~~~~~  241 (545)
                      ++|...+.+|......  |+.|++++|.+. .+|..+..+++|+.|++++|...+.+|..+..+++|+.|++++|...+.
T Consensus       450 ~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~  529 (768)
T 3rgz_A          450 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN  529 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEE
T ss_pred             CCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCc
Confidence            7666555555544333  666777766666 4566666666777777776666666666666666677777766666666


Q ss_pred             cccccCCCCCCcEEEecCccCc-CCCc-----------------------------------------------------
Q 009053          242 LPDELGNLKALEELRVEGTAIR-RPPE-----------------------------------------------------  267 (545)
Q Consensus       242 lp~~l~~l~~L~~L~L~~n~l~-~lp~-----------------------------------------------------  267 (545)
                      +|..++.+++|+.|++++|.+. .+|.                                                     
T Consensus       530 ~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  609 (768)
T 3rgz_A          530 IPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST  609 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGG
T ss_pred             CCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcccc
Confidence            6666666666666666666554 3332                                                     


Q ss_pred             -----------------cCCCCCCCcEEeccCCcCCCcchhhhcCCCCCCEEeccCCcCccccCCC---CCCccEEeccC
Q 009053          268 -----------------SLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPEL---PCNLHDLDASG  327 (545)
Q Consensus       268 -----------------~l~~l~~L~~L~L~~n~~~~~lp~~l~~l~~L~~L~L~~c~~l~~ip~~---~~sL~~L~l~~  327 (545)
                                       .++.+++|+.|+|++|...+.+|..++.+++|+.|+|++|...+.+|+.   .++|+.|++++
T Consensus       610 ~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~  689 (768)
T 3rgz_A          610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS  689 (768)
T ss_dssp             TCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             ccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCC
Confidence                             2233456667777777433466777777777777777777666666653   35666777777


Q ss_pred             CCCCCccCCcccC-CcccEEEEcCC
Q 009053          328 CTSLEALPASLSS-KFYLSVDLSNC  351 (545)
Q Consensus       328 c~~L~~l~~~~~~-~~~~~l~l~~C  351 (545)
                      |...+.+|..+.. ..++.|+++++
T Consensus       690 N~l~g~ip~~l~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          690 NKLDGRIPQAMSALTMLTEIDLSNN  714 (768)
T ss_dssp             SCCEECCCGGGGGCCCCSEEECCSS
T ss_pred             CcccCcCChHHhCCCCCCEEECcCC
Confidence            6555566654431 12346666665
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 545
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 63.5 bits (153), Expect = 1e-11
 Identities = 50/265 (18%), Positives = 91/265 (34%), Gaps = 7/265 (2%)

Query: 97  SKLLTKLPDLSLAQNLEILDLGGCSSLTETHSSIQYLNKLEVLDLDRCESLRTLPTSIQS 156
              L K+P   L  +  +LDL             + L  L  L L   +  +  P +   
Sbjct: 19  DLGLEKVPK-DLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAP 77

Query: 157 -KYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSL 215
              L+RL L     LK  PE     +  L +    I ++  S+        +       L
Sbjct: 78  LVKLERLYLSKN-QLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPL 136

Query: 216 ESLPSSLSMFKSLTSLEIIYCPKLKRLPDELGNLKALEELRVEGTAIR-RPPESLGQLSS 274
           +S       F+ +  L  I            G   +L EL ++G  I      SL  L++
Sbjct: 137 KSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNN 196

Query: 275 LQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLPEL--PCNLHDLDASGCTSLE 332
           L  L LS NS       S+ +   L  L +++ K+++    L     +  +      ++ 
Sbjct: 197 LAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNN-NIS 255

Query: 333 ALPASLSSKFYLSVDLSNCLKLDLS 357
           A+ ++       +   ++   + L 
Sbjct: 256 AIGSNDFCPPGYNTKKASYSGVSLF 280
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query545
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.27
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.19
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.17
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.16
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.75
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.14
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.88  E-value=3.2e-21  Score=195.67  Aligned_cols=298  Identities=19%  Similarity=0.252  Sum_probs=154.1

Q ss_pred             hCCCCCcEEEeeCCCCccccCCcCCCCCCCccEEEeCCCCCCcc--cccccCccEEEcCCCCCccccccccCCCCccEEE
Q 009053           16 SKMTELRFLKFYGSENKCMVSSLEGVPFTEVRYFEWHQYPLKTL--DIHAENLVSLKMPGSKVKQLWDDVQNLVNLKKID   93 (545)
Q Consensus        16 ~~m~~Lr~L~l~~~~~~~l~~~l~~l~~~~Lr~L~l~~~~l~~l--~~~~~~L~~L~L~~~~l~~l~~~~~~l~~L~~Ld   93 (545)
                      +.+.+|+.|+++++....+ +++++++  +|++|++++|.++.+  ...+++|++|++++|.++.++ .+..+++|+.|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l-~gl~~L~--nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI-DGVEYLN--NLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC-TTGGGCT--TCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCc-cccccCC--CCCEEeCcCCcCCCCccccCCccccccccccccccccc-cccccccccccc
Confidence            3566788999987766555 4788887  899999999988888  567888999999999888775 478888999999


Q ss_pred             ecCCCCCCCCCCCCCCCCccEEEeeCCCCCcc-------------------ccccccCCCCCCEEEecCCCCCCccCCcc
Q 009053           94 LWYSKLLTKLPDLSLAQNLEILDLGGCSSLTE-------------------THSSIQYLNKLEVLDLDRCESLRTLPTSI  154 (545)
Q Consensus        94 Ls~~~~~~~~p~l~~l~~L~~L~L~~c~~l~~-------------------~~~~i~~l~~L~~L~L~~c~~l~~lp~~~  154 (545)
                      ++++...... .......+..+....+.....                   ....+...+.........+. ........
T Consensus       117 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  194 (384)
T d2omza2         117 LFNNQITDID-PLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK-VSDISVLA  194 (384)
T ss_dssp             CCSSCCCCCG-GGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSC-CCCCGGGG
T ss_pred             cccccccccc-cccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccc-cccccccc
Confidence            8877664432 222333444444332211000                   00011111222222222111 11111111


Q ss_pred             CCccccEEeecCCCCCCCCCccccCCccEEEcccccCcccCccccCCCCCCEEEecCCCCCccccccccCCCCCcEEEEe
Q 009053          155 QSKYLKRLVLRGCSNLKNFPEISSSGIHRLDLTHVGIKELPSSIDRLSKLDTLKIHDCTSLESLPSSLSMFKSLTSLEII  234 (545)
Q Consensus       155 ~l~~L~~L~L~~c~~l~~~p~~~~~~L~~L~l~~~~i~~lp~~~~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~Ls  234 (545)
                      .+++++.+.++++......|......|+.|+++++.++.++ .+..+++|+.|++++|...+ ++. +..+++|++|+++
T Consensus       195 ~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~-~~~-~~~~~~L~~L~l~  271 (384)
T d2omza2         195 KLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISN-LAP-LSGLTKLTELKLG  271 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCC-CGG-GTTCTTCSEEECC
T ss_pred             cccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCC-CCc-ccccccCCEeecc
Confidence            44555555555543222111111112555555555555543 34555555555555554332 221 4455555555555


Q ss_pred             CCCCCCccccccCCCCCCcEEEecCccCcCCCccCCCCCCCcEEeccCCcCCCcchhhhcCCCCCCEEeccCCcCccccC
Q 009053          235 YCPKLKRLPDELGNLKALEELRVEGTAIRRPPESLGQLSSLQILSLSDNSNLERAPESIRHLSKLTSLFISDCKMLQTLP  314 (545)
Q Consensus       235 ~c~~~~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~lp~~l~~l~~L~~L~L~~c~~l~~ip  314 (545)
                      ++...+. + .+..++.++.+.+..|.++.++ .+..+++++.|++++| .++.++. +..+++|++|++++|+ ++.++
T Consensus       272 ~~~l~~~-~-~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n-~l~~l~~-l~~l~~L~~L~L~~n~-l~~l~  345 (384)
T d2omza2         272 ANQISNI-S-PLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFN-NISDISP-VSSLTKLQRLFFANNK-VSDVS  345 (384)
T ss_dssp             SSCCCCC-G-GGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSS-CCSCCGG-GGGCTTCCEEECCSSC-CCCCG
T ss_pred             CcccCCC-C-cccccccccccccccccccccc-ccchhcccCeEECCCC-CCCCCcc-cccCCCCCEEECCCCC-CCCCh
Confidence            5443322 1 2444555555555555554432 2444555555555555 4444432 4555555555555553 23333


Q ss_pred             CC--CCCccEEeccCC
Q 009053          315 EL--PCNLHDLDASGC  328 (545)
Q Consensus       315 ~~--~~sL~~L~l~~c  328 (545)
                      .+  .++|++|++++|
T Consensus       346 ~l~~l~~L~~L~l~~N  361 (384)
T d2omza2         346 SLANLTNINWLSAGHN  361 (384)
T ss_dssp             GGGGCTTCCEEECCSS
T ss_pred             hHcCCCCCCEEECCCC
Confidence            21  235555555544
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure