Citrus Sinensis ID: 009182

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-
MHKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHEEEHHHcc
MHKWYSFLFEIIVEQFLLYADLffysetilqqivppvlnsfsdqdsRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITvldsvpdidmlgflPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIknspsvdygRMAEILVQRAASPDEFTRLTAITWINEFVKlggdqlvpyYADILGAilpcisdkeEKIRVVARETNEELRAikadpadgfdvgpiLSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSlvnpagkdLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
MHKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEElraikadpadgfdvgPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDnsllekrgaliIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
MHKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMlgflpdfldglfNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQAlnlilltsselselrdllkkslVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYlfallfgltgffnllYWKTVL
**KWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDS**EIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKT**
**KWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPS************************AITWINEFVK********YYADILGAILP***************TNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRV*****EKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSEL**********PAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
MHKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
*HKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKWYSFLFEIIVEQFLLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNLLYWKTVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query541 2.2.26 [Sep-21-2011]
Q68F38782 Protein VAC14 homolog OS= N/A no 0.927 0.641 0.398 1e-113
Q5ZIW5780 Protein VAC14 homolog OS= yes no 0.920 0.638 0.394 1e-112
Q66L58771 Protein VAC14 homolog OS= yes no 0.920 0.645 0.405 1e-112
Q80W92783 Protein VAC14 homolog OS= yes no 0.920 0.636 0.390 1e-109
Q08AM6782 Protein VAC14 homolog OS= yes no 0.920 0.636 0.399 1e-108
A2VE70783 Protein VAC14 homolog OS= yes no 0.920 0.636 0.398 1e-108
Q80WQ2782 Protein VAC14 homolog OS= yes no 0.916 0.634 0.396 1e-108
P87145 811 Protein VAC14 homolog OS= yes no 0.920 0.614 0.338 9e-88
Q06708 880 Vacuole morphology and in yes no 0.556 0.342 0.312 7e-40
>sp|Q68F38|VAC14_XENLA Protein VAC14 homolog OS=Xenopus laevis GN=vac14 PE=2 SV=1 Back     alignment and function desciption
 Score =  408 bits (1048), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 245/615 (39%), Positives = 336/615 (54%), Gaps = 113/615 (18%)

Query: 26  SETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADS 85
           S   L++++ PVL  F+D DSR+RYYACEALYNI KV RG  +  FN +FD L KL+AD 
Sbjct: 87  SGQYLRELIEPVLTCFNDADSRLRYYACEALYNIVKVARGSVLPHFNVLFDGLSKLAADP 146

Query: 86  DANVQSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVP 145
           D NV+S + LLDRL+KDIVTES +F +  F+PLLRER+   N Y RQF++ WI VL+SVP
Sbjct: 147 DPNVKSGSELLDRLLKDIVTESSKFDLVGFVPLLRERIYSNNQYARQFIISWILVLESVP 206

Query: 146 DIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSP-SVDYGRMAEILVQR 204
           DI++L +LP+ LDGLF +L D+S EIR+  + +L EFL+EIK  P SV +  MA ILV  
Sbjct: 207 DINLLDYLPEILDGLFQILGDNSKEIRKMCEVSLGEFLKEIKKLPDSVKFAEMANILVIH 266

Query: 205 AASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCIS--DKEEKIRVVARETNE 262
             S D+  +LTA+TW+ EF++L G  ++PY + IL A+LPC+S  D+++ I+ VA   N+
Sbjct: 267 CQSTDDLIQLTAMTWMREFLQLAGRVMLPYSSGILTAVLPCLSYDDRKKNIKEVANVCNQ 326

Query: 263 EL----------------------------------------RAIKADPADGFDVGPILS 282
            L                                        R + + P    D   I +
Sbjct: 327 SLMKLITPEDDETDEVRQSPATQPDEDFSSNHENSSQHTTYNRTLPSAPDSSLDNANIFA 386

Query: 283 IAT------------------RQL--SSEWEATRIEALHWISTLLNRHRTEVLHFLNDIF 322
            ++                  R L  S+    TRI  L W+  L  +   ++    + +F
Sbjct: 387 PSSMNTCPVSLNLDGIVHVLDRHLHESTTGMMTRICVLKWLYHLYIKTPRKMFRHTDSLF 446

Query: 323 DTLLKALSDPSDEVVLLVLEV--------------------------------------- 343
             LLK LSD SDEV+L  LEV                                       
Sbjct: 447 PILLKTLSDESDEVILKDLEVLAEIASSPAGQTDIVTDCNDLPTGMSELHVPVPTKVTQA 506

Query: 344 HACIAKDLQ----------HFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVY 393
           H  + + L+          +F + +V L+  F  +  LLE RGA IIR+LC+LL+AE ++
Sbjct: 507 HGSVIRGLECSPSTPTMNSYFHRFMVNLLKRFSNERKLLEIRGAFIIRQLCLLLNAENIF 566

Query: 394 RELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSLYASW 453
             ++ IL  E DL FA TMVQ LN ILLTSSEL +LR  L K L  P   +LF  LY SW
Sbjct: 567 HSMADILLREEDLKFASTMVQNLNSILLTSSELFQLRSQL-KDLQTPESCNLFCCLYRSW 625

Query: 454 CHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLRLQVL 513
           CH+P+A +SLC L Q Y HA  +IQ   + ++ V FL ++DKL++L+E PIF YLRLQ+L
Sbjct: 626 CHNPVATVSLCFLTQNYQHAYNLIQKFGDLEVTVDFLTEVDKLVQLIECPIFTYLRLQLL 685

Query: 514 KLRTEDYLFALLFGL 528
            +    YL   L+GL
Sbjct: 686 DVENNPYLIRALYGL 700
The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Acts as a positive activator of PIKfyve kinase activity.
Xenopus laevis (taxid: 8355)
>sp|Q5ZIW5|VAC14_CHICK Protein VAC14 homolog OS=Gallus gallus GN=VAC14 PE=2 SV=1 Back     alignment and function description
>sp|Q66L58|VAC14_DANRE Protein VAC14 homolog OS=Danio rerio GN=vac14 PE=2 SV=1 Back     alignment and function description
>sp|Q80W92|VAC14_RAT Protein VAC14 homolog OS=Rattus norvegicus GN=Vac14 PE=1 SV=1 Back     alignment and function description
>sp|Q08AM6|VAC14_HUMAN Protein VAC14 homolog OS=Homo sapiens GN=VAC14 PE=1 SV=1 Back     alignment and function description
>sp|A2VE70|VAC14_BOVIN Protein VAC14 homolog OS=Bos taurus GN=VAC14 PE=2 SV=1 Back     alignment and function description
>sp|Q80WQ2|VAC14_MOUSE Protein VAC14 homolog OS=Mus musculus GN=Vac14 PE=1 SV=1 Back     alignment and function description
>sp|P87145|VAC14_SCHPO Protein VAC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.03 PE=3 SV=1 Back     alignment and function description
>sp|Q06708|VAC14_YEAST Vacuole morphology and inheritance protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC14 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query541
356524533 722 PREDICTED: protein VAC14 homolog [Glycin 0.922 0.691 0.927 0.0
255570069 728 conserved hypothetical protein [Ricinus 0.922 0.685 0.931 0.0
147782112 727 hypothetical protein VITISV_014540 [Viti 0.922 0.686 0.913 0.0
225424372 727 PREDICTED: protein VAC14 homolog [Vitis 0.922 0.686 0.913 0.0
356502378 724 PREDICTED: protein VAC14 homolog [Glycin 0.922 0.689 0.907 0.0
224101889 725 predicted protein [Populus trichocarpa] 0.922 0.688 0.925 0.0
356511291 691 PREDICTED: protein VAC14 homolog [Glycin 0.922 0.722 0.911 0.0
449449244 738 PREDICTED: protein VAC14 homolog [Cucumi 0.922 0.676 0.903 0.0
357521307 736 VAC14-like protein [Medicago truncatula] 0.924 0.679 0.879 0.0
224108275 724 predicted protein [Populus trichocarpa] 0.922 0.689 0.897 0.0
>gi|356524533|ref|XP_003530883.1| PREDICTED: protein VAC14 homolog [Glycine max] Back     alignment and taxonomy information
 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/499 (92%), Positives = 480/499 (96%)

Query: 30  LQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANV 89
           L+QIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANV
Sbjct: 89  LEQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANV 148

Query: 90  QSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDM 149
           QSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDM
Sbjct: 149 QSAAHLLDRLVKDIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDM 208

Query: 150 LGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPD 209
           LGFLPDFLDGLFNMLSDSSHEIRQQADSAL EFLQEIKNSPSVDYGRMAEILVQRA SPD
Sbjct: 209 LGFLPDFLDGLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAGSPD 268

Query: 210 EFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIKA 269
           EFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCI+DKEEKIRVVARETNEELRA+KA
Sbjct: 269 EFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCIADKEEKIRVVARETNEELRALKA 328

Query: 270 DPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKAL 329
           DPA+ FDVG ILSIA RQLSSE EATRIEALHWISTLLN++RTEVL FLNDIFDTLLKAL
Sbjct: 329 DPAEAFDVGAILSIARRQLSSELEATRIEALHWISTLLNKYRTEVLEFLNDIFDTLLKAL 388

Query: 330 SDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDA 389
           SDPSDEVVLLVL+VHACIAKD QHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLL+A
Sbjct: 389 SDPSDEVVLLVLDVHACIAKDPQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLNA 448

Query: 390 ERVYRELSTILEGEADLDFACTMVQALNLILLTSSELSELRDLLKKSLVNPAGKDLFVSL 449
           ERVYRELSTILE E+DLDFA  MVQALNLILLTSSELSE+RDLLK+SLVNPAGKDL+VSL
Sbjct: 449 ERVYRELSTILEAESDLDFASIMVQALNLILLTSSELSEIRDLLKQSLVNPAGKDLYVSL 508

Query: 450 YASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYLR 509
           YASWCHSPMAIISLCLLAQTY HASAVIQSLVEED+NVKFLVQLDKLIRLLETPIFAYLR
Sbjct: 509 YASWCHSPMAIISLCLLAQTYQHASAVIQSLVEEDINVKFLVQLDKLIRLLETPIFAYLR 568

Query: 510 LQVLKLRTEDYLFALLFGL 528
           LQ+L+     +LF  L+GL
Sbjct: 569 LQLLEPGRYTWLFKTLYGL 587

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570069|ref|XP_002525997.1| conserved hypothetical protein [Ricinus communis] gi|223534729|gb|EEF36421.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147782112|emb|CAN65293.1| hypothetical protein VITISV_014540 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424372|ref|XP_002284995.1| PREDICTED: protein VAC14 homolog [Vitis vinifera] gi|297737634|emb|CBI26835.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502378|ref|XP_003519996.1| PREDICTED: protein VAC14 homolog [Glycine max] Back     alignment and taxonomy information
>gi|224101889|ref|XP_002312461.1| predicted protein [Populus trichocarpa] gi|222852281|gb|EEE89828.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511291|ref|XP_003524360.1| PREDICTED: protein VAC14 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449449244|ref|XP_004142375.1| PREDICTED: protein VAC14 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|357521307|ref|XP_003630942.1| VAC14-like protein [Medicago truncatula] gi|355524964|gb|AET05418.1| VAC14-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224108275|ref|XP_002314784.1| predicted protein [Populus trichocarpa] gi|222863824|gb|EEF00955.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query541
TAIR|locus:2065423 744 AT2G01690 "AT2G01690" [Arabido 0.896 0.651 0.839 1.9e-209
DICTYBASE|DDB_G0289233 801 DDB_G0289233 "VAC14 family pro 0.700 0.473 0.464 4e-104
UNIPROTKB|F1NWG6 780 VAC14 "Protein VAC14 homolog" 0.456 0.316 0.484 7.1e-99
UNIPROTKB|Q5ZIW5 780 VAC14 "Protein VAC14 homolog" 0.456 0.316 0.484 1.9e-98
MGI|MGI:2157980 782 Vac14 "Vac14 homolog (S. cerev 0.473 0.327 0.463 1.8e-96
ZFIN|ZDB-GENE-040912-82 771 vac14 "vac14 homolog (S. cerev 0.454 0.319 0.460 1.8e-96
UNIPROTKB|F1MJZ1 783 VAC14 "Protein VAC14 homolog" 0.449 0.310 0.473 3e-96
UNIPROTKB|Q08AM6 782 VAC14 "Protein VAC14 homolog" 0.456 0.315 0.468 3.8e-96
UNIPROTKB|A2VE70 783 VAC14 "Protein VAC14 homolog" 0.449 0.310 0.473 3.8e-96
UNIPROTKB|E2RB06 783 VAC14 "Uncharacterized protein 0.449 0.310 0.473 6.2e-96
TAIR|locus:2065423 AT2G01690 "AT2G01690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2025 (717.9 bits), Expect = 1.9e-209, P = 1.9e-209
 Identities = 408/486 (83%), Positives = 431/486 (88%)

Query:    30 LQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANV 89
             L+QIVPPV+NSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFN+IFDALCKLSADSDANV
Sbjct:    89 LEQIVPPVINSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNKIFDALCKLSADSDANV 148

Query:    90 QSAAHLLDRLVK-DIVTESDQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDID 148
             QSAAHLLDRLVK DIVTESDQFSIEEFIPLL+ERMNVLNPYVRQFLVGWITVLDSVPDID
Sbjct:   149 QSAAHLLDRLVKQDIVTESDQFSIEEFIPLLKERMNVLNPYVRQFLVGWITVLDSVPDID 208

Query:   149 MXXXXXXXXXXXXNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQRAASP 208
             M            NMLSDSSHEIRQQADSAL EFLQEIKNSPSVDYGRMAEILVQRAASP
Sbjct:   209 MLGFLPDFLDGLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAASP 268

Query:   209 DEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEELRAIK 268
             DEFTRLTAITWINEFVKLGGDQLV YYADILGAILPCISDKEEKIRVVARETNEELR+I 
Sbjct:   269 DEFTRLTAITWINEFVKLGGDQLVRYYADILGAILPCISDKEEKIRVVARETNEELRSIH 328

Query:   269 ADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKA 328
              +P+DGFDVG ILS+A RQLSSE+EATRIEAL+WISTLLN+HRTEVL FLNDIFDTLLKA
Sbjct:   329 VEPSDGFDVGAILSVARRQLSSEFEATRIEALNWISTLLNKHRTEVLCFLNDIFDTLLKA 388

Query:   329 LSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLD 388
             LSD SD+VVLLVLEVHA +AKD QHFRQL+VFLVHNFR DNSLLE+RGALI+RR+CVLLD
Sbjct:   389 LSDSSDDVVLLVLEVHAGVAKDPQHFRQLIVFLVHNFRADNSLLERRGALIVRRMCVLLD 448

Query:   389 AERVYRELSTILEGEADLDFACTMVQAXXXXXXXXXXXXXXXXXXXXXXVNPAGKDLFVS 448
             AERVYRELSTILEGE +LDFA TMVQA                      VN  GK+LFV+
Sbjct:   449 AERVYRELSTILEGEDNLDFASTMVQALNLILLTSPELSKLRELLKGSLVNREGKELFVA 508

Query:   449 LYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRLLETPIFAYL 508
             LY SWCHSPMAIISLCLLAQ Y HAS VIQSLVEED+NVKFLVQLDKLIRLLETPIF YL
Sbjct:   509 LYTSWCHSPMAIISLCLLAQAYQHASVVIQSLVEEDINVKFLVQLDKLIRLLETPIFTYL 568

Query:   509 RLQVLK 514
             RLQ+L+
Sbjct:   569 RLQLLE 574
GO:0008150 "biological_process" evidence=ND
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
DICTYBASE|DDB_G0289233 DDB_G0289233 "VAC14 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWG6 VAC14 "Protein VAC14 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIW5 VAC14 "Protein VAC14 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2157980 Vac14 "Vac14 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-82 vac14 "vac14 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJZ1 VAC14 "Protein VAC14 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q08AM6 VAC14 "Protein VAC14 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2VE70 VAC14 "Protein VAC14 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RB06 VAC14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030586001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (699 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002161001
SubName- Full=Chromosome undetermined scaffold_127, whole genome shotgun sequence; (892 aa)
    ••• 0.578
GSVIVG00016372001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (833 aa)
    ••• 0.556
GSVIVG00002733001
SubName- Full=Chromosome chr1 scaffold_135, whole genome shotgun sequence; (815 aa)
     •• 0.536
GSVIVG00035009001
SubName- Full=Chromosome chr13 scaffold_74, whole genome shotgun sequence; (534 aa)
     •• 0.502
GSVIVG00016649001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (1235 aa)
     •• 0.466
GSVIVG00038872001
SubName- Full=Chromosome chr8 scaffold_99, whole genome shotgun sequence; (559 aa)
     •• 0.457

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query541
pfam11916181 pfam11916, Vac14_Fig4_bd, Vacuolar protein 14 C-te 2e-67
pfam1275597 pfam12755, Vac14_Fab1_bd, Vacuolar 14 Fab1-binding 2e-40
pfam0298531 pfam02985, HEAT, HEAT repeat 0.002
>gnl|CDD|221312 pfam11916, Vac14_Fig4_bd, Vacuolar protein 14 C-terminal Fig4p binding Back     alignment and domain information 
 Score =  215 bits (549), Expect = 2e-67
 Identities = 95/161 (59%), Positives = 122/161 (75%), Gaps = 1/161 (0%)

Query: 368 DNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELS 427
           D  LLE+RG LIIR+LC+LL+AERVYR L++ILE E DL+FA  MVQ LN ILLTS ELS
Sbjct: 1   DRKLLERRGNLIIRQLCLLLNAERVYRTLASILEEEEDLEFASKMVQTLNTILLTSPELS 60

Query: 428 ELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNV 487
           ELR  L+  L   A + LF SLY SWCH+P++ +SLCLL+Q Y HA  ++QSL E ++ V
Sbjct: 61  ELRKKLRN-LTLKADQSLFSSLYRSWCHNPVSALSLCLLSQAYEHAYNLLQSLGELEITV 119

Query: 488 KFLVQLDKLIRLLETPIFAYLRLQVLKLRTEDYLFALLFGL 528
            FLVQ+DKL++LLE+P+F YLRLQ+L+     YL+  L+GL
Sbjct: 120 DFLVQIDKLVQLLESPVFTYLRLQLLEPEKYPYLYKCLYGL 160

Vac14 is a scaffold for the Fab1 kinase complex, a complex that allows for the dynamic interconversion of PI3P and PI(3,5)P2p (phosphoinositide phosphate (PIP) lipids, that are generated transiently on the cytoplasmic face of selected intracellular membranes). This interconversion is regulated by at least five proteins in yeast: the lipid kinase Fab1p, lipid phosphatase Fig4p, the Fab1p activator Vac7p, the Fab1p inhibitor Atg18p, and Vac14p, a protein required for the activity of both Fab1p and Fig4p. The C-terminal region of Vac14 binds to Fig4p. The full length Vac14 in yeasts is likely to be a protein carrying a succession of HEAT repeats, most of which have now degenerated. This regulatory system is crucial for the proper functioning of the mammalian nervous system. Length = 181
>gnl|CDD|193231 pfam12755, Vac14_Fab1_bd, Vacuolar 14 Fab1-binding region Back     alignment and domain information
>gnl|CDD|202500 pfam02985, HEAT, HEAT repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 541
KOG0212675 consensus Uncharacterized conserved protein [Funct 100.0
PF11916182 Vac14_Fig4_bd: Vacuolar protein 14 C-terminal Fig4 100.0
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 100.0
KOG0212 675 consensus Uncharacterized conserved protein [Funct 100.0
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.87
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 99.81
KOG1242569 consensus Protein containing adaptin N-terminal re 99.8
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.8
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 99.77
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 99.77
KOG1242569 consensus Protein containing adaptin N-terminal re 99.74
PRK09687280 putative lyase; Provisional 99.7
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 99.64
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.64
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 99.64
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.62
PRK09687280 putative lyase; Provisional 99.56
KOG1824 1233 consensus TATA-binding protein-interacting protein 99.55
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.55
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.45
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 99.44
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.44
KOG1824 1233 consensus TATA-binding protein-interacting protein 99.43
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.43
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 99.35
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.34
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.26
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.25
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.25
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 99.24
PTZ00429 746 beta-adaptin; Provisional 99.24
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 99.23
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.19
PTZ00429 746 beta-adaptin; Provisional 99.12
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 99.11
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 99.1
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.07
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 99.05
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.02
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.99
KOG4224550 consensus Armadillo repeat protein VAC8 required f 98.88
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.85
TIGR02270410 conserved hypothetical protein. Members are found 98.81
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.78
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 98.77
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 98.72
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.7
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.64
KOG2259 823 consensus Uncharacterized conserved protein [Funct 98.63
KOG4224550 consensus Armadillo repeat protein VAC8 required f 98.59
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 98.58
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.53
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 98.51
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.47
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.45
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.4
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.38
KOG2259823 consensus Uncharacterized conserved protein [Funct 98.38
TIGR02270410 conserved hypothetical protein. Members are found 98.34
KOG12481176 consensus Uncharacterized conserved protein [Funct 98.32
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.24
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.2
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.19
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.15
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.13
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.11
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 98.06
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.05
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.04
KOG1820815 consensus Microtubule-associated protein [Cytoskel 98.02
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 98.01
COG5096 757 Vesicle coat complex, various subunits [Intracellu 98.0
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 98.0
KOG2025 892 consensus Chromosome condensation complex Condensi 97.99
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 97.95
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 97.92
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.91
KOG1820815 consensus Microtubule-associated protein [Cytoskel 97.91
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.9
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.89
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.86
KOG2032533 consensus Uncharacterized conserved protein [Funct 97.85
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.83
KOG2025 892 consensus Chromosome condensation complex Condensi 97.82
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.81
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.77
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.7
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.62
KOG2032533 consensus Uncharacterized conserved protein [Funct 97.62
KOG2956516 consensus CLIP-associating protein [General functi 97.58
PF05804708 KAP: Kinesin-associated protein (KAP) 97.58
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 97.51
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.5
KOG4653982 consensus Uncharacterized conserved protein [Funct 97.48
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 97.48
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 97.44
KOG2956516 consensus CLIP-associating protein [General functi 97.42
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 97.36
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.34
PF05804708 KAP: Kinesin-associated protein (KAP) 97.34
KOG22741005 consensus Predicted importin 9 [Intracellular traf 97.33
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 97.3
KOG04141251 consensus Chromosome condensation complex Condensi 97.29
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.29
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.28
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.28
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 97.23
PLN030761780 ARF guanine nucleotide exchange factor (ARF-GEF); 97.19
KOG1993978 consensus Nuclear transport receptor KAP120 (impor 97.14
PF05004309 IFRD: Interferon-related developmental regulator ( 97.11
KOG4653982 consensus Uncharacterized conserved protein [Funct 97.11
PF05004309 IFRD: Interferon-related developmental regulator ( 97.1
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 97.05
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 97.05
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 97.02
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 97.02
KOG0567289 consensus HEAT repeat-containing protein [General 96.95
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.93
PF08167165 RIX1: rRNA processing/ribosome biogenesis 96.91
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 96.91
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 96.91
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 96.9
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.85
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.85
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.85
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 96.82
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.8
KOG4413524 consensus 26S proteasome regulatory complex, subun 96.79
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 96.76
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.75
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.74
COG5656970 SXM1 Importin, protein involved in nuclear import 96.72
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 96.71
PF13251182 DUF4042: Domain of unknown function (DUF4042) 96.64
PF08167165 RIX1: rRNA processing/ribosome biogenesis 96.64
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 96.63
PLN030761780 ARF guanine nucleotide exchange factor (ARF-GEF); 96.61
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.59
KOG0413 1529 consensus Uncharacterized conserved protein relate 96.58
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.57
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 96.52
PF14500262 MMS19_N: Dos2-interacting transcription regulator 96.48
KOG0414 1251 consensus Chromosome condensation complex Condensi 96.48
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 96.44
KOG4413524 consensus 26S proteasome regulatory complex, subun 96.4
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.32
KOG45241014 consensus Uncharacterized conserved protein [Funct 96.28
KOG0567289 consensus HEAT repeat-containing protein [General 96.27
KOG1993978 consensus Nuclear transport receptor KAP120 (impor 96.13
COG5116926 RPN2 26S proteasome regulatory complex component [ 96.13
KOG1293678 consensus Proteins containing armadillo/beta-caten 96.09
COG5116926 RPN2 26S proteasome regulatory complex component [ 96.05
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.05
KOG1243690 consensus Protein kinase [General function predict 96.01
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.97
KOG1293678 consensus Proteins containing armadillo/beta-caten 95.97
PF05536543 Neurochondrin: Neurochondrin 95.88
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 95.83
PF14500262 MMS19_N: Dos2-interacting transcription regulator 95.75
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 95.74
KOG2933334 consensus Uncharacterized conserved protein [Funct 95.7
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 95.67
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 95.63
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 95.57
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.48
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 95.47
KOG2933334 consensus Uncharacterized conserved protein [Funct 95.46
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 95.45
KOG2081559 consensus Nuclear transport regulator [Intracellul 95.37
KOG4535728 consensus HEAT and armadillo repeat-containing pro 95.37
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 95.33
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 95.26
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 95.26
COG50981128 Chromosome condensation complex Condensin, subunit 95.21
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 95.18
KOG2149393 consensus Uncharacterized conserved protein [Funct 94.94
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 94.88
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.75
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.67
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 94.62
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.39
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 94.31
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 94.21
KOG1243690 consensus Protein kinase [General function predict 94.12
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 94.11
PF13251182 DUF4042: Domain of unknown function (DUF4042) 94.02
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 93.96
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 93.93
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 93.8
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 93.73
KOG2149393 consensus Uncharacterized conserved protein [Funct 93.67
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.64
KOG2022 982 consensus Nuclear transport receptor LGL2 (importi 93.62
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 93.48
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 93.43
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 93.43
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 93.33
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 93.32
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.28
KOG2549576 consensus Transcription initiation factor TFIID, s 93.24
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 93.12
COG5098 1128 Chromosome condensation complex Condensin, subunit 93.1
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 92.88
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 92.56
KOG1566342 consensus Conserved protein Mo25 [Function unknown 92.52
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 92.36
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 92.29
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.29
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 92.24
smart00638574 LPD_N Lipoprotein N-terminal Domain. 92.15
KOG2137700 consensus Protein kinase [Signal transduction mech 92.13
COG5656970 SXM1 Importin, protein involved in nuclear import 92.0
KOG18511710 consensus Uncharacterized conserved protein [Funct 91.76
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 91.73
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 91.59
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 91.59
KOG2137700 consensus Protein kinase [Signal transduction mech 91.46
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 91.45
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 91.39
KOG1877 819 consensus Putative transmembrane protein cmp44E [G 91.12
KOG2973353 consensus Uncharacterized conserved protein [Funct 90.94
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 90.88
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 90.54
KOG3961262 consensus Uncharacterized conserved protein [Funct 90.2
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 90.1
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 90.09
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 89.95
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 89.8
COG5032 2105 TEL1 Phosphatidylinositol kinase and protein kinas 89.51
KOG0413 1529 consensus Uncharacterized conserved protein relate 88.97
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 88.62
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 88.45
KOG3961262 consensus Uncharacterized conserved protein [Funct 88.45
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 88.41
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 88.1
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 88.05
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 87.94
KOG2081559 consensus Nuclear transport regulator [Intracellul 87.16
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 87.01
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 86.97
KOG2549576 consensus Transcription initiation factor TFIID, s 86.95
KOG2022982 consensus Nuclear transport receptor LGL2 (importi 86.7
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 86.65
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 86.43
cd03561133 VHS VHS domain family; The VHS domain is present i 86.02
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 85.91
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 85.45
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 85.37
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 85.2
PF08161198 NUC173: NUC173 domain; InterPro: IPR012978 This is 85.18
PF05536543 Neurochondrin: Neurochondrin 85.17
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 84.54
KOG2973353 consensus Uncharacterized conserved protein [Funct 84.51
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 84.12
KOG18371621 consensus Uncharacterized conserved protein [Funct 83.7
COG5234 993 CIN1 Beta-tubulin folding cofactor D [Posttranslat 83.69
KOG1848 1610 consensus Uncharacterized conserved protein [Funct 83.62
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 83.36
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 83.36
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 83.23
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 82.86
KOG18511710 consensus Uncharacterized conserved protein [Funct 82.56
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 82.31
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 81.31
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 81.04
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 81.0
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 80.53
KOG18371621 consensus Uncharacterized conserved protein [Funct 80.49
PF12054441 DUF3535: Domain of unknown function (DUF3535); Int 80.48
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 80.43
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-126  Score=964.30  Aligned_cols=507  Identities=54%  Similarity=0.892  Sum_probs=493.8

Q ss_pred             hhhhcchhHHHHhhcCCCCHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHHhHhhcc
Q 009182           27 ETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAAHLLDRLVKDIVTE  106 (541)
Q Consensus        27 ~~~l~~ii~~vl~~l~D~d~~VR~~A~eaL~~i~k~~~~~~~~~~~~i~~~L~kl~~D~d~~VR~~A~~L~~l~kdi~~e  106 (541)
                      ..|+..++|||+.||+|+|.+|||||||++|||+|++++++..||+++|+++||+.+|+|++||+||+.+||++|||+++
T Consensus        79 ~~Y~~~iv~Pv~~cf~D~d~~vRyyACEsLYNiaKv~k~~v~~~Fn~iFdvL~klsaDsd~~V~~~aeLLdRLikdIVte  158 (675)
T KOG0212|consen   79 AGYLEKIVPPVLNCFSDQDSQVRYYACESLYNIAKVAKGEVLVYFNEIFDVLCKLSADSDQNVRGGAELLDRLIKDIVTE  158 (675)
T ss_pred             HHHHHHhhHHHHHhccCccceeeeHhHHHHHHHHHHhccCcccchHHHHHHHHHHhcCCccccccHHHHHHHHHHHhccc
Confidence            55999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cc-hhcHhhhHHHHHHHhcCCCHHHHHHHHHHHHHhhcCCCchhhhchHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHH
Q 009182          107 SD-QFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQE  185 (541)
Q Consensus       107 ~~-~~~l~~~iP~L~e~l~d~~~~vR~~a~~~l~~L~~~~~~~l~~~lp~~L~~L~~lL~D~~~eVR~~a~~~L~~ll~~  185 (541)
                      +. +|+++.|||.|.+++++.||.+|+++++|++.+.++|+.+|..|+|++++|||++|+|++++||..+..++++|+.+
T Consensus       159 ~~~tFsL~~~ipLL~eriy~~n~~tR~flv~Wl~~Lds~P~~~m~~yl~~~ldGLf~~LsD~s~eVr~~~~t~l~~fL~e  238 (675)
T KOG0212|consen  159 SASTFSLPEFIPLLRERIYVINPMTRQFLVSWLYVLDSVPDLEMISYLPSLLDGLFNMLSDSSDEVRTLTDTLLSEFLAE  238 (675)
T ss_pred             cccccCHHHHHHHHHHHHhcCCchHHHHHHHHHHHHhcCCcHHHHhcchHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHH
Confidence            76 89999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCC-ChHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhcCcCcccchhhHHHHHhhhcCCCCh-hHHHHHHHHHHH
Q 009182          186 IKNSPSV-DYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEE-KIRVVARETNEE  263 (541)
Q Consensus       186 i~~~~~~-~~~~ii~~Ll~~~~~~~~~vr~~al~wL~~l~~~~~~~l~p~l~~llp~ll~~l~d~~~-~iR~~A~~~~~~  263 (541)
                      |..+|.. +++.++++++.+.+++++++|..|+.||.+|++++|.++++|+++++..+++|++|+++ .+++.|..+|+.
T Consensus       239 I~s~P~s~d~~~~i~vlv~~l~ss~~~iq~~al~Wi~efV~i~g~~~l~~~s~il~~iLpc~s~~e~~~i~~~a~~~n~~  318 (675)
T KOG0212|consen  239 IRSSPSSMDYDDMINVLVPHLQSSEPEIQLKALTWIQEFVKIPGRDLLLYLSGILTAILPCLSDTEEMSIKEYAQMVNGL  318 (675)
T ss_pred             HhcCccccCcccchhhccccccCCcHHHHHHHHHHHHHHhcCCCcchhhhhhhhhhhcccCCCCCccccHHHHHHHHHHH
Confidence            9988877 89999999999999999999999999999999999999999999999999999999887 699999999999


Q ss_pred             HHHhhcCC--CCCCChHhHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhChHHHhhhhHHHHHHHHHhcCCCCHHHHHHHH
Q 009182          264 LRAIKADP--ADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSDEVVLLVL  341 (541)
Q Consensus       264 L~~~i~~~--~~~~~l~~il~~L~~~L~~~~~~~R~aal~wL~~L~~~~~~~i~~~l~~l~p~Ll~~L~D~~~~V~~~~~  341 (541)
                      +++.+.+.  ++.+|++.+++++.+++.++.+++|++|++|+..++.+.|+++..|.++++++|+++|+|++++|+..++
T Consensus       319 l~~l~s~~~~~~~id~~~ii~vl~~~l~~~~~~tri~~L~Wi~~l~~~~p~ql~~h~~~if~tLL~tLsd~sd~vvl~~L  398 (675)
T KOG0212|consen  319 LLKLVSSERLKEEIDYGSIIEVLTKYLSDDREETRIAVLNWIILLYHKAPGQLLVHNDSIFLTLLKTLSDRSDEVVLLAL  398 (675)
T ss_pred             HHHHHhhhhhccccchHHHHHHHHHHhhcchHHHHHHHHHHHHHHHhhCcchhhhhccHHHHHHHHhhcCchhHHHHHHH
Confidence            99887654  3348999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhc--chhhHHHHHHHHHHhccccchhhhhhHHHHHHHhhccCChhhHHHHHHHHhcccCChHHHHHHHHHhHHh
Q 009182          342 EVHACIAK--DLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLI  419 (541)
Q Consensus       342 ~~L~~i~~--~~~~f~~~m~~LL~~~~~~~~ll~~r~~~iir~Lc~~l~~e~i~~~l~~il~~~~d~~f~~~~v~~L~~i  419 (541)
                      .+++.|++  +..++.+|+.+||++|+.+++++++||++||||||.+++||+||+.+|+||+.++|+.||++|||+||+|
T Consensus       399 ~lla~i~~s~~~~~~~~fl~sLL~~f~e~~~~l~~Rg~lIIRqlC~lL~aE~IYr~~a~ILe~e~nl~FAstMV~~Ln~i  478 (675)
T KOG0212|consen  399 SLLASICSSSNSPNLRKFLLSLLEMFKEDTKLLEVRGNLIIRQLCLLLNAERIYRSIADILEREENLKFASTMVQALNTI  478 (675)
T ss_pred             HHHHHHhcCcccccHHHHHHHHHHHHhhhhHHHHhhhhHHHHHHHHHhCHHHHHHHHHHHHhccccchHHHHHHHHHHhh
Confidence            99999994  4457899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCcHhHHHHHHHHhhccCCcchhHHHHHHHHhhccChHHHHHHHHHHhhhHHHHHHHHHhhccccchHHHHHHHHHHHH
Q 009182          420 LLTSSELSELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLCLLAQTYHHASAVIQSLVEEDLNVKFLVQLDKLIRL  499 (541)
Q Consensus       420 l~t~~el~~~R~~L~~~~~~~~~~~lf~~l~~~w~~n~~~~~slcll~~~y~~a~~ll~~~~~~~~~~~~l~~id~lvql  499 (541)
                      |+|||||+++|++||+ +.+++++++|+|||++|||||||++|||||||||+|||++++.|++.|+|+++|+|+||||||
T Consensus       479 LlTStELf~LR~~Lk~-lsn~es~~lF~cLy~sWchnPva~~SLClLtQnYqhA~~liq~fa~~eitvd~L~elDKLVqL  557 (675)
T KOG0212|consen  479 LLTSTELFQLRNKLKD-LSNEESQNLFCCLYRSWCHNPVATLSLCLLTQNYQHAYDLIQLFADVEITVDFLVELDKLVQL  557 (675)
T ss_pred             hcccHHHHHHHHHHHh-ccChhhhHHHHHHHHHHcCCcHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHH
Confidence            9999999999999999 799999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhHhhhhhcCCCCChhHHHHHHHHHHHhhH
Q 009182          500 LETPIFAYLRLQVLKLRTEDYLFALLFGLTGFFNL  534 (541)
Q Consensus       500 ~esp~f~~lRl~ll~~~~~~~l~~~l~gllmllp~  534 (541)
                      ||||+|||+|+|||||.+||||.|||||||||||+
T Consensus       558 iEsPIFtylRLqLLe~~~~pyL~kaLyGlLMLLPQ  592 (675)
T KOG0212|consen  558 IESPIFTYLRLQLLEPKNNPYLHKALYGLLMLLPQ  592 (675)
T ss_pred             HhcchHHHHHHHHhccccCchHHHHHHHHHHHccc
Confidence            99999999999999999999999999999999998

>PF11916 Vac14_Fig4_bd: Vacuolar protein 14 C-terminal Fig4p binding; InterPro: IPR021841 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4524 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1877 consensus Putative transmembrane protein cmp44E [General function prediction only] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>KOG3961 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>COG5032 TEL1 Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG3961 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF08161 NUC173: NUC173 domain; InterPro: IPR012978 This is the central domain of a novel family of hypothetical nucleolar proteins [] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG1837 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5234 CIN1 Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones / Cytoskeleton] Back     alignment and domain information
>KOG1848 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1837 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query541
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-19
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-14
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-14
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-07
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 2e-15
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 4e-11
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 4e-08
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 4e-11
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 3e-05
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 2e-10
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-09
2db0_A253 253AA long hypothetical protein; heat repeats, hel 4e-08
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 8e-08
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 9e-06
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 2e-07
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 4e-04
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-07
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 6e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-05
1qgr_A876 Protein (importin beta subunit); transport recepto 8e-05
1qgr_A876 Protein (importin beta subunit); transport recepto 4e-04
1qgr_A 876 Protein (importin beta subunit); transport recepto 9e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-04
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
 Score = 91.2 bits (226), Expect = 1e-19
 Identities = 56/328 (17%), Positives = 109/328 (33%), Gaps = 15/328 (4%)

Query: 26  SETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADS 85
            E +   ++P +  +  D+  RVRY   +    + K V  +       +  A   L  D 
Sbjct: 236 QEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK--TDLVPAFQNLMKDC 293

Query: 86  DANV-QSAAHLLDRLVKDIVTES-DQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDS 143
           +A V  +A+H +    +++  +  +   + + +P ++E ++  N +V+  L   I  L  
Sbjct: 294 EAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGL-- 351

Query: 144 VPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVDYGRMAEILVQ 203
            P +     +   L      L D   E+R    S L    + I          +   +V+
Sbjct: 352 SPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQS--LLPAIVE 409

Query: 204 RAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIRVVARETNEE 263
            A       RL  I ++       G +       +    +  + D    IR  A      
Sbjct: 410 LAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEK--LNSLCMAWLVDHVYAIREAATSN--- 464

Query: 264 LRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFD 323
           L+ +       +    I+              R+  L  I+ L      ++      +  
Sbjct: 465 LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDI--TTKHMLP 522

Query: 324 TLLKALSDPSDEVVLLVLEVHACIAKDL 351
           T+L+   DP   V   V +    I   L
Sbjct: 523 TVLRMAGDPVANVRFNVAKSLQKIGPIL 550
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Length = 355 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query541
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.96
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.94
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.94
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.94
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.91
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.91
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.9
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.9
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.89
1qgr_A876 Protein (importin beta subunit); transport recepto 99.89
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.88
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.8
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.77
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.76
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.74
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.74
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.73
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.71
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.71
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.7
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.7
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.69
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.66
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.64
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.62
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.59
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.59
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.57
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.57
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.56
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.56
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.53
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.52
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.51
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.51
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.51
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.49
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.48
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.48
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.47
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.47
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.46
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.45
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.45
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 99.45
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.45
2x19_B963 Importin-13; nuclear transport, protein transport; 99.44
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.43
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.43
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.42
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.4
2x1g_F971 Cadmus; transport protein, developmental protein, 99.39
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.38
2x1g_F971 Cadmus; transport protein, developmental protein, 99.38
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.36
1wa5_C960 Importin alpha RE-exporter; nuclear transport/comp 99.35
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.28
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.27
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.22
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.21
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.18
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.16
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.15
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.12
3nmz_A458 APC variant protein; protein-protein complex, arma 99.05
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.03
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.98
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 98.98
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.98
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.97
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.9
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.87
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.8
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.79
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.79
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.75
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 98.75
3nmz_A458 APC variant protein; protein-protein complex, arma 98.74
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.74
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.69
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.69
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.68
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.66
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.6
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.59
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.56
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.55
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.55
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.54
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 98.52
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.5
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.5
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 98.34
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 98.34
3gjx_A1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.32
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.31
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 98.3
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.23
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.19
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 97.87
3grl_A651 General vesicular transport factor P115; vesicle t 97.8
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.78
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 97.55
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.41
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.03
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.02
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.93
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.79
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.77
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 96.74
3grl_A 651 General vesicular transport factor P115; vesicle t 96.49
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.32
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 96.13
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 96.12
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.06
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 95.98
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 95.83
1w9c_A321 CRM1 protein, exportin 1; nuclear protein, nuclear 95.18
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 94.94
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 93.71
1w9c_A321 CRM1 protein, exportin 1; nuclear protein, nuclear 93.41
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 93.16
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 91.43
1vsy_4799 Proteasome activator BLM10; 20S proteasome BLM10, 90.23
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 88.92
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 88.52
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 86.14
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 86.12
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 86.06
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 85.74
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 85.61
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 85.44
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 83.26
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 82.8
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 82.59
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 81.96
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
Probab=99.96  E-value=3.3e-26  Score=262.87  Aligned_cols=368  Identities=16%  Similarity=0.177  Sum_probs=309.2

Q ss_pred             hhcchhHHHHhhcCCCCHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHhhcCCCHHHHHHH-HHHHHHHhHhhccc
Q 009182           29 ILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAA-HLLDRLVKDIVTES  107 (541)
Q Consensus        29 ~l~~ii~~vl~~l~D~d~~VR~~A~eaL~~i~k~~~~~~~~~~~~i~~~L~kl~~D~d~~VR~~A-~~L~~l~kdi~~e~  107 (541)
                      ....|.+.++++++|+++.||..++.++..|++.-   ....|+++++.|.+.++++++.+|++| ..|..++++.....
T Consensus        87 ~~~~ik~~ll~~l~~~~~~vr~~~a~~i~~ia~~~---~~~~wp~ll~~L~~~l~~~~~~~r~~al~~L~~i~~~~~~~~  163 (852)
T 4fdd_A           87 VTDFIKSECLNNIGDSSPLIRATVGILITTIASKG---ELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEIL  163 (852)
T ss_dssp             HHHHHHHHHHTTTTCSSHHHHHHHHHHHHHHHHHT---TTTTCTTHHHHHHHHHSCSSHHHHHHHHHHHHHHHHHHTTHH
T ss_pred             HHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhc---CccccHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhHHHh
Confidence            34567788999999999999999999999998764   235689999999999999999999999 88999988765421


Q ss_pred             c----hhcHhhhHHHHHHHhcCCCHHHHHHHHHHHHHhhcCCCchhhhchHHHHHHHHHHcCCCCHHHHHHHHHHHHHHH
Q 009182          108 D----QFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFL  183 (541)
Q Consensus       108 ~----~~~l~~~iP~L~e~l~d~~~~vR~~a~~~l~~L~~~~~~~l~~~lp~~L~~L~~lL~D~~~eVR~~a~~~L~~ll  183 (541)
                      +    ...++.++|.+.+.+.++++.||..++.+++.+....+..+..+++.+++.+++.+.|++++||..++.+++.+.
T Consensus       164 ~~~~~~~~~~~il~~l~~~l~~~~~~vR~~A~~aL~~~~~~~~~~~~~~~~~~l~~l~~~~~d~~~~vr~~a~~~L~~l~  243 (852)
T 4fdd_A          164 DSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLL  243 (852)
T ss_dssp             HHCSSSSCHHHHHHHHTTTTTCSSHHHHHHHHHHHHTTTTTTCHHHHTSHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHH
T ss_pred             chhhhcchHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence            1    233788999999999999999999999999988877777788899999999999999999999999999999998


Q ss_pred             HHhcCCCCCChHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhh--cCcCcccchhhHHHHHhhhcC-----------C--
Q 009182          184 QEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKL--GGDQLVPYYADILGAILPCIS-----------D--  248 (541)
Q Consensus       184 ~~i~~~~~~~~~~ii~~Ll~~~~~~~~~vr~~al~wL~~l~~~--~~~~l~p~l~~llp~ll~~l~-----------d--  248 (541)
                      +..+....++++.+++.++...++.++.+|..|++++..+++.  ....+.||+++++|.+++.|.           |  
T Consensus       244 ~~~~~~~~~~l~~l~~~l~~~~~~~~~~vr~~a~e~l~~l~~~~~~~~~~~~~~~~l~p~ll~~l~~~e~d~~~~~~d~~  323 (852)
T 4fdd_A          244 EVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVE  323 (852)
T ss_dssp             HHCHHHHGGGHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHTTSTTHHHHHTTTHHHHHHHHHHHTSCCHHHHHHHHC---
T ss_pred             HhCHHHHHHHHHHHHHHHHHHccCCcHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHcCCcHhHHHHhcCCcc
Confidence            7654333456889999999999999999999999777766652  123357899999999999983           3  


Q ss_pred             ---------CChhHHHHHHHHHHHHHHhhcCCCCCCChHhHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhChHHHhhhhH
Q 009182          249 ---------KEEKIRVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLN  319 (541)
Q Consensus       249 ---------~~~~iR~~A~~~~~~L~~~i~~~~~~~~l~~il~~L~~~L~~~~~~~R~aal~wL~~L~~~~~~~i~~~l~  319 (541)
                               .+.++|..|.++.+.+.+..++    .-++.+++.+.+.+.+++|..|.+|+.+++.+++++++.+.++++
T Consensus       324 ed~~~dd~~~~~~vr~~a~~~L~~la~~~~~----~~~~~l~~~l~~~l~~~~~~~R~aa~~alg~i~~~~~~~~~~~l~  399 (852)
T 4fdd_A          324 GGSGGDDTISDWNLRKCSAAALDVLANVYRD----ELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLP  399 (852)
T ss_dssp             ---------CCCCHHHHHHHHHHHHHHHHGG----GGHHHHHHHHHHHHTCSSHHHHHHHHHHHHHTTTTTHHHHGGGHH
T ss_pred             cccccccccccchHHHHHHHHHHHHHHhccH----HHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcchHHHHHHHH
Confidence                     2235788999999888776653    235788999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHHHHhc------chhhHHHHHHHHHHhccccchhhhhhHHHHHHHhhccCCh----
Q 009182          320 DIFDTLLKALSDPSDEVVLLVLEVHACIAK------DLQHFRQLVVFLVHNFRVDNSLLEKRGALIIRRLCVLLDA----  389 (541)
Q Consensus       320 ~l~p~Ll~~L~D~~~~V~~~~~~~L~~i~~------~~~~f~~~m~~LL~~~~~~~~ll~~r~~~iir~Lc~~l~~----  389 (541)
                      .++|.+++.++|+++.||..++|+++++++      ...|+.++++.+++.+.+++..++..+...+.++|...+.    
T Consensus       400 ~~l~~l~~~l~d~~~~Vr~~a~~~l~~l~~~~~~~~~~~~~~~ll~~L~~~L~d~~~~vr~~a~~aL~~l~~~~~~~l~~  479 (852)
T 4fdd_A          400 ELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVP  479 (852)
T ss_dssp             HHHHHHHHHTTCSSHHHHHHHHHHHHHTHHHHHHSCTTTTHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHGGGGGG
T ss_pred             HHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHhhHhhHh
Confidence            999999999999999999999999999984      3578999999999999877777777888888888877665    


Q ss_pred             --hhHHHHHHHHhccc
Q 009182          390 --ERVYRELSTILEGE  403 (541)
Q Consensus       390 --e~i~~~l~~il~~~  403 (541)
                        +.+...+..++...
T Consensus       480 ~l~~ll~~L~~~l~~~  495 (852)
T 4fdd_A          480 YLAYILDTLVFAFSKY  495 (852)
T ss_dssp             GHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHh
Confidence              35555666666543
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1w9c_A CRM1 protein, exportin 1; nuclear protein, nuclear export complex; 2.3A {Homo sapiens} SCOP: a.118.1.19 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1w9c_A CRM1 protein, exportin 1; nuclear protein, nuclear export complex; 2.3A {Homo sapiens} SCOP: a.118.1.19 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 541
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 8e-14
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-13
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-12
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 2e-10
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 2e-06
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 7e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.001
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 6e-07
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 2e-04
d2bpta1 861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 5e-04
d1wa5c_ 959 a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Sacc 5e-04
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Cullin-associated NEDD8-dissociated protein 1 (Tip120)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 72.1 bits (175), Expect = 8e-14
 Identities = 55/457 (12%), Positives = 138/457 (30%), Gaps = 19/457 (4%)

Query: 21  DLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCK 80
           D     +   +++V  +L    D++  V+  A + L  +   V+   +     I D LC 
Sbjct: 34  DSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVE---TIVDTLCT 90

Query: 81  LSADSDANVQSAAHLLDRLVKDIVTESDQFS------IEEFIPLLRERM-NVLNPYVRQF 133
                   ++  + +  + V   +  +   S       ++    L   +    +  V+  
Sbjct: 91  NMLSDKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLE 150

Query: 134 LVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALWEFLQEIKNSPSVD 193
            +  +  + S     ++ F P  L  L   L+     +R++   AL   +    N   VD
Sbjct: 151 ALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVD 210

Query: 194 YGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKI 253
              +  +L + + +    T  T I  I    +  G ++  Y   I+  ++   +  ++++
Sbjct: 211 L--IEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDEL 268

Query: 254 RVVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTE 313
           R    +  E              V  I++I  + L+ +      +     + +      +
Sbjct: 269 REYCIQAFESFVRRCPKEVYPH-VSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDD 327

Query: 314 VLHFLNDIF-DTLLKALSDPSDEVVLLVLEVHACIAKDLQHFRQLVVFLVHNFR-----V 367
                +D + D    +          L   V        + ++ +   L+  F+     V
Sbjct: 328 DDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENV 387

Query: 368 DNSLLEKRGALIIRRLCVLLDAERVYRELSTILEGEADLDFACTMVQALNLILLTSSELS 427
              +     +L+ +   V                          +V+AL+  +   S  +
Sbjct: 388 KADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKT 447

Query: 428 ELRDLLKKSLVNPAGKDLFVSLYASWCHSPMAIISLC 464
                   + +                   +  ++  
Sbjct: 448 RQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDK 484
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query541
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.92
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.9
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.87
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.86
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.75
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.7
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.68
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.68
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.67
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.67
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.49
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.4
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.4
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.33
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.29
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.25
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.1
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.04
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.8
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 98.66
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.66
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.59
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.49
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.4
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 98.31
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.31
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 94.58
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 94.25
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 93.39
d1w9ca_321 Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [Tax 92.83
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 90.61
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 89.23
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 87.45
d1w9ca_321 Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [Tax 87.42
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=1.3e-23  Score=227.30  Aligned_cols=351  Identities=17%  Similarity=0.205  Sum_probs=276.9

Q ss_pred             HhhhhhhcchhhhhcchhHHHHhhcCCCCHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHhhcCCCHHHHHHH-HH
Q 009182           17 LLYADLFFYSETILQQIVPPVLNSFSDQDSRVRYYACEALYNIAKVVRGDFIIFFNQIFDALCKLSADSDANVQSAA-HL   95 (541)
Q Consensus        17 ~~~~~~~~~~~~~l~~ii~~vl~~l~D~d~~VR~~A~eaL~~i~k~~~~~~~~~~~~i~~~L~kl~~D~d~~VR~~A-~~   95 (541)
                      ..+++.+.. +.+...++|.+...++|++|+||.++++++.++++..+++..  ...++|.+.+++.|++++||.+| ..
T Consensus       228 ~~i~~~~~~-~~~~~~i~~~l~~~~~D~~~~Vr~~~~~~l~~l~~~~~~~~~--~~~l~~~l~~ll~d~~~~vr~~a~~~  304 (588)
T d1b3ua_         228 VNIAQLLPQ-EDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEIT--KTDLVPAFQNLMKDCEAEVRAAASHK  304 (588)
T ss_dssp             HHHHHHSCH-HHHHHHTHHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHH--HHTHHHHHHHHHTCSSHHHHHHHHHH
T ss_pred             HHhhccCCH-HHHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhhhhhh--hhhhhHHHHHHHhccchHHHHHHHHH
Confidence            444444433 455566789999999999999999999999999987765543  35789999999999999999999 88


Q ss_pred             HHHHHhHhhccc-chhcHhhhHHHHHHHhcCCCHHHHHHHHHHHHHhhcCCCchhhhchHHHHHHHHHHcCCCCHHHHHH
Q 009182           96 LDRLVKDIVTES-DQFSIEEFIPLLRERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQ  174 (541)
Q Consensus        96 L~~l~kdi~~e~-~~~~l~~~iP~L~e~l~d~~~~vR~~a~~~l~~L~~~~~~~l~~~lp~~L~~L~~lL~D~~~eVR~~  174 (541)
                      +..+++.+..+. ....++.++|.+...+.|.++.||..+..++..+....+.+  .+.+.+++.+.+.+.|++++||..
T Consensus       305 l~~~~~~l~~~~~~~~~~~~i~~~l~~~~~d~~~~vr~~~~~~l~~~~~~~~~~--~~~~~l~p~l~~~l~d~~~~v~~~  382 (588)
T d1b3ua_         305 VKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKD--NTIEHLLPLFLAQLKDECPEVRLN  382 (588)
T ss_dssp             HHHHHHTSCTTTHHHHHHHTHHHHHHHHHTCSCHHHHHHHHTTGGGGHHHHCHH--HHHHHTHHHHHHHHTCSCHHHHHH
T ss_pred             HHHHHHHHhhhhhhhhhHHHHHHHHHHhhcCCChHHHHHHHHHHhhhhhccchh--HHHHHHHHHHHHHHHhhhhhhhhH
Confidence            888887554322 22356889999999999999999999999988877655432  345667788888999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCCChHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhcCcCcccchhhHHHHHhhhcCCCChhHH
Q 009182          175 ADSALWEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINEFVKLGGDQLVPYYADILGAILPCISDKEEKIR  254 (541)
Q Consensus       175 a~~~L~~ll~~i~~~~~~~~~~ii~~Ll~~~~~~~~~vr~~al~wL~~l~~~~~~~l~p~l~~llp~ll~~l~d~~~~iR  254 (541)
                      +..+++.+...++.  ..-.+.++|.+....++++|.+|..++..++.++...+...  +.+.+.|.+..++.|+...||
T Consensus       383 ~~~~l~~~~~~~~~--~~~~~~ll~~l~~~~~d~~~~~r~~~~~~l~~l~~~~~~~~--~~~~l~~~l~~~l~D~~~~VR  458 (588)
T d1b3ua_         383 IISNLDCVNEVIGI--RQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEF--FDEKLNSLCMAWLVDHVYAIR  458 (588)
T ss_dssp             HHTTCHHHHHHSCH--HHHHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHCGGG--CCHHHHHHHHHGGGCSSHHHH
T ss_pred             HHHHHHHHHhhcch--hhhhhHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHcChHh--HHHHHHHHHHhhccCCchhHH
Confidence            99999988876641  11257789999999999999999999999999988776555  457899999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCCCCChHhHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhChHHHhhhhHHHHHHHHHhcCCCCH
Q 009182          255 VVARETNEELRAIKADPADGFDVGPILSIATRQLSSEWEATRIEALHWISTLLNRHRTEVLHFLNDIFDTLLKALSDPSD  334 (541)
Q Consensus       255 ~~A~~~~~~L~~~i~~~~~~~~l~~il~~L~~~L~~~~~~~R~aal~wL~~L~~~~~~~i~~~l~~l~p~Ll~~L~D~~~  334 (541)
                      .+|.++.+.+.+..+.+   +....++|.+.+.+.++++..|.+++.+++.+.+.++.+.  +.+.++|.+++.++|+.+
T Consensus       459 ~~A~~~L~~l~~~~~~~---~~~~~i~~~l~~~~~~~~~~~R~~~~~~l~~l~~~~~~~~--~~~~ilp~ll~~~~D~v~  533 (588)
T d1b3ua_         459 EAATSNLKKLVEKFGKE---WAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDI--TTKHMLPTVLRMAGDPVA  533 (588)
T ss_dssp             HHHHHHHHHHHHHHCHH---HHHHHTHHHHHHTTTCSCHHHHHHHHHHHHHHHHHHHHHH--HHHHTHHHHHHGGGCSCH
T ss_pred             HHHHHHHHHHHHHhCcH---HHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHcChHH--HHHHHHHHHHHHcCCCCH
Confidence            99999999987665432   3346788999999999999999999999999999888765  457899999999999999


Q ss_pred             HHHHHHHHHHHHHhc--chhhHHHHHHHHHHhcccc-chhhhhhHHHHHH
Q 009182          335 EVVLLVLEVHACIAK--DLQHFRQLVVFLVHNFRVD-NSLLEKRGALIIR  381 (541)
Q Consensus       335 ~V~~~~~~~L~~i~~--~~~~f~~~m~~LL~~~~~~-~~ll~~r~~~iir  381 (541)
                      +||..+++++..++.  +++.+..-+..+++.+.+| ..-++..+...+.
T Consensus       534 nVR~~a~~~l~~i~~~~~~~~~~~~i~~~l~~L~~D~d~dVr~~A~~al~  583 (588)
T d1b3ua_         534 NVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALT  583 (588)
T ss_dssp             HHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHTTCSSHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCcHhHHHHHHHHHHHHcCCCCHHHHHHHHHHHH
Confidence            999999999999984  3344444445555544433 3333333333333
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1w9ca_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ca_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure