Citrus Sinensis ID: 009194


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVFFH
ccHHHHHHHHHHHHcccEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccccEEEcccccccccEEcccccccHHHHcccccccEEEEEEcccccccccccccccccEEEEEccccccccccccccccccHHHHccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEcccccccHHHccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccccccc
ccHHHHHHHHHHHcccccEEEEcccccccccccHHcccEEEEEEccccHHHccccccccccEEEEEEccccccccccHHHHHHccccEEEEccccccccccccHHHHHcccEEEccccccccccHHHHHcccEEEEcccccHHHccHHHHHHHcccEEEccccccccEccHHHHHHHHcccEEEEccccccEcccccccHHHHHHHHHHccccEEEEEEcccHHcccHcccccHcccEEEEccEEcccccccccccHHHHHHHHHHHHHccccccHHHHHHccccccEEEEcccccccccccccccccccccccEEEEcccHHHHHHHcccccccccHcccccEEEEcccHHHHHHHcccccccccccccEEEEEcccHHHHHcccHHHHHHcccccEEEEcccHcHHHccccccccccccccccEEEEccccccccccccccccEEEEcccHHHcccccccHHHHHHcccEEEEcccccHEEEEcccccccccccEEccccccccHcccHcHHHccccccEcccHHHHHHEcccccccc
MHDVIHVVAVSIAteermfnvpnvaDLEKKMEETIqkdpiaislphrdiqelperlqcpnlqlfllytegngpmqvsdhffegmeglkvlqfpgigssslpssLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNinqlpveigqLTRLQlldlsncwwleviapnVISKLSQLEELymgngfsgwekveggsnasLVELERLtelttleievpdaeilppdfvsVELQRYKirigdgpedefdpllVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVhelddgegfprlkRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLRedqsfsnlriinvDSCRKLKYLFSFSMAKNLLRLqkvkvedcddlkmiigpdmekppttqgfieinaeddpvhqgiyccqnltkvtvwscHRLKYLFSYSMVNSLGQLQHLEIRNcrsiegvvntttlggrdefkvfpklhylslhwlpklssfaspedvihtemqpqslfdekvffh
MHDVIHVVAvsiateermfnvpNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTtleievpdaeilppdfvSVELQRYKIRigdgpedefdpLLVKSEASRLMMLKGIKKvsilqendgTKMLLQRTEDLWLETLEGVQSVVHelddgegfprLKRLLVTDCSEILhivgsvrrvrCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSmaknllrlqkVKVEDCDDLKMiigpdmekppTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVntttlggrdeFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEmqpqslfdekvffh
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFpgigssslpsslgrliNLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASlvelerltelttleieVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVFFH
***VIHVVAVSIATEERMFNVPNVADL***********PIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPD******TQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFA***********************
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEV*****ISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVN*********FKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVFFH
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVFFH
*HDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVFFH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query540 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.822 0.483 0.265 9e-17
Q9T048985 Disease resistance protei no no 0.729 0.4 0.256 1e-16
Q42484909 Disease resistance protei no no 0.701 0.416 0.237 1e-15
Q6DHL5238 Leucine-rich repeat-conta yes no 0.264 0.600 0.309 5e-06
Q7XA39988 Putative disease resistan N/A no 0.168 0.092 0.365 9e-06
C0LGP4 1010 Probable LRR receptor-lik no no 0.251 0.134 0.3 1e-05
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.262 0.101 0.345 2e-05
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.251 0.096 0.342 2e-05
O35930 734 Platelet glycoprotein Ib no no 0.159 0.117 0.402 2e-05
A4IIK1 997 Malignant fibrous histioc no no 0.370 0.200 0.286 3e-05
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 134/505 (26%), Positives = 224/505 (44%), Gaps = 61/505 (12%)

Query: 1   MHDVIHVVAV-SIATEERMFNVPNVADL------EKKMEETIQKDPIAISLPHRDIQELP 53
           MHDV+   A+  ++++   F+   +A        + K   ++Q+    +SL    ++ LP
Sbjct: 431 MHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQR----VSLMANKLERLP 486

Query: 54  ERLQCPNLQLFLLYTEGNGPM-QVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQT 112
             +    ++  +L  +GN  + +V + F +    L++L   G+   +LP S   L +L++
Sbjct: 487 NNV-IEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRS 545

Query: 113 LCLDWCE-LADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAP 171
           L L  C+ L ++ ++  L KL+ L L  S I +LP  +  L+ L+ + +SN + L+ I  
Sbjct: 546 LVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPA 605

Query: 172 NVISKLSQLEELYMGNGFSGW----EKVEGGSNASLVELERLTELTTLEIEVPDAEILPP 227
             I +LS LE L M      W    E+ EG   A+L E+  L  L  L I++ D      
Sbjct: 606 GTILQLSSLEVLDMAGSAYSWGIKGEEREG--QATLDEVTCLPHLQFLAIKLLDVLSFSY 663

Query: 228 DFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTE 287
           +F S+  +  K +        F P+   S          I  V++   N     LLQ   
Sbjct: 664 EFDSLTKRLTKFQF------LFSPIRSVSPPGTGEGCLAISDVNV--SNASIGWLLQHVT 715

Query: 288 DLWLETLEGVQSVVHEL--DDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEAL 345
            L L   EG+  +   L       F  +K L +     +    G   ++  ++FP LE L
Sbjct: 716 SLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQL--DLFPNLEEL 773

Query: 346 SLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFS-MAKNLLRLQKVKVEDC 404
           SL  + NLE+I             L+++ V  CR+LK LFS   +A  L  LQ++KV  C
Sbjct: 774 SLDNV-NLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSC 832

Query: 405 DDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQN-LTKVTVWSCHRLKYLFSY-S 462
             L+ +                 N    PV    +C ++ L K+TV    +LKYL    S
Sbjct: 833 LRLEEL----------------FNFSSVPVD---FCAESLLPKLTVI---KLKYLPQLRS 870

Query: 463 MVNS---LGQLQHLEIRNCRSIEGV 484
           + N    L  L+HLE+ +C S++ +
Sbjct: 871 LCNDRVVLESLEHLEVESCESLKNL 895




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.744 0.305 0.456 4e-82
255574526 1232 Disease resistance protein RFL1, putativ 0.933 0.409 0.411 1e-81
255563252 1603 Disease resistance protein RPS5, putativ 0.744 0.250 0.472 3e-81
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.727 0.159 0.463 3e-77
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.737 0.419 0.460 1e-76
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.744 0.3 0.453 6e-74
358344919 1995 NBS/LRR resistance protein-like protein 0.866 0.234 0.379 3e-72
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.733 0.167 0.437 1e-71
359488108 1436 PREDICTED: disease resistance protein At 0.924 0.347 0.356 7e-71
359488103 1530 PREDICTED: disease resistance protein At 0.914 0.322 0.368 9e-71
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  311 bits (798), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 193/423 (45%), Positives = 271/423 (64%), Gaps = 21/423 (4%)

Query: 1   MHDVIHVVAVSIATEERMFNVPNVADLEKKM-EETIQKDPIAISLPHRDIQELPERLQCP 59
           MHDV+H  A+S+A   R  +V  VAD  K+     + +   AISLP R I +LP  L+CP
Sbjct: 460 MHDVVHSFAISVAL--RDHHVLTVADEFKEWPANDVLQQYTAISLPFRKIPDLPAILECP 517

Query: 60  NLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCE 119
           NL  FLL  + +  +Q+ D FF  M+ LK+L    +  S LPSSL  L NLQTLCLD C 
Sbjct: 518 NLNSFLLLNK-DPSLQIPDSFFREMKELKILDLTEVNLSPLPSSLQFLENLQTLCLDHCV 576

Query: 120 LADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQ 179
           L DI+ IG+L KL++LSL  SNI +LP EIG++TRLQLLDLSNC  LEVI+PN +S L++
Sbjct: 577 LEDISIIGELNKLKVLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLTR 636

Query: 180 LEELYMGNGFSGWEKVEGGS----NASLVELERLTELTTLEIEVPDAEILPPDFVSV--E 233
           LE+LYMGN F  WE  EG S    NA L EL+ L+ L+TL +++ DA+ +P D  S    
Sbjct: 637 LEDLYMGNSFVKWE-TEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQN 695

Query: 234 LQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLET 293
           L+R++I IGDG +       VK   SR + L   K  +++Q  +G   LL+ TE+L L+ 
Sbjct: 696 LERFRIFIGDGWD-----WSVKDATSRTLKL---KLNTVIQLEEGVNTLLKITEELHLQE 747

Query: 294 LEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNL 353
           L GV+S++++L DGEGFP+L+ L V +C  + +I+ S+R      F  L++L L  L NL
Sbjct: 748 LNGVKSILNDL-DGEGFPQLRHLHVQNCPGVQYIINSIRMGPRTAFLNLDSLFLENLDNL 806

Query: 354 ETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGP 413
           E IC+ QL   +S  NLRI+ V+SC +LK LFS SMA+ L+RL+++ + DC  ++ ++  
Sbjct: 807 EKICHGQLMA-ESLGNLRILKVESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAE 865

Query: 414 DME 416
           + E
Sbjct: 866 ESE 868




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358344919|ref|XP_003636533.1| NBS/LRR resistance protein-like protein [Medicago truncatula] gi|355502468|gb|AES83671.1| NBS/LRR resistance protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.725 0.426 0.241 2e-15
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.359 0.196 0.263 2.3e-12
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.312 0.185 0.239 6.6e-11
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.305 0.186 0.281 1.1e-05
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.333 0.186 0.258 2.3e-05
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.327 0.196 0.25 0.00013
TAIR|locus:21750751068 AT5G41750 [Arabidopsis thalian 0.138 0.070 0.341 0.00014
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.316 0.224 0.238 0.00039
MGI|MGI:1333744 734 Gp1ba "glycoprotein 1b, alpha 0.140 0.103 0.432 0.0004
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 2.0e-15, Sum P(2) = 2.0e-15
 Identities = 100/414 (24%), Positives = 174/414 (42%)

Query:     1 MHDVIHVVAV-SIATEERMFNVPNVAD--LEKKMEETIQKDPIAISLPHRDIQELPERLQ 57
             MHDV+   A+  ++++   F+   +A   L +  ++        +SL    ++ LP  + 
Sbjct:   431 MHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV- 489

Query:    58 CPNLQLFLLYTEGNGPM-QVSDHFFEGMEGLKVLQFXXXXXXXXXXXXXXXXNLQTLCLD 116
                ++  +L  +GN  + +V + F +    L++L                  +L++L L 
Sbjct:   490 IEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLR 549

Query:   117 WCE-LADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVIS 175
              C+ L ++ ++  L KL+ L L  S I +LP  +  L+ L+ + +SN + L+ I    I 
Sbjct:   550 NCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTIL 609

Query:   176 KLSQLEELYM-GNGFS-GWEKVEGGSNASXXXXXXXXXXXXXXXXVPDAEILPPDFVSVE 233
             +LS LE L M G+ +S G +  E    A+                + D      +F S+ 
Sbjct:   610 QLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLT 669

Query:   234 LQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLET 293
              +  K +        F P+   S          I  V++   + G   LLQ    L L  
Sbjct:   670 KRLTKFQF------LFSPIRSVSPPGTGEGCLAISDVNVSNASIG--WLLQHVTSLDLNY 721

Query:   294 LEGVQSVVHEL--DDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLT 351
              EG+  +   L       F  +K L +     +    G   ++  ++FP LE LSL  + 
Sbjct:   722 CEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQL--DLFPNLEELSLDNV- 778

Query:   352 NLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFS-MAKNLLRLQKVKVEDC 404
             NLE+I             L+++ V  CR+LK LFS   +A  L  LQ++KV  C
Sbjct:   779 NLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSC 832


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1333744 Gp1ba "glycoprotein 1b, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-04
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 53.8 bits (129), Expect = 1e-07
 Identities = 37/104 (35%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 85  EGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAA-IGQLKKLEILSLAYSNIN 143
             LK L        SLPS L  L NL+ L L + +L+D+   +  L  L  L L+ + I+
Sbjct: 140 SNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKIS 199

Query: 144 QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGN 187
            LP EI  L+ L+ LDLSN   +E+   + +S L  L  L + N
Sbjct: 200 DLPPEIELLSALEELDLSNNSIIEL--LSSLSNLKNLSGLELSN 241


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 540
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.37
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.35
KOG4341483 consensus F-box protein containing LRR [General fu 99.32
KOG4341483 consensus F-box protein containing LRR [General fu 99.31
KOG4237498 consensus Extracellular matrix protein slit, conta 99.21
KOG4237498 consensus Extracellular matrix protein slit, conta 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.86
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.32
PLN03150623 hypothetical protein; Provisional 98.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.29
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.23
PLN03150623 hypothetical protein; Provisional 98.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.06
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.76
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.52
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.42
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.93
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.4
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.0
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.61
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.56
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.85
smart0037026 LRR Leucine-rich repeats, outliers. 86.85
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.97  E-value=1.1e-28  Score=276.31  Aligned_cols=194  Identities=21%  Similarity=0.316  Sum_probs=128.0

Q ss_pred             cCCCeEEEccCCCCCC-CCC-cCCCCCccEEEcccCCCCCccccHHHHhcCccCcEEEcCCCCCCC-CCcccccCCCCcE
Q 009194           36 QKDPIAISLPHRDIQE-LPE-RLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSS-LPSSLGRLINLQT  112 (540)
Q Consensus        36 ~~~l~~l~l~~~~~~~-l~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~-l~~~l~~l~~L~~  112 (540)
                      ..+++.++++++.+.. ++. +..+++|+.|++++|.+ ...+|.+++.++++|++|++++|.+.. +|.  +.+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~-~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL-SGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCcc-CCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCE
Confidence            3478889998887743 333 33788999999998887 667888877788888888888887753 443  45677777


Q ss_pred             EEcCCCccCC--cccccCCCCCCEEEecCCCCc-ccchhcCCCCCCCEEECCCCccccccchhhhhcCCccceEEccCCC
Q 009194          113 LCLDWCELAD--IAAIGQLKKLEILSLAYSNIN-QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGF  189 (540)
Q Consensus       113 L~l~~~~~~~--~~~i~~l~~L~~L~l~~~~~~-~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~  189 (540)
                      |++++|.+..  |..++++++|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|+.|++++|.
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNN  223 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCc
Confidence            7777777653  566777777777777777654 56666777777777777777644555554 6777777777777665


Q ss_pred             cccccccCCCccchhhccCCCCccEEEeecCCCC-CCCccccc-cCccEEEEEe
Q 009194          190 SGWEKVEGGSNASLVELERLTELTTLEIEVPDAE-ILPPDFVS-VELQRYKIRI  241 (540)
Q Consensus       190 ~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~~~~-~~L~~L~l~~  241 (540)
                      +..        ..+..++++++|++|++++|... .+|..+.. ++|+.|.+..
T Consensus       224 l~~--------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  269 (968)
T PLN00113        224 LSG--------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQ  269 (968)
T ss_pred             cCC--------cCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcC
Confidence            541        22334555566666666655532 33433333 5555555543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 84.6 bits (210), Expect = 3e-18
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 18/131 (13%)

Query: 93  PGIGSSSLPSSLGRLINLQTLCLDWCELADI-AAIGQLKKLEILSLAYSNINQLPVEIGQ 151
             + S+        L+NLQ+L L+W  +  + A+I  L+ L+ L +  S ++ L   I  
Sbjct: 168 EPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHH 227

Query: 152 LTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVEL----E 207
           L +L+ LDL  C  L    P +    + L+ L + +             ++L+ L     
Sbjct: 228 LPKLEELDLRGCTALRNY-PPIFGGRAPLKRLILKD------------CSNLLTLPLDIH 274

Query: 208 RLTELTTLEIE 218
           RLT+L  L++ 
Sbjct: 275 RLTQLEKLDLR 285


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.63
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.01
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.91
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.83
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.82
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.78
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.6
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.63
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.7
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-32  Score=287.65  Aligned_cols=165  Identities=26%  Similarity=0.264  Sum_probs=135.4

Q ss_pred             CcchhhhhhhhhhcCCCeEEEccCCCCCCCCC--cCCCCCccEEEcccCCCCCccccHHHHhcCccCcEEEcCCCCCCCC
Q 009194           23 NVADLEKKMEETIQKDPIAISLPHRDIQELPE--RLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSL  100 (540)
Q Consensus        23 ~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~--~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l  100 (540)
                      .+.+++.+|. .++++++++++++|.+..++.  +.++++|++|++++|.+  ..++...|.++++|++|++++|.+..+
T Consensus        19 ~~~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l--~~i~~~~~~~l~~L~~L~Ls~n~l~~~   95 (606)
T 3vq2_A           19 MDQKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEI--ETIEDKAWHGLHHLSNLILTGNPIQSF   95 (606)
T ss_dssp             TTSCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCC--CEECTTTTTTCTTCCEEECTTCCCCCC
T ss_pred             cCCCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCcc--cccCHHHhhchhhcCEeECCCCccccc
Confidence            3445666665 467899999999999977765  44999999999999986  556555678999999999999999876


Q ss_pred             -CcccccCCCCcEEEcCCCccCC-c-ccccCCCCCCEEEecCCCCc--ccchhcCCCCCCCEEECCCCccccccchhhhh
Q 009194          101 -PSSLGRLINLQTLCLDWCELAD-I-AAIGQLKKLEILSLAYSNIN--QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVIS  175 (540)
Q Consensus       101 -~~~l~~l~~L~~L~l~~~~~~~-~-~~i~~l~~L~~L~l~~~~~~--~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~  175 (540)
                       |..++++++|++|++++|.++. + ..++++++|++|++++|.+.  .+|..++++++|++|++++|. +..++...++
T Consensus        96 ~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~  174 (606)
T 3vq2_A           96 SPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNY-IQTITVNDLQ  174 (606)
T ss_dssp             CTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSC-CCEECTTTTH
T ss_pred             ChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCc-ceecChhhhh
Confidence             7889999999999999999887 4 78999999999999999887  578999999999999999988 5555444355


Q ss_pred             cCCccc----eEEccCCCcc
Q 009194          176 KLSQLE----ELYMGNGFSG  191 (540)
Q Consensus       176 ~l~~L~----~L~l~~~~~~  191 (540)
                      .+++|+    .|++++|.+.
T Consensus       175 ~l~~L~~~l~~L~l~~n~l~  194 (606)
T 3vq2_A          175 FLRENPQVNLSLDMSLNPID  194 (606)
T ss_dssp             HHHHCTTCCCEEECTTCCCC
T ss_pred             hhhccccccceeeccCCCcc
Confidence            555444    5777666554



>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 540
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 55.4 bits (132), Expect = 8e-09
 Identities = 23/121 (19%), Positives = 44/121 (36%), Gaps = 6/121 (4%)

Query: 42  ISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLP 101
           + L    I  +        L       E N            ++ L  L       S + 
Sbjct: 268 LKLGANQISNISPLAGLTALTNL----ELNENQLEDISPISNLKNLTYLTLYFNNISDIS 323

Query: 102 SSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLS 161
             +  L  LQ L     +++D++++  L  +  LS  ++ I+ L   +  LTR+  L L+
Sbjct: 324 P-VSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLT-PLANLTRITQLGLN 381

Query: 162 N 162
           +
Sbjct: 382 D 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.36
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84  E-value=4e-19  Score=174.88  Aligned_cols=341  Identities=16%  Similarity=0.178  Sum_probs=171.9

Q ss_pred             cCccCcEEEcCCCCCCCCCcccccCCCCcEEEcCCCccCCcccccCCCCCCEEEecCCCCcccchhcCCCCCCCEEECCC
Q 009194           83 GMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSN  162 (540)
Q Consensus        83 ~l~~L~~L~l~~~~~~~l~~~l~~l~~L~~L~l~~~~~~~~~~i~~l~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~~  162 (540)
                      .+.+|++|+++++.++.+. .+..+++|++|++++|.++++..++++++|++|++++|.+..++. ++.+++|+.|++.+
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-cccccccccccccc
Confidence            4556777777777776653 466777777777777777764457777777777777777666653 66777777777766


Q ss_pred             CccccccchhhhhcCCccceEEccCCCcccccccCCCccchhhccCCCCccEEEeecCCCCCCCccccccCccEEEEEec
Q 009194          163 CWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIG  242 (540)
Q Consensus       163 ~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~  242 (540)
                      +. ...++.  ......+.......+.+.....        .....................+..   ............
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~l~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~  185 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNTISDISA--------LSGLTSLQQLSFGNQVTDLKPLAN---LTTLERLDISSN  185 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEEECCCGG--------GTTCTTCSEEEEEESCCCCGGGTT---CTTCCEEECCSS
T ss_pred             cc-cccccc--cccccccccccccccccccccc--------ccccccccccccccccchhhhhcc---cccccccccccc
Confidence            55 333333  2334444444443332221000        000001111111111111111100   011111111111


Q ss_pred             CCCCCCCCccccccccccEEEEeccccccccccchhhhhhhcccceeeeccccCcccccccCccCCCCccccEEeecccc
Q 009194          243 DGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCS  322 (540)
Q Consensus       243 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  322 (540)
                      .   .........+++++.+.++++. +..+.    .....++|+.|.+.++. +++.    +.+..+++|+.+.+.++ 
T Consensus       186 ~---~~~~~~~~~l~~~~~l~l~~n~-i~~~~----~~~~~~~L~~L~l~~n~-l~~~----~~l~~l~~L~~L~l~~n-  251 (384)
T d2omza2         186 K---VSDISVLAKLTNLESLIATNNQ-ISDIT----PLGILTNLDELSLNGNQ-LKDI----GTLASLTNLTDLDLANN-  251 (384)
T ss_dssp             C---CCCCGGGGGCTTCSEEECCSSC-CCCCG----GGGGCTTCCEEECCSSC-CCCC----GGGGGCTTCSEEECCSS-
T ss_pred             c---cccccccccccccceeeccCCc-cCCCC----cccccCCCCEEECCCCC-CCCc----chhhcccccchhccccC-
Confidence            1   1111124455566666665521 11111    11234566666665543 2221    12445666666666666 


Q ss_pred             CceeeeccccccccccCcccceecccccccccccccccCCCCCCCCCCCeEEEeeCCCCccccChHHHhhcccccEEEEc
Q 009194          323 EILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVE  402 (540)
Q Consensus       323 ~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~  402 (540)
                      .++.+.      ....+++|+.|++.++ .++.+..     ...++.++.+.+..+ .++.++   ....+++++.|+++
T Consensus       252 ~l~~~~------~~~~~~~L~~L~l~~~-~l~~~~~-----~~~~~~l~~l~~~~n-~l~~~~---~~~~~~~l~~L~ls  315 (384)
T d2omza2         252 QISNLA------PLSGLTKLTELKLGAN-QISNISP-----LAGLTALTNLELNEN-QLEDIS---PISNLKNLTYLTLY  315 (384)
T ss_dssp             CCCCCG------GGTTCTTCSEEECCSS-CCCCCGG-----GTTCTTCSEEECCSS-CCSCCG---GGGGCTTCSEEECC
T ss_pred             ccCCCC------cccccccCCEeeccCc-ccCCCCc-----ccccccccccccccc-cccccc---ccchhcccCeEECC
Confidence            233332      3455666666666543 2332221     344566666666654 344432   24556666666666


Q ss_pred             cccccccccccCCCCCCCccceeeecccCCCCCCCccCCCCccEEEEccCCCcccccchhhhhhcCCCcEEEEecccccc
Q 009194          403 DCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIE  482 (540)
Q Consensus       403 ~c~~l~~~~~~~~~~~~~l~~l~~i~~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~~~~~~~~l~~L~~L~i~~C~~L~  482 (540)
                      ++ +++++.                         .+..+++|++|++++| ++++++   .+.++++|++|+++++ +++
T Consensus       316 ~n-~l~~l~-------------------------~l~~l~~L~~L~L~~n-~l~~l~---~l~~l~~L~~L~l~~N-~l~  364 (384)
T d2omza2         316 FN-NISDIS-------------------------PVSSLTKLQRLFFANN-KVSDVS---SLANLTNINWLSAGHN-QIS  364 (384)
T ss_dssp             SS-CCSCCG-------------------------GGGGCTTCCEEECCSS-CCCCCG---GGGGCTTCCEEECCSS-CCC
T ss_pred             CC-CCCCCc-------------------------ccccCCCCCEEECCCC-CCCCCh---hHcCCCCCCEEECCCC-cCC
Confidence            54 444331                         2345678888888887 566663   3567788888888765 455


Q ss_pred             eeccccccCCCCccccccccceeeccc
Q 009194          483 GVVNTTTLGGRDEFKVFPKLHYLSLHW  509 (540)
Q Consensus       483 ~~~~~~~~~~~~~~~~~~~L~~L~l~~  509 (540)
                      +++.         +..+++|++|+|++
T Consensus       365 ~l~~---------l~~l~~L~~L~L~~  382 (384)
T d2omza2         365 DLTP---------LANLTRITQLGLND  382 (384)
T ss_dssp             BCGG---------GTTCTTCSEEECCC
T ss_pred             CChh---------hccCCCCCEeeCCC
Confidence            5431         33567777777654



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure