Citrus Sinensis ID: 009272


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN
ccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEccccHHHHHHccccccccEEEEccccccccccccccccHHcccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccEEEEEEEEEccccEEEcHHcccccccccccEEEEccEEEEEEEEcccccccEEEEEEEEEccccEEEEEccccccccEEEEcccccHHHHHHHcccccHHHHHHcccccccccccccccccccccccEEEEcccccccHHHHHHHHHcccccccccccccccccccccccccccEEEEEcccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHcHHcccc
cccHHHHHHHHHHHHHHHHHccccccccccccHHEEEHHHcccEEEEEEEEEcccccHHHHHHHHcccccEEEEcccEcHHHcHHHHEHHHHHccHHcccccccEEEEEcccccEEEEEcEccHHHHccccEEcEccccccccccccHHHHHHHHHHHHHHHcEcccccHHHHHHHHHHHHcccccEEEEccEcccEEEEcEEcEccccEEccHHHHHHHcccccEEEEEccEEEEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEEEEEEEccHHHHHHHHHHHccEEcHHHHHHccccccEEcccccEEEEccEEEEEEEccccccccccccEEEEcHcccEEEccccccccccEEEEccccccEEEEEEEcccccEEEEEEcccccccccEcccccccHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccEEEEEEccccccccccccHHHHHHHHHHHcEEccccEEcccEcccEccccEEcccEcEEEccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHc
mdlrclrlSFVATLATFLFFHDfcacqkapnysfmrnataakpvsyydyivigggtagcplaASLSQNASVLLLergdspygnpnitnsgsfsaeladlsptspsqrfisedgvvSTRArvlgggtcinagfytraepyyareagwdgrlvNESYQWVEKkvvfrppmqRWQSALRDGLVevgvlpyngftydhlygtkiggtiidqnsqrhTAADLLEYANPSGLTVLLHASVHKILFrnkgkarpvahgvvfrdatdaEHIAYLRNGPKNEIIVsagalgspqllmlsgvgpadhlkahnitvvldqplvgqgmsdnpmnaifvpspvpVEVSLIQVVGItqfgsyiegasgvnfaggspsprpyrggfifekiigpvstghlelrtrnpndtpsvtfnyfkepedlqRCVQGISTIEKIIESksfskfkydnmSVETLLNMTasmplnllpkhsntstslEQFCRDTVMTIWHyhggcqvgkvvdhdykvlGVDAlrvvdgstfyyspgtnpqaTVMMLGRYMGVRILSERLASN
MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRarvlgggtcinagfytRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFrnkgkarpvahGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIiesksfskfkYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGStfyyspgtnpqatVMMLGRYMGVRILSERLASN
MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAggspsprpyrggFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGistiekiiesksfskfkYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN
**LRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLL*************************************DGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGG****RPYRGGFIFEKIIGPVSTGHLELRT*******SVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLP******TSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRIL*******
******RLSFVATLATFLFFHDFCACQK**************PVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRI*SER****
MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN
*DLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query538 2.2.26 [Sep-21-2011]
Q9S746594 Protein HOTHEAD OS=Arabid no no 0.908 0.823 0.533 1e-161
Q9SSM2552 (R)-mandelonitrile lyase- no no 0.921 0.898 0.495 1e-134
P52706563 (R)-mandelonitrile lyase N/A no 0.936 0.895 0.425 1e-113
Q945K2563 (R)-mandelonitrile lyase N/A no 0.962 0.920 0.420 1e-113
O50048576 (R)-mandelonitrile lyase N/A no 0.933 0.871 0.426 1e-110
P52707573 (R)-mandelonitrile lyase N/A no 0.936 0.879 0.412 1e-109
O82784574 (R)-mandelonitrile lyase N/A no 0.960 0.900 0.406 1e-105
O24243559 (R)-mandelonitrile lyase N/A no 0.925 0.890 0.412 1e-105
Q47944531 L-sorbose 1-dehydrogenase yes no 0.810 0.821 0.281 2e-30
Q9WWW2552 Alcohol dehydrogenase [ac yes no 0.812 0.791 0.286 4e-28
>sp|Q9S746|HTH_ARATH Protein HOTHEAD OS=Arabidopsis thaliana GN=HTH PE=1 SV=1 Back     alignment and function desciption
 Score =  568 bits (1464), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 285/534 (53%), Positives = 361/534 (67%), Gaps = 45/534 (8%)

Query: 45  SYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSP 104
           S YDYIVIGGGTAGCPLAA+LSQN SVL+LERG  P+ N N++   +F   LAD+S +S 
Sbjct: 61  SSYDYIVIGGGTAGCPLAATLSQNFSVLVLERGGVPFTNANVSFLRNFHIGLADISASSA 120

Query: 105 SQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVF 164
           SQ F+S DGV + RARVLGGG+CINAGFY+RA+  + + AGWD +LV ESY WVE+++V 
Sbjct: 121 SQAFVSTDGVYNARARVLGGGSCINAGFYSRADAAFVKRAGWDPKLVKESYPWVEREIVH 180

Query: 165 RPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPS 224
           +P +  WQ ALRD L+EVGV P+NGFTYDH+ GTKIGGTI D+  +RHTAA+LL YANP 
Sbjct: 181 QPKLTLWQKALRDSLLEVGVRPFNGFTYDHVSGTKIGGTIFDRFGRRHTAAELLAYANPQ 240

Query: 225 GLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSP 284
            L VL++A+V KI+F   G  RP   GV+F+D    +H A L N   +E+I+S+GA+GSP
Sbjct: 241 KLRVLIYATVQKIVFDTSG-TRPRVTGVIFKDEKGNQHQALLSNRKGSEVILSSGAIGSP 299

Query: 285 QLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQ 344
           Q+LMLSG+GP   L+   I VVL+   VG+GM+DNPMN I VPS  P+E SLIQ VGIT+
Sbjct: 300 QMLMLSGIGPKKELQRLKIPVVLENEHVGKGMADNPMNTILVPSKAPIEQSLIQTVGITK 359

Query: 345 FGSYIEGASGVNFAGGSPSP-----------------------RP--------------- 366
            G Y+E ++G    G SP                         RP               
Sbjct: 360 MGVYVEASTGF---GQSPESIHTHYGIMSNKNELFSTIPAKQRRPEATQAYITRNKYQLH 416

Query: 367 --YRGGFIFEKIIGPVSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIE 424
             + G FI EK+  P+S GHL L   N +D PSVTFNYFK P DLQRCV+ I  + K++ 
Sbjct: 417 EAFNGSFILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQRCVEAIRLVSKVVT 476

Query: 425 SKSFSKF-KYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQV 483
           S  F  + + D  +V  +L+++    +NL PK  N + S+ QFC+DTV+TIWHYHGGC V
Sbjct: 477 SNRFLNYTQCDKQNVHKMLSLSVKANINLRPKQLNDTKSMAQFCKDTVVTIWHYHGGCLV 536

Query: 484 GKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS 537
           GKVV  + KVLGVD LRV+DGSTF  SPGTNPQAT+MM+GRYMGV+IL ERL +
Sbjct: 537 GKVVSPNRKVLGVDRLRVIDGSTFDESPGTNPQATMMMMGRYMGVKILRERLGN 590




Probable FAD-dependent enzyme. Involved in regulating post-genital organ fusion. Required to limit cellular interactions between contacting epidermal cells during floral development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SSM2|MDLL_ARATH (R)-mandelonitrile lyase-like OS=Arabidopsis thaliana GN=At1g73050 PE=2 SV=1 Back     alignment and function description
>sp|P52706|MDL1_PRUSE (R)-mandelonitrile lyase 1 OS=Prunus serotina GN=MDL1 PE=1 SV=1 Back     alignment and function description
>sp|Q945K2|MDL2_PRUDU (R)-mandelonitrile lyase 2 OS=Prunus dulcis GN=MDL2 PE=1 SV=1 Back     alignment and function description
>sp|O50048|MDL2_PRUSE (R)-mandelonitrile lyase 2 OS=Prunus serotina GN=MDL2 PE=2 SV=1 Back     alignment and function description
>sp|P52707|MDL3_PRUSE (R)-mandelonitrile lyase 3 OS=Prunus serotina GN=MDL3 PE=2 SV=1 Back     alignment and function description
>sp|O82784|MDL4_PRUSE (R)-mandelonitrile lyase 4 OS=Prunus serotina GN=MDL4 PE=2 SV=1 Back     alignment and function description
>sp|O24243|MDL1_PRUDU (R)-mandelonitrile lyase 1 OS=Prunus dulcis GN=MDL1 PE=2 SV=1 Back     alignment and function description
>sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 Back     alignment and function description
>sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query538
359474262568 PREDICTED: protein HOTHEAD isoform 2 [Vi 1.0 0.947 0.707 0.0
359474260578 PREDICTED: protein HOTHEAD isoform 1 [Vi 1.0 0.930 0.695 0.0
356514078581 PREDICTED: protein HOTHEAD-like [Glycine 0.977 0.905 0.711 0.0
356563226581 PREDICTED: protein HOTHEAD-like [Glycine 0.977 0.905 0.713 0.0
224053991577 predicted protein [Populus trichocarpa] 0.977 0.911 0.719 0.0
449452496578 PREDICTED: protein HOTHEAD-like [Cucumis 0.975 0.908 0.677 0.0
449495903580 PREDICTED: protein HOTHEAD-like [Cucumis 0.975 0.905 0.677 0.0
357481759580 Choline dehydrogenase [Medicago truncatu 0.973 0.903 0.666 0.0
357481761580 Choline dehydrogenase [Medicago truncatu 0.942 0.874 0.678 0.0
255537255548 glucose-methanol-choline (gmc) oxidoredu 0.927 0.910 0.666 0.0
>gi|359474262|ref|XP_003631426.1| PREDICTED: protein HOTHEAD isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/565 (70%), Positives = 459/565 (81%), Gaps = 27/565 (4%)

Query: 1   MDLRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCP 60
           M +   R    A     +FFH FC+ +KAPNYSFM  AT+A  +SYYDYI++GGGTAGCP
Sbjct: 1   MGVGLWRFILAAFAGVLVFFHGFCSSEKAPNYSFMHQATSAPAISYYDYIIVGGGTAGCP 60

Query: 61  LAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRAR 120
           LAA+LSQN SVLLLERG +PYGNPNITN GSF A  +D SPTSPSQRF+SEDGV++ RAR
Sbjct: 61  LAATLSQNYSVLLLERGGAPYGNPNITNLGSFGAPFSDFSPTSPSQRFVSEDGVINARAR 120

Query: 121 VLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLV 180
           VLGGG+C+NAGFYTRA P Y  E GWD  +V ESY+WVEK V F+PPM++WQSA+RDGL+
Sbjct: 121 VLGGGSCLNAGFYTRAGPDYVEEVGWDSGMVKESYEWVEKVVAFKPPMRQWQSAVRDGLL 180

Query: 181 EVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFR 240
           EVGVLPYNGFTYDH+YGTKIGGTI D +  RHTAADLL+YANP+GLTVLLHA+VHKI FR
Sbjct: 181 EVGVLPYNGFTYDHIYGTKIGGTIFDPDGHRHTAADLLQYANPTGLTVLLHATVHKITFR 240

Query: 241 NKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKA 300
            +GK RPVAHGV+FRD    +H AYL+   KNEIIVS+GALGSPQLLMLSGVGPA  +KA
Sbjct: 241 RRGKVRPVAHGVIFRDVLGKKHKAYLKRDSKNEIIVSSGALGSPQLLMLSGVGPAQQIKA 300

Query: 301 HNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGG 360
           HNI++VLD P+VGQ MSDNPMNAIF+PSP+PVEVSLIQVVGIT  G+YIE ASG NFA  
Sbjct: 301 HNISLVLDLPMVGQRMSDNPMNAIFIPSPLPVEVSLIQVVGITHSGTYIEAASGENFAAS 360

Query: 361 SP-------SPR--------------------PYRGGFIFEKIIGPVSTGHLELRTRNPN 393
            P       SP+                     +RGGFI EKI+GP+STGHLEL++RNPN
Sbjct: 361 GPQRDFGMFSPKQRTPEAIAKAIDSMSKLDETAFRGGFILEKIMGPISTGHLELQSRNPN 420

Query: 394 DTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLL 453
           D PSVTFNYFKEPEDLQRCV G+  IEKIIESK+FS+FKYD +SV  L+NMT + P+NL+
Sbjct: 421 DNPSVTFNYFKEPEDLQRCVNGMQIIEKIIESKAFSQFKYDYLSVPALINMTLNFPVNLV 480

Query: 454 PKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGT 513
           P+H N STSLEQFC+DTVMTIWHYHGGCQVG VVDHDYKVLGVDALRV+DGSTF  SPGT
Sbjct: 481 PRHDNASTSLEQFCKDTVMTIWHYHGGCQVGSVVDHDYKVLGVDALRVIDGSTFNASPGT 540

Query: 514 NPQATVMMLGRYMGVRILSERLASN 538
           NPQATVMMLGRYMG+RILSERLAS+
Sbjct: 541 NPQATVMMLGRYMGLRILSERLASD 565




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359474260|ref|XP_002282510.2| PREDICTED: protein HOTHEAD isoform 1 [Vitis vinifera] gi|297742610|emb|CBI34759.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356514078|ref|XP_003525734.1| PREDICTED: protein HOTHEAD-like [Glycine max] Back     alignment and taxonomy information
>gi|356563226|ref|XP_003549865.1| PREDICTED: protein HOTHEAD-like [Glycine max] Back     alignment and taxonomy information
>gi|224053991|ref|XP_002298074.1| predicted protein [Populus trichocarpa] gi|222845332|gb|EEE82879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452496|ref|XP_004143995.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449495903|ref|XP_004159980.1| PREDICTED: protein HOTHEAD-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357481759|ref|XP_003611165.1| Choline dehydrogenase [Medicago truncatula] gi|355512500|gb|AES94123.1| Choline dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357481761|ref|XP_003611166.1| Choline dehydrogenase [Medicago truncatula] gi|355512501|gb|AES94124.1| Choline dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255537255|ref|XP_002509694.1| glucose-methanol-choline (gmc) oxidoreductase, putative [Ricinus communis] gi|223549593|gb|EEF51081.1| glucose-methanol-choline (gmc) oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query538
TAIR|locus:2034705572 AT1G12570 [Arabidopsis thalian 0.639 0.601 0.701 9.5e-187
TAIR|locus:2173068586 AT5G51950 [Arabidopsis thalian 0.663 0.609 0.626 6.9e-171
TAIR|locus:2078441577 AT3G56060 [Arabidopsis thalian 0.663 0.618 0.598 1.3e-169
TAIR|locus:2173053582 AT5G51930 [Arabidopsis thalian 0.594 0.549 0.608 4e-151
TAIR|locus:2032627594 HTH "HOTHEAD" [Arabidopsis tha 0.574 0.520 0.587 7.8e-144
TAIR|locus:2032642552 AT1G73050 [Arabidopsis thalian 0.933 0.909 0.482 2.8e-121
UNIPROTKB|Q945K2563 MDL2 "(R)-mandelonitrile lyase 0.959 0.916 0.413 1.4e-101
TAIR|locus:2035830501 AT1G14190 [Arabidopsis thalian 0.689 0.740 0.422 2.5e-100
TAIR|locus:505006121503 AT1G14185 [Arabidopsis thalian 0.719 0.769 0.423 1.1e-99
UNIPROTKB|G4N440625 MGG_16853 "Uncharacterized pro 0.284 0.244 0.301 4.2e-28
TAIR|locus:2034705 AT1G12570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1296 (461.3 bits), Expect = 9.5e-187, Sum P(2) = 9.5e-187
 Identities = 242/345 (70%), Positives = 283/345 (82%)

Query:    14 LATFLFFHD-FCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVL 72
             +A  LF H   C+  KAPNYSFMR+AT +   SYYDYI+IGGGTAGCPLAA+LSQNASVL
Sbjct:    12 VALSLFLHSPICSSDKAPNYSFMRDATGSPTTSYYDYIIIGGGTAGCPLAATLSQNASVL 71

Query:    73 LLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGF 132
             LLERGDSPY NPNIT   +F A L+DLS +SPSQRF+SEDGV++ RARVLGGG+ +NAGF
Sbjct:    72 LLERGDSPYNNPNITRLSAFGAALSDLSESSPSQRFVSEDGVINARARVLGGGSALNAGF 131

Query:   133 YTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTY 192
             YTRA   Y R  GWDG L NESYQWVE KV F+PPM RWQ+A+RDGL+E G++P NGFTY
Sbjct:   132 YTRAGTKYVRNMGWDGALANESYQWVEAKVAFQPPMGRWQTAVRDGLLEAGIVPNNGFTY 191

Query:   193 DHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGV 252
             DH+ GTK GGTI D+N  RHTAADLLEYA+P G+TVLLHA+VH+ILFR +G  +P+A+GV
Sbjct:   192 DHINGTKFGGTIFDRNGNRHTAADLLEYADPKGITVLLHATVHRILFRTRGTTKPIANGV 251

Query:   253 VFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLV 312
             V+RD T   H AYL+ G  +EII+SAG LGSPQLLMLSGVGP+  L+A NITVV+DQP V
Sbjct:   252 VYRDRTGQAHRAYLKEGALSEIILSAGTLGSPQLLMLSGVGPSAQLQAQNITVVMDQPHV 311

Query:   313 GQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNF 357
             GQGM DNPMNA+FVPSPVPVEVSLI+VVGIT  G+Y+E A G NF
Sbjct:   312 GQGMYDNPMNAVFVPSPVPVEVSLIEVVGITGEGTYVEAAGGENF 356


GO:0005576 "extracellular region" evidence=ISM
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0008812 "choline dehydrogenase activity" evidence=IEA
GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA
GO:0016832 "aldehyde-lyase activity" evidence=ISS
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2173068 AT5G51950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078441 AT3G56060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173053 AT5G51930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032627 HTH "HOTHEAD" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032642 AT1G73050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q945K2 MDL2 "(R)-mandelonitrile lyase 2" [Prunus dulcis (taxid:3755)] Back     alignment and assigned GO terms
TAIR|locus:2035830 AT1G14190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006121 AT1G14185 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N440 MGG_16853 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.3.4LOW CONFIDENCE prediction!
4th Layer4.1.2.10LOW CONFIDENCE prediction!
3rd Layer4.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 0.0
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 1e-44
TIGR01810532 TIGR01810, betA, choline dehydrogenase 4e-37
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 2e-33
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 8e-26
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 5e-20
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 3e-14
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 3e-13
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 5e-07
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 4e-04
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 7e-04
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 7e-04
PTZ00367567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 8e-04
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 0.002
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.002
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 0.002
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.004
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
 Score =  740 bits (1913), Expect = 0.0
 Identities = 319/572 (55%), Positives = 398/572 (69%), Gaps = 40/572 (6%)

Query: 3   LRCLRLSFVATLATFLFFHDFCACQKAPNYSFMRNATAAKPV-SYYDYIVIGGGTAGCPL 61
           L CL  S  +   +    + +    KA ++S   +++++    S YDYIV+GGGTAGCPL
Sbjct: 11  LLCLPTSSSSQGKSHFTPYRYPFIDKASSFSSSSSSSSSSGGDSAYDYIVVGGGTAGCPL 70

Query: 62  AASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLSPTSPSQRFISEDGVVSTRARV 121
           AA+LSQN SVLLLERG  P+GN N++   +F   LAD SPTS SQ FIS DGV++ RARV
Sbjct: 71  AATLSQNFSVLLLERGGVPFGNANVSFLENFHIGLADTSPTSASQAFISTDGVINARARV 130

Query: 122 LGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVE 181
           LGGGTCINAGFY+RA   + ++AGWD +LVNESY WVE+++V  P +  WQ+ALRD L+E
Sbjct: 131 LGGGTCINAGFYSRASTRFIQKAGWDAKLVNESYPWVERQIVHWPKVAPWQAALRDSLLE 190

Query: 182 VGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRN 241
           VGV P+NGFTYDH+YGTK+GGTI D+  +RHTAA+LL   NP+ L VLLHA+V KI+F +
Sbjct: 191 VGVSPFNGFTYDHVYGTKVGGTIFDEFGRRHTAAELLAAGNPNKLRVLLHATVQKIVF-D 249

Query: 242 KGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAH 301
               RP A GV+F+D    +H A+L N   +EII+SAGA+GSPQ+L+LSG+GP   LK H
Sbjct: 250 TSGKRPRATGVIFKDENGNQHQAFLSNNKGSEIILSAGAIGSPQMLLLSGIGPKKELKKH 309

Query: 302 NITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGS 361
            I VVL    VG+GM+DNPMN+IFVPS  PVE SLIQ VGIT+ G YIE +SG   +  S
Sbjct: 310 KIPVVLHNEHVGKGMADNPMNSIFVPSKAPVEQSLIQTVGITKMGVYIEASSGFGQSPDS 369

Query: 362 -------------------PSPRP------------------YRGGFIFEKIIGPVSTGH 384
                              P  R                   + GGFI EKI GP+STGH
Sbjct: 370 IHCHHGIMSAEIGQLSTIPPKQRTPEAIQAYIHRKKNLPHEAFNGGFILEKIAGPISTGH 429

Query: 385 LELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKF-KYDNMSVETLLN 443
           L L   N +D PSVTFNYFK P+DLQRCV GI TIEKI+++  F+ F + D  ++E +LN
Sbjct: 430 LSLINTNVDDNPSVTFNYFKHPQDLQRCVYGIRTIEKIVKTNHFTNFTQCDKQTMEKVLN 489

Query: 444 MTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVD 503
           M+    +NL+PKH+N + SLEQFC+DTV+TIWHYHGGC VGKVVD +YKVLGV  LRV+D
Sbjct: 490 MSVKANINLIPKHTNDTKSLEQFCKDTVITIWHYHGGCHVGKVVDQNYKVLGVSRLRVID 549

Query: 504 GSTFYYSPGTNPQATVMMLGRYMGVRILSERL 535
           GSTF  SPGTNPQATVMM+GRYMGV+IL ERL
Sbjct: 550 GSTFDESPGTNPQATVMMMGRYMGVKILRERL 581


Length = 587

>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 538
PLN02785587 Protein HOTHEAD 100.0
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.97
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.63
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.51
PRK07121492 hypothetical protein; Validated 99.49
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.48
PRK08274466 tricarballylate dehydrogenase; Validated 99.48
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.47
COG2081408 Predicted flavoproteins [General function predicti 99.47
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.45
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.44
PRK06175433 L-aspartate oxidase; Provisional 99.43
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.42
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.41
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.4
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.39
PRK12839572 hypothetical protein; Provisional 99.37
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.37
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.34
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.34
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.33
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.32
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.32
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.32
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.32
PLN02815 594 L-aspartate oxidase 99.32
PRK12842574 putative succinate dehydrogenase; Reviewed 99.31
PRK07395553 L-aspartate oxidase; Provisional 99.31
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.31
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.3
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.3
PRK07804541 L-aspartate oxidase; Provisional 99.29
PRK08071510 L-aspartate oxidase; Provisional 99.28
PRK09077536 L-aspartate oxidase; Provisional 99.28
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.28
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.27
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.26
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.25
PLN02464627 glycerol-3-phosphate dehydrogenase 99.24
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.24
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.24
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.22
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.21
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.21
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.19
COG0579429 Predicted dehydrogenase [General function predicti 99.19
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.18
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.17
PRK07512513 L-aspartate oxidase; Provisional 99.16
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.15
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.14
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.12
PRK08275554 putative oxidoreductase; Provisional 99.12
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.12
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.1
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.09
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.08
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.08
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.07
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.07
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.07
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.06
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.06
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.05
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.03
PRK05257494 malate:quinone oxidoreductase; Validated 99.02
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.01
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.0
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.0
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.99
PLN02661357 Putative thiazole synthesis 98.98
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.98
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.97
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.97
PRK11728393 hydroxyglutarate oxidase; Provisional 98.97
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.97
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.96
PRK08401466 L-aspartate oxidase; Provisional 98.94
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.93
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.92
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 98.92
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.88
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.88
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.85
PRK10157428 putative oxidoreductase FixC; Provisional 98.83
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.8
COG3573552 Predicted oxidoreductase [General function predict 98.8
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.79
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.79
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.74
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.74
PRK10015429 oxidoreductase; Provisional 98.73
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.68
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.67
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.67
PRK13977576 myosin-cross-reactive antigen; Provisional 98.65
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.63
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.62
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.61
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.56
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.56
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.54
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.54
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.52
PLN02507499 glutathione reductase 98.52
PLN02985514 squalene monooxygenase 98.51
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.49
PRK06185407 hypothetical protein; Provisional 98.49
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.45
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.45
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.43
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.41
PRK07208479 hypothetical protein; Provisional 98.4
PRK06847375 hypothetical protein; Provisional 98.4
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.38
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.37
PLN02697529 lycopene epsilon cyclase 98.37
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.36
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.35
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 98.34
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.33
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.31
PRK07045388 putative monooxygenase; Reviewed 98.3
PRK06126545 hypothetical protein; Provisional 98.3
KOG2853509 consensus Possible oxidoreductase [General functio 98.28
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.27
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.26
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.25
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.25
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.23
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.23
PTZ00058561 glutathione reductase; Provisional 98.22
PRK08244493 hypothetical protein; Provisional 98.22
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.21
PRK06116450 glutathione reductase; Validated 98.21
PRK06370463 mercuric reductase; Validated 98.21
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.2
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 98.19
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.19
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.17
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.16
PRK06834488 hypothetical protein; Provisional 98.16
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.16
PRK06184502 hypothetical protein; Provisional 98.15
PRK08163396 salicylate hydroxylase; Provisional 98.15
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.14
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.14
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.13
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.13
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.12
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.12
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.11
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.11
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.11
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.1
PRK07190487 hypothetical protein; Provisional 98.1
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.09
PLN02546558 glutathione reductase 98.08
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.08
KOG4716503 consensus Thioredoxin reductase [Posttranslational 98.07
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.07
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.07
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.05
PRK07588391 hypothetical protein; Provisional 98.05
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.03
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.03
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.03
PRK14694468 putative mercuric reductase; Provisional 98.02
TIGR02053463 MerA mercuric reductase. This model represents the 98.01
PTZ00153659 lipoamide dehydrogenase; Provisional 98.0
PRK11445351 putative oxidoreductase; Provisional 98.0
PRK13748561 putative mercuric reductase; Provisional 97.99
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.98
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 97.97
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.97
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.96
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.96
PRK07236386 hypothetical protein; Provisional 97.96
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.96
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.95
PRK06753373 hypothetical protein; Provisional 97.94
PTZ00052499 thioredoxin reductase; Provisional 97.92
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.9
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 97.89
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.89
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.87
KOG2852380 consensus Possible oxidoreductase [General functio 97.79
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.78
PLN02676487 polyamine oxidase 97.77
PRK05868372 hypothetical protein; Validated 97.77
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.76
PRK14727479 putative mercuric reductase; Provisional 97.76
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.76
PRK09897534 hypothetical protein; Provisional 97.76
PRK07846451 mycothione reductase; Reviewed 97.76
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.73
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.73
PRK09126392 hypothetical protein; Provisional 97.73
PRK08013400 oxidoreductase; Provisional 97.72
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.69
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.68
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.68
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.66
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.64
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.63
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.62
PLN02463447 lycopene beta cyclase 97.61
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.6
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.58
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.57
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.57
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.53
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.52
PLN02268435 probable polyamine oxidase 97.52
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.51
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.5
PTZ00367567 squalene epoxidase; Provisional 97.48
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.47
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.47
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.46
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.44
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.44
PRK07233434 hypothetical protein; Provisional 97.39
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.37
PLN02576496 protoporphyrinogen oxidase 97.36
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.36
PRK06996398 hypothetical protein; Provisional 97.33
PLN02568539 polyamine oxidase 97.32
PRK10262321 thioredoxin reductase; Provisional 97.32
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.27
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.23
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.22
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.21
PRK07538413 hypothetical protein; Provisional 97.19
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.18
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.18
COG3349485 Uncharacterized conserved protein [Function unknow 97.18
PRK08294 634 phenol 2-monooxygenase; Provisional 97.15
PRK13512438 coenzyme A disulfide reductase; Provisional 97.11
PRK12416463 protoporphyrinogen oxidase; Provisional 97.11
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.08
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.07
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.06
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.05
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.02
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 96.99
PRK12831464 putative oxidoreductase; Provisional 96.95
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.91
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.9
PLN02529738 lysine-specific histone demethylase 1 96.86
PLN02612567 phytoene desaturase 96.85
PRK06475400 salicylate hydroxylase; Provisional 96.82
PLN02328808 lysine-specific histone demethylase 1 homolog 96.81
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.76
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.68
PLN02487569 zeta-carotene desaturase 96.67
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.64
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 96.63
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.62
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 96.6
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.59
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.55
PRK098531019 putative selenate reductase subunit YgfK; Provisio 96.49
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.44
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.4
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.35
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.32
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.23
PRK12814652 putative NADPH-dependent glutamate synthase small 96.21
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 96.21
PLN03000 881 amine oxidase 96.2
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.18
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.16
PLN02976 1713 amine oxidase 96.16
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.16
PLN02852491 ferredoxin-NADP+ reductase 96.15
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.15
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.07
PRK06327475 dihydrolipoamide dehydrogenase; Validated 95.91
PRK06567 1028 putative bifunctional glutamate synthase subunit b 95.88
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.87
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 95.87
PRK05976472 dihydrolipoamide dehydrogenase; Validated 95.82
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 95.73
PRK14989 847 nitrite reductase subunit NirD; Provisional 95.68
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.65
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 95.59
COG4529474 Uncharacterized protein conserved in bacteria [Fun 95.59
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.57
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 95.51
PRK06370463 mercuric reductase; Validated 95.49
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.43
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.38
TIGR02053463 MerA mercuric reductase. This model represents the 95.38
PTZ00188506 adrenodoxin reductase; Provisional 95.37
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.34
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 95.29
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 95.29
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 95.28
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 95.24
PRK10262321 thioredoxin reductase; Provisional 95.18
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 95.17
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.11
PRK07845466 flavoprotein disulfide reductase; Reviewed 95.04
PLN02507499 glutathione reductase 95.03
PRK06116450 glutathione reductase; Validated 95.01
PRK14727479 putative mercuric reductase; Provisional 94.97
PRK13984604 putative oxidoreductase; Provisional 94.96
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 94.86
PTZ00318424 NADH dehydrogenase-like protein; Provisional 94.82
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 94.82
PRK09564444 coenzyme A disulfide reductase; Reviewed 94.79
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 94.79
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 94.75
PRK12831464 putative oxidoreductase; Provisional 94.72
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 94.71
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 94.66
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 94.58
PRK13748561 putative mercuric reductase; Provisional 94.42
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 94.33
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 94.33
PTZ00058561 glutathione reductase; Provisional 94.19
PRK14694468 putative mercuric reductase; Provisional 93.94
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 93.93
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 93.85
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.8
KOG2403 642 consensus Succinate dehydrogenase, flavoprotein su 93.59
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 93.55
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 93.48
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 93.45
KOG03992142 consensus Glutamate synthase [Amino acid transport 93.36
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 93.35
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 93.26
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 93.19
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 93.12
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 92.9
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 92.85
KOG2755334 consensus Oxidoreductase [General function predict 92.77
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 92.47
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 92.36
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 92.29
KOG0404322 consensus Thioredoxin reductase [Posttranslational 91.68
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 91.07
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 90.51
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 90.35
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 89.7
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 88.85
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 88.72
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 88.47
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 88.42
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 88.35
PRK07846451 mycothione reductase; Reviewed 88.03
PRK05708305 2-dehydropantoate 2-reductase; Provisional 87.18
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 86.69
PRK13512438 coenzyme A disulfide reductase; Provisional 86.01
PRK14989 847 nitrite reductase subunit NirD; Provisional 85.99
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 85.35
PRK06292460 dihydrolipoamide dehydrogenase; Validated 85.08
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 84.99
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 84.95
PRK06249313 2-dehydropantoate 2-reductase; Provisional 84.48
PTZ00153659 lipoamide dehydrogenase; Provisional 84.33
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 84.28
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.27
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 83.91
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 83.65
PRK12921305 2-dehydropantoate 2-reductase; Provisional 83.25
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 83.08
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 82.89
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 82.76
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.73
PLN02546558 glutathione reductase 81.99
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.89
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.87
PRK04148134 hypothetical protein; Provisional 81.85
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 81.8
PRK06718202 precorrin-2 dehydrogenase; Reviewed 81.71
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.63
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.53
PRK06719157 precorrin-2 dehydrogenase; Validated 81.4
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.48
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 80.1
>PLN02785 Protein HOTHEAD Back     alignment and domain information
Probab=100.00  E-value=2e-81  Score=665.47  Aligned_cols=510  Identities=61%  Similarity=1.048  Sum_probs=400.4

Q ss_pred             ccCCCcccccccccCCC----------CCCccEEEECCCCchHHHhhhhcCCCeEEEEeccCCCCCCCCcccchhhhhhh
Q 009272           27 QKAPNYSFMRNATAAKP----------VSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAEL   96 (538)
Q Consensus        27 ~~~~~~~~~~~~~~~~~----------~~~~DvIIVGsG~aG~~~A~~La~g~~VlvlE~G~~~~~~~~~~~~~~~~~~~   96 (538)
                      .....+.|+.++.+.+.          +..|||||||+|.+||++|.+|+++.+|||||+|+.....+.+.....+....
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yD~IIVG~G~aG~~lA~~Ls~~~~VLllE~G~~~~~~~~~~~~~~~~~~~  105 (587)
T PLN02785         26 FTPYRYPFIDKASSFSSSSSSSSSSGGDSAYDYIVVGGGTAGCPLAATLSQNFSVLLLERGGVPFGNANVSFLENFHIGL  105 (587)
T ss_pred             CCccCCchhhccccccccccccccccccccCCEEEECcCHHHHHHHHHHhcCCcEEEEecCCCCCCCchhhhHHhhCCcc
Confidence            34455688999887776          56899999999999999999999988999999998643334443333343344


Q ss_pred             cCCCCCCCCccccCCCceeecCcccccchhhhcccccccCChhhhhcCCCChhhhhhhhhhhccccccCCCCchhHHHHH
Q 009272           97 ADLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALR  176 (538)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~g~~lGG~s~~n~~~~~r~~~~~~~~~gw~~~~l~~~~~~~e~~~~~~~~~~~~~~~~~  176 (538)
                      .+|.+.+.+|.+..++.+.+.+||+|||+|++|++.|.|+++++++..||+++.+.++|++.|+.+...+...++...+.
T Consensus       106 ~d~~~~~~~q~~~~~~~~~~~rGr~LGGsS~iN~~~y~Rg~~~d~~~~GW~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~  185 (587)
T PLN02785        106 ADTSPTSASQAFISTDGVINARARVLGGGTCINAGFYSRASTRFIQKAGWDAKLVNESYPWVERQIVHWPKVAPWQAALR  185 (587)
T ss_pred             cccCCccccccccCCCceeccccceecchhhhcCeEEEeCCHHHhccCCCCcccccchHHHHhcccccCCCcChHHHHHH
Confidence            57888888888888889999999999999999999999999988888899999999999999987655666778899999


Q ss_pred             HHHHHcCCCCCCCCccCCCCceeeeeeeeCCCCccccHHHHHhhcCCCCeEEEeccEEEEEEecCCCCCCCeEEEEEEEe
Q 009272          177 DGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRD  256 (538)
Q Consensus       177 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~g~r~~~~~~l~~~~~~~~~i~~~~~V~~I~~~~~~~~~~~~~gV~~~~  256 (538)
                      +++.++|+.+.+++..++..+...+.++++..|.|+++..+++.+++.|++|++++.|++|++++++ .+++++||++.+
T Consensus       186 ~a~~e~G~~~~n~~~~d~~~G~~~g~~i~~~~g~R~saa~l~~~~~~~nl~Vl~~a~V~rIl~~~~~-~~~ra~GV~~~~  264 (587)
T PLN02785        186 DSLLEVGVSPFNGFTYDHVYGTKVGGTIFDEFGRRHTAAELLAAGNPNKLRVLLHATVQKIVFDTSG-KRPRATGVIFKD  264 (587)
T ss_pred             HHHHHcCCCccCCCCCCCccceeeeEEEeCCCCEEcCHHHHHhhcCCCCeEEEeCCEEEEEEEcCCC-CCceEEEEEEEE
Confidence            9999999988777666666666667777777899999888877778899999999999999998642 223899999987


Q ss_pred             CCCCeEEEEeccCCCceEEEcCCCcCCHHHHHHcCCCChhhhhhCCCceeecCcccCccCccCCCceEEeeCCCCccchh
Q 009272          257 ATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSL  336 (538)
Q Consensus       257 ~~g~~~~~~~~~~~a~~VVLaaGai~tp~lLl~SGig~~~~l~~~gi~~~~~~p~vG~~l~dh~~~~~~~~~~~~~~~~~  336 (538)
                      .+|..+++.+...++++||||||+|+||+|||+|||||+.+|+++||+++.|+|.||+||+|||...+.+..+.+.....
T Consensus       265 ~~g~~~~~~~~~~~~~eVILsAGai~sP~lL~~SGIGp~~~L~~~gIpvv~dlP~VG~NL~DHp~~~i~~~~~~~~~~~~  344 (587)
T PLN02785        265 ENGNQHQAFLSNNKGSEIILSAGAIGSPQMLLLSGIGPKKELKKHKIPVVLHNEHVGKGMADNPMNSIFVPSKAPVEQSL  344 (587)
T ss_pred             CCCceEEEEeecccCceEEecccccCCHHHHHHcCCCCHHHHHHcCCCeeecCCCcccchhhCcccceEEEeCCCchhhh
Confidence            66765544322124689999999999999999999999999999999999999999999999999888887665543222


Q ss_pred             hHhhccccccccccccCCCC------------CC----------CCC--CC-------------CCCccceeeEeeecCc
Q 009272          337 IQVVGITQFGSYIEGASGVN------------FA----------GGS--PS-------------PRPYRGGFIFEKIIGP  379 (538)
Q Consensus       337 ~~~~~~~~~~~~~~~~~g~~------------~~----------~~~--~~-------------~~~~~~~~~~~~~~~p  379 (538)
                      .+..+....+.|.+..+++.            +.          +..  ..             ...+...+++..++.|
T Consensus       345 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~P  424 (587)
T PLN02785        345 IQTVGITKMGVYIEASSGFGQSPDSIHCHHGIMSAEIGQLSTIPPKQRTPEAIQAYIHRKKNLPHEAFNGGFILEKIAGP  424 (587)
T ss_pred             HhhhhhhccccceecccccccCchhhhhhccccccccccccccCcccccchhhhhhccCcccccccccccceEEEEecCC
Confidence            33222222222221111100            00          000  00             0011112445677899


Q ss_pred             CcceEEEecCCCCCCCCeeecCCCCCHHHHHHHHHHHHHHHHHHcCccccccccccc-hhHHhhhhccCCCCCCCCCCCC
Q 009272          380 VSTGHLELRTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNM-SVETLLNMTASMPLNLLPKHSN  458 (538)
Q Consensus       380 ~s~g~v~l~~~d~~~~p~i~~~~~~~~~D~~~~~~~~~~~~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~p~~~~  458 (538)
                      .|||+|+|.++||.+.|.|+++|+.++.|++.+.++++.+++++++.+++.+...+. +.+++.......+.+..|...+
T Consensus       425 ~SrG~V~L~ssdp~~~P~i~~ny~~~p~Dl~~~~~g~r~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~  504 (587)
T PLN02785        425 ISTGHLSLINTNVDDNPSVTFNYFKHPQDLQRCVYGIRTIEKIVKTNHFTNFTQCDKQTMEKVLNMSVKANINLIPKHTN  504 (587)
T ss_pred             CcceEEEecCCCCCcCCccccccCCCHHHHHHHHHHHHHHHHHHcChhhhhhccccccccccccccccccccccCCCCCC
Confidence            999999999999999999999999999999999999999999999988776642211 1111122111112223344456


Q ss_pred             CHHHHHHHHHhccCCcccccccccCCCccCCCCcEeccCCceEEecccCCCCCCCchHHHHHHHHHHHHHHHHHhhhhc
Q 009272          459 TSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  537 (538)
Q Consensus       459 ~~~~~~~~~~~~~~~~~H~~Gt~~mG~VVD~~~rv~g~~nL~V~DaSv~P~~~~~NP~~Ti~ala~r~a~~i~~~~~~~  537 (538)
                      +++++++|+|+...+.||++|||+||+|||+++||||++||||||+|+||..|++||++|+||+|+|+|++|+++++.+
T Consensus       505 ~d~~l~~~ir~~~~t~~H~~GTc~MG~VVD~~lrV~GV~~LRVvDaSi~P~~p~~np~atv~miaer~A~~Il~~~~~~  583 (587)
T PLN02785        505 DTKSLEQFCKDTVITIWHYHGGCHVGKVVDQNYKVLGVSRLRVIDGSTFDESPGTNPQATVMMMGRYMGVKILRERLGR  583 (587)
T ss_pred             CHHHHHHHHHHhcccccCCcccccCCCeECCCCeEeccCCeEEeecccCCCCCCCccHHHHHHHHHHHHHHHHHHhhhh
Confidence            7889999999999999999999999999999999999999999999999999999999999999999999999987653



>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 1e-108
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 1e-108
3red_A521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 1e-104
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 5e-19
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 5e-19
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 1e-18
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 7e-16
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 6e-12
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 1e-10
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 2e-08
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 3e-10
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 5e-08
1naa_A541 Cellobiose Dehydrogenase Flavoprotein Fragment In C 2e-05
1kdg_A546 Crystal Structure Of The Flavin Domain Of Cellobios 2e-05
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure

Iteration: 1

Score = 390 bits (1002), Expect = e-108, Method: Compositional matrix adjust. Identities = 219/529 (41%), Positives = 302/529 (57%), Gaps = 25/529 (4%) Query: 21 HDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSP 80 HDF SF +AT + YDY+++GGGT+GCPLAA+LS+ VL+LERG P Sbjct: 7 HDFSYL------SFAYDATDLELEGSYDYVIVGGGTSGCPLAATLSEKYKVLVLERGSLP 60 Query: 81 YGNPNITNSGSFSAELA-DLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEP- 138 PN+ + F L + +P +RF+SEDG+ + R RVLGG + INAG Y RA Sbjct: 61 TAYPNVLTADGFVYNLQQEDDGKTPVERFVSEDGIDNVRGRVLGGTSIINAGVYARANTS 120 Query: 139 -YYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYG 197 Y A WD LVN++Y+WVE +V++P Q WQS + +E GV P +GF+ DH G Sbjct: 121 IYSASGVDWDMDLVNQTYEWVEDTIVYKPNSQSWQSVTKTAFLEAGVHPNHGFSLDHEEG 180 Query: 198 TKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDA 257 T+I G+ D RH A +LL N + L V +HASV KI+F N A GV++RD+ Sbjct: 181 TRITGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVEKIIFSNAPGL--TATGVIYRDS 238 Query: 258 TDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMS 317 H A++R+ K E+IVSAG +G+PQLL+LSGVGP +L + NI VVL P VGQ + Sbjct: 239 NGTPHQAFVRS--KGEVIVSAGTIGTPQLLLLSGVGPESYLSSLNIPVVLSHPYVGQFLH 296 Query: 318 DNPMNAIFVPSPVPVEVSLIQVVGITQ------FGSYIEGASGVNFAXXXXXXXXXXXXF 371 DNP N I + P P+E +++ V+GI+ F S F Sbjct: 297 DNPRNFINILPPNPIEPTIVTVLGISNDFYQCSFSSLPFTTPPFGFFPSSSYPLPNSTFA 356 Query: 372 IF-EKIIGPVSTGHLELR-TRNPNDTPSVTFNYFKEPEDLQRCVQGXXXXXXXXXXXXXX 429 F K+ GP+S G L L+ + N +P+V FNY+ DL CV G Sbjct: 357 HFASKVAGPLSYGSLTLKSSSNVRVSPNVKFNYYSNLTDLSHCVSGMKKIGELLSTDALK 416 Query: 430 XXXYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDH 489 +++ N+ +P LPK + E FCR++V + WHYHGGC VGKV+D Sbjct: 417 PYKVEDLPGVEGFNILG-IP---LPKDQTDDAAFETFCRESVASYWHYHGGCLVGKVLDG 472 Query: 490 DYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN 538 D++V G++ALRVVDGSTF Y+P ++PQ +MLGRY+G++IL ER AS+ Sbjct: 473 DFRVTGINALRVVDGSTFPYTPASHPQGFYLMLGRYVGIKILQERSASD 521
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 Back     alignment and structure
>pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query538
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 0.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 2e-66
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 2e-64
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 2e-64
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 1e-62
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 2e-59
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-58
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 2e-50
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 9e-31
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 1e-21
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-12
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 1e-04
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 1e-06
3atr_A453 Conserved archaeal protein; saturating double bond 9e-06
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-05
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 4e-05
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 5e-05
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 7e-05
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 1e-04
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 1e-04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 4e-04
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 5e-04
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 5e-04
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
 Score =  582 bits (1504), Expect = 0.0
 Identities = 217/528 (41%), Positives = 309/528 (58%), Gaps = 23/528 (4%)

Query: 24  CACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGN 83
            +       SF  +AT  +    YDY+++GGGT+GCPLAA+LS+   VL+LERG  P   
Sbjct: 4   TSDHDFSYLSFAYDATDLELEGSYDYVIVGGGTSGCPLAATLSEKYKVLVLERGSLPTAY 63

Query: 84  PNITNSGSFSAELA-DLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEP--YY 140
           PN+  +  F   L  +    +P +RF+SEDG+ + R RVLGG + INAG Y RA    Y 
Sbjct: 64  PNVLTADGFVYNLQQEDDGKTPVERFVSEDGIDNVRGRVLGGTSIINAGVYARANTSIYS 123

Query: 141 AREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKI 200
           A    WD  LVN++Y+WVE  +V++P  Q WQS  +   +E GV P +GF+ DH  GT+I
Sbjct: 124 ASGVDWDMDLVNQTYEWVEDTIVYKPNSQSWQSVTKTAFLEAGVHPNHGFSLDHEEGTRI 183

Query: 201 GGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDA 260
            G+  D    RH A +LL   N + L V +HASV KI+F N       A GV++RD+   
Sbjct: 184 TGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVEKIIFSNAPGLT--ATGVIYRDSNGT 241

Query: 261 EHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNP 320
            H A++R   K E+IVSAG +G+PQLL+LSGVGP  +L + NI VVL  P VGQ + DNP
Sbjct: 242 PHQAFVR--SKGEVIVSAGTIGTPQLLLLSGVGPESYLSSLNIPVVLSHPYVGQFLHDNP 299

Query: 321 MNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASG--------VNFAGGSPSPRPY-RGGF 371
            N I +  P P+E +++ V+GI+    + + +            F   S  P P      
Sbjct: 300 RNFINILPPNPIEPTIVTVLGIS--NDFYQCSFSSLPFTTPPFGFFPSSSYPLPNSTFAH 357

Query: 372 IFEKIIGPVSTGHLELRTR-NPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSK 430
              K+ GP+S G L L++  N   +P+V FNY+    DL  CV G+  I +++ + +   
Sbjct: 358 FASKVAGPLSYGSLTLKSSSNVRVSPNVKFNYYSNLTDLSHCVSGMKKIGELLSTDALKP 417

Query: 431 FKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHD 490
           +K +++      N+        LPK      + E FCR++V + WHYHGGC VGKV+D D
Sbjct: 418 YKVEDLPGVEGFNILG----IPLPKDQTDDAAFETFCRESVASYWHYHGGCLVGKVLDGD 473

Query: 491 YKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLASN 538
           ++V G++ALRVVDGSTF Y+P ++PQ   +MLGRY+G++IL ER AS+
Sbjct: 474 FRVTGINALRVVDGSTFPYTPASHPQGFYLMLGRYVGIKILQERSASD 521


>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query538
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.55
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.44
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.44
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.38
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.33
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.28
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.26
3dme_A369 Conserved exported protein; structural genomics, P 99.25
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.23
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.23
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.2
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.18
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.18
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.16
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.15
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.14
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.12
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.09
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.06
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.05
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.03
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.02
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.01
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.01
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.0
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.0
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.99
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.98
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.91
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.9
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.9
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.87
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.87
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.86
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.85
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.85
3atr_A453 Conserved archaeal protein; saturating double bond 98.81
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.77
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.74
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.74
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.7
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.64
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.62
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.61
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.6
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.58
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.58
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.57
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.56
2cul_A232 Glucose-inhibited division protein A-related PROT 98.56
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.54
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.51
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.49
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.48
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.47
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.47
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.43
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.43
2bry_A497 NEDD9 interacting protein with calponin homology a 98.42
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.41
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.4
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.38
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.36
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.36
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.33
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.33
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.33
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.31
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.31
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.31
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.31
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.3
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.3
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.3
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.29
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.29
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.28
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.27
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.27
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.25
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.24
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.24
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.19
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.18
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.18
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.13
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.12
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.12
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.1
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.09
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.08
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.02
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.96
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.95
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.94
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.92
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.91
4dna_A463 Probable glutathione reductase; structural genomic 97.91
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.89
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.89
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.85
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.82
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.82
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.82
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.82
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.81
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.81
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.8
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.78
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.77
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.76
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.76
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.75
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.73
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.73
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.72
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.72
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.71
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.71
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.71
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.69
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.67
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.66
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.66
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.66
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.65
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.65
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.65
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.65
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.63
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.62
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.61
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.61
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.59
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.56
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.55
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.54
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.52
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.52
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.51
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.51
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.51
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.5
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.49
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.49
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.49
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.48
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.46
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.46
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.44
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.41
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.41
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.36
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.35
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.29
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.27
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.26
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.21
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.2
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.19
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.18
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.17
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.16
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.14
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.1
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.07
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.05
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.02
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.02
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.02
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.97
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.93
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.91
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.91
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.86
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.85
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.8
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.79
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.78
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.78
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.76
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.76
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.71
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.68
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.66
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 96.64
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.61
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.56
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.54
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.52
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.52
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.52
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.45
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.39
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.39
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.39
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.38
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.37
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.33
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.31
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.21
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.19
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.15
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.11
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.03
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.02
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.02
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.01
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 95.97
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 95.94
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 95.94
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 95.92
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.88
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.87
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.86
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.85
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 95.8
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.65
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.65
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 95.64
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 95.64
1ojt_A482 Surface protein; redox-active center, glycolysis, 95.6
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.59
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.57
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 95.55
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 95.53
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.47
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.41
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.4
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.3
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 95.24
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 95.16
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 95.07
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 95.04
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 95.03
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.03
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.98
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 94.78
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 94.66
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 94.58
4dna_A463 Probable glutathione reductase; structural genomic 94.36
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 94.32
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 93.69
1fec_A490 Trypanothione reductase; redox-active center, oxid 93.68
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 93.49
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 92.86
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 92.24
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 92.06
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 91.85
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 91.23
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.97
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.79
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.54
1lss_A140 TRK system potassium uptake protein TRKA homolog; 90.43
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 90.36
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 90.34
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 89.55
1id1_A153 Putative potassium channel protein; RCK domain, E. 88.73
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 87.51
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 86.84
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 86.81
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 86.67
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 86.33
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 86.07
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 85.96
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 85.74
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 85.66
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 85.38
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 85.09
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 85.06
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 85.05
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 84.97
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 84.89
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 84.53
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.45
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 84.42
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 84.28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 83.94
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 83.48
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 82.79
4g65_A461 TRK system potassium uptake protein TRKA; structur 82.63
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 82.6
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 82.16
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 82.07
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 81.8
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 81.5
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 81.39
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 81.34
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 81.21
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 80.98
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 80.82
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 80.71
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 80.68
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 80.4
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 80.24
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
Probab=100.00  E-value=4.1e-77  Score=635.04  Aligned_cols=497  Identities=43%  Similarity=0.783  Sum_probs=381.8

Q ss_pred             CCcccccccccCCCCCCccEEEECCCCchHHHhhhhcCCCeEEEEeccCCCCCCCCcccchhhhhhhcCCC-CCCCCccc
Q 009272           30 PNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSPYGNPNITNSGSFSAELADLS-PTSPSQRF  108 (538)
Q Consensus        30 ~~~~~~~~~~~~~~~~~~DvIIVGsG~aG~~~A~~La~g~~VlvlE~G~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  108 (538)
                      ..++|+.++....+..+|||||||||++|+++|.+|++|.+|||||+|+.....+....+..|...+.++. |.+.+|.+
T Consensus        10 ~~~~~~~~~~~~~~~~~yD~IIVGsG~AG~v~A~rLseg~~VlvLEaG~~~~~~~~~~~~~~~~~~~~~~~~~~t~~q~~   89 (536)
T 1ju2_A           10 SYLSFAYDATDLELEGSYDYVIVGGGTSGCPLAATLSEKYKVLVLERGSLPTAYPNVLTADGFVYNLQQEDDGKTPVERF   89 (536)
T ss_dssp             GGGGGEEEGGGSCSEEEEEEEEECCSTTHHHHHHHHTTTSCEEEECSSBCGGGSGGGGBGGGHHHHHHSCCCSSSSEEEE
T ss_pred             ccCccccCcccccccCcccEEEECccHHHHHHHHHHhcCCcEEEEecCCCcCCCcceecchhHhhhccCCCcCcCCCccc
Confidence            34567777766656678999999999999999999999889999999987533344444545554443222 45666766


Q ss_pred             cCCCceeecCcccccchhhhcccccccCChhhhhcCC--CChhhhhhhhhhhccccccCCCCchhHHHHHHHHHHcCCCC
Q 009272          109 ISEDGVVSTRARVLGGGTCINAGFYTRAEPYYAREAG--WDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLP  186 (538)
Q Consensus       109 ~~~~~~~~~~g~~lGG~s~~n~~~~~r~~~~~~~~~g--w~~~~l~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~g~~~  186 (538)
                      ..++.+.+.+|++|||+|.+|++.+.|+.+++++..|  |+++++.+||+++|+.+.+.+...++...+.+++.++|+.+
T Consensus        90 ~~~~~~~~~rg~~lGGsS~in~~~~~R~~~~d~~~~G~~W~~~~~~p~~~~~e~~~~~~~~~~~~~~~~~~a~~~~G~~~  169 (536)
T 1ju2_A           90 VSEDGIDNVRGRVLGGTSIINAGVYARANTSIYSASGVDWDMDLVNQTYEWVEDTIVYKPNSQSWQSVTKTAFLEAGVHP  169 (536)
T ss_dssp             ECTTSCEEEEECBTTGGGGTSCCEECBCCTTSSTTSSSCCCHHHHHHHHHHHHHHHCBCCCCCHHHHHHHHHHHHTTCCC
T ss_pred             cCCCcceeecceeccccccccCeEEEeCCHHHHhhccCCCChHHHHHHHHhhhcccCCCCCCCcHHHHHHHHHHHcCCCC
Confidence            7778888999999999999999999999998777778  99999999999999988777777788888999999999876


Q ss_pred             CCCCccCCCCceeeeeeeeCCCCccccHHHHHhhcCCCCeEEEeccEEEEEEecCCCCCCCeEEEEEEEeCCCCeEEEEe
Q 009272          187 YNGFTYDHLYGTKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYL  266 (538)
Q Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~g~r~~~~~~l~~~~~~~~~i~~~~~V~~I~~~~~~~~~~~~~gV~~~~~~g~~~~~~~  266 (538)
                      .++...+...++..+...++.+|.|+++..|++.+++.|++|++++.|++|++++++  ..+++||++.+.+|+.+++.+
T Consensus       170 ~~~~~~~~~~g~~~g~~~~~~~g~r~s~~~~~~~~~~~~~~v~~~~~v~~i~~~~~~--~~~~~GV~~~~~~g~~~~~~v  247 (536)
T 1ju2_A          170 NHGFSLDHEEGTRITGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVEKIIFSNAP--GLTATGVIYRDSNGTPHQAFV  247 (536)
T ss_dssp             EEEECCBCCSEEEECEESBCTTSBBCCGGGGGGGSCTTTEEEEESCEEEEEEECCSS--SCBEEEEEEECTTSCEEEEEE
T ss_pred             CCCcccCCCCCceeeeEEECCCCeEecHHHhhhhhcCCCcEEEeCCEEEEEEECCCC--CCEEEEEEEEeCCCceEEEEe
Confidence            554333444455554444457888988766777778899999999999999998631  138999999875676555532


Q ss_pred             ccCCCceEEEcCCCcCCHHHHHHcCCCChhhhhhCCCceeecCcccCccCccCCCceEEeeCCCCccchhhHhhcccccc
Q 009272          267 RNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFG  346 (538)
Q Consensus       267 ~~~~a~~VVLaaGai~tp~lLl~SGig~~~~l~~~gi~~~~~~p~vG~~l~dh~~~~~~~~~~~~~~~~~~~~~~~~~~~  346 (538)
                      +  ++++||||||+++||+||++||||+.++|+++||+++.|+|.||+|||||+...+.+..+.+......+..+...  
T Consensus       248 ~--a~k~VILaaGa~~sp~lL~~SGig~~~~l~~~gi~~~~dlP~VG~NL~DH~~~~~~~~~~~~~~~~~~~~~~~~~--  323 (536)
T 1ju2_A          248 R--SKGEVIVSAGTIGTPQLLLLSGVGPESYLSSLNIPVVLSHPYVGQFLHDNPRNFINILPPNPIEPTIVTVLGISN--  323 (536)
T ss_dssp             E--EEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTEEEECCEEEEEEECCSSCCCCCCCCEEEECS--
T ss_pred             c--cCCEEEEcCcccCCHHHHHHcCCCCHHHHHhcCCceEecCcccccchhcCcceeEEEEeCCCcccccchhhhHHH--
Confidence            2  469999999999999999999999999999999999999999999999999887777655443211111111100  


Q ss_pred             ccccccCCC--------C-CCCCCCCCCCccceeeEeeecCcCcceEEEe-cCCCCCCCCeeecCCCCCHHHHHHHHHHH
Q 009272          347 SYIEGASGV--------N-FAGGSPSPRPYRGGFIFEKIIGPVSTGHLEL-RTRNPNDTPSVTFNYFKEPEDLQRCVQGI  416 (538)
Q Consensus       347 ~~~~~~~g~--------~-~~~~~~~~~~~~~~~~~~~~~~p~s~g~v~l-~~~d~~~~p~i~~~~~~~~~D~~~~~~~~  416 (538)
                      .|.....|.        . +...........+.++...++.|.|||+|+| +++||.+.|.|+++|+.++.|++.+.+++
T Consensus       324 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~P~SrG~V~L~~s~Dp~~~P~i~~~y~~~~~D~~~~~~~~  403 (536)
T 1ju2_A          324 DFYQCSFSSLPFTTPPFGFFPSSSYPLPNSTFAHFASKVAGPLSYGSLTLKSSSNVRVSPNVKFNYYSNLTDLSHCVSGM  403 (536)
T ss_dssp             SEEEEEEEECCCSSCCBTTBSSSCCCCCSSCEEEEEEEESSCSCCEEEECSCSSCTTSCCEECCCTTCSHHHHHHHHHHH
T ss_pred             HHHHcCCCCCCCChhhheeecCcccCCCCcceEEEeeecCCCCcceEEEeCCCCCcccCceecccccCCccHHHHHHHHH
Confidence            111111110        0 0000000011123455667789999999999 88999999999999999999999999999


Q ss_pred             HHHHHHHcCccccccccccc-hhHHhhhhccCCCCCCCCCCCCCHHHHHHHHHhccCCcccccccccCCCccCCCCcEec
Q 009272          417 STIEKIIESKSFSKFKYDNM-SVETLLNMTASMPLNLLPKHSNTSTSLEQFCRDTVMTIWHYHGGCQVGKVVDHDYKVLG  495 (538)
Q Consensus       417 ~~~~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~H~~Gt~~mG~VVD~~~rv~g  495 (538)
                      +.+++++++.+++.+..... ..+.+....     ...|...++++++++|++....+.+|++|||+||+|||++|||||
T Consensus       404 ~~~~~i~~~~~~~~~~~~~~~~~p~~~~~~-----~~~p~~~~~d~~~~~~ir~~~~t~~H~~GTcrMG~VVD~~lrV~G  478 (536)
T 1ju2_A          404 KKIGELLSTDALKPYKVEDLPGVEGFNILG-----IPLPKDQTDDAAFETFCRESVASYWHYHGGCLVGKVLDGDFRVTG  478 (536)
T ss_dssp             HHHHHHHTSGGGGGGCSSCCSTTCSCCBSS-----SCCCSCTTCHHHHHHHHHHHCEECSCCEESSCBTTTBCTTSBBTT
T ss_pred             HHHHHHHcCccchhhhccccccCCCccccc-----cCCCcccCCHHHHHHHHHhccCccccCcCccCCccEECCCCeEcC
Confidence            99999999988887654321 000000000     002333468899999999999999999999999999999999999


Q ss_pred             cCCceEEecccCCCCCCCchHHHHHHHHHHHHHHHHHhhhhc
Q 009272          496 VDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSERLAS  537 (538)
Q Consensus       496 ~~nL~V~DaSv~P~~~~~NP~~Ti~ala~r~a~~i~~~~~~~  537 (538)
                      ++||||||+||||+.+++||++|+||||+|+|++|+++++.+
T Consensus       479 v~nLrVvDaSv~P~~~~~np~~t~~aiAer~A~~ii~~~~~~  520 (536)
T 1ju2_A          479 INALRVVDGSTFPYTPASHPQGFYLMLGRYVGIKILQERSAS  520 (536)
T ss_dssp             CBTEEECSGGGCSSCSSSSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCeEEeecccCCCCCCcchHHHHHHHHHHHHHHHHHhhhhh
Confidence            999999999999999999999999999999999999887653



>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 538
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 2e-59
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 3e-10
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 6e-42
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 6e-33
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 7e-05
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 3e-30
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 3e-04
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 1e-26
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 3e-07
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 6e-22
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 7e-06
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 4e-19
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-17
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 4e-07
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 9e-07
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-06
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 3e-06
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 4e-06
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 5e-06
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 5e-06
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 6e-06
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 7e-06
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-05
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 2e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 3e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 4e-05
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 1e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-04
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 2e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-04
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 3e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 4e-04
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 6e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 7e-04
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 8e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.001
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.001
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.001
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 0.002
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 0.002
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 0.002
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.003
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Hydroxynitrile lyase
species: Almond (Prunus dulcis) [TaxId: 3755]
 Score =  198 bits (504), Expect = 2e-59
 Identities = 142/337 (42%), Positives = 193/337 (57%), Gaps = 16/337 (4%)

Query: 21  HDFCACQKAPNYSFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQNASVLLLERGDSP 80
           HDF         SF  +AT  +    YDY+++GGGT+GCPLAA+LS+   VL+LERG  P
Sbjct: 7   HDF------SYLSFAYDATDLELEGSYDYVIVGGGTSGCPLAATLSEKYKVLVLERGSLP 60

Query: 81  YGNPNITNSGSFSAELA-DLSPTSPSQRFISEDGVVSTRARVLGGGTCINAGFYTRAEP- 138
              PN+  +  F   L  +    +P +RF+SEDG+ + R RVLGG + INAG Y RA   
Sbjct: 61  TAYPNVLTADGFVYNLQQEDDGKTPVERFVSEDGIDNVRGRVLGGTSIINAGVYARANTS 120

Query: 139 -YYAREAGWDGRLVNESYQWVEKKVVFRPPMQRWQSALRDGLVEVGVLPYNGFTYDHLYG 197
            Y A    WD  LVN++Y+WVE  +V++P  Q WQS  +   +E GV P +GF+ DH  G
Sbjct: 121 IYSASGVDWDMDLVNQTYEWVEDTIVYKPNSQSWQSVTKTAFLEAGVHPNHGFSLDHEEG 180

Query: 198 TKIGGTIIDQNSQRHTAADLLEYANPSGLTVLLHASVHKILFRNKGKARPVAHGVVFRDA 257
           T+I G+  D    RH A +LL   N + L V +HASV KI+F N       A GV++RD+
Sbjct: 181 TRITGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVEKIIFSNAPGLT--ATGVIYRDS 238

Query: 258 TDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLDQPLVGQGMS 317
               H A++R+  K E+IVSAG +G+PQLL+LSGVGP  +L + NI VVL  P VGQ + 
Sbjct: 239 NGTPHQAFVRS--KGEVIVSAGTIGTPQLLLLSGVGPESYLSSLNIPVVLSHPYVGQCLV 296

Query: 318 DNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASG 354
              ++  F    V    +L  V G T   +      G
Sbjct: 297 GKVLDGDF---RVTGINALRVVDGSTFPYTPASHPQG 330


>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query538
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.71
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.67
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.66
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.65
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.51
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.5
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.49
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.48
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.44
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.43
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.4
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.39
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.36
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.34
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 99.28
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.26
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.23
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.21
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.99
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.95
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.9
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.73
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.64
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.63
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.55
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.52
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.5
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.48
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.47
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.46
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.44
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.42
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.41
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.39
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.39
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.36
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.23
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.23
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.18
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.16
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.15
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.14
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.1
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.08
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.08
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.06
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.03
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.01
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.94
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.94
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.92
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.92
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.92
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.89
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.84
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.82
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.8
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.8
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.79
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.77
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.74
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.74
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.7
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.69
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.65
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.63
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.59
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.58
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.54
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.53
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.49
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.44
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.44
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.42
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.17
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.09
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.06
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.65
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.59
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.51
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.43
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.14
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.92
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.78
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.68
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.55
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.14
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 95.04
d2f5va2198 Pyranose 2-oxidase {White-rot fungus (Peniophora s 94.98
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.81
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.78
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.7
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.1
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.75
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.49
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.23
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.39
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.57
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.12
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 89.05
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.79
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.69
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.53
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 87.03
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.02
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 86.83
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 86.62
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.53
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 86.09
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 85.66
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 84.9
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.0
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 81.21
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.74
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 80.58
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]
Probab=100.00  E-value=9.5e-49  Score=399.08  Aligned_cols=331  Identities=27%  Similarity=0.361  Sum_probs=250.9

Q ss_pred             ccccccccCCCCCCccEEEECCCCchHHHhhhhcC-C-CeEEEEeccCCCCCCCC-cccchhhhhhh---cCCCCCCCCc
Q 009272           33 SFMRNATAAKPVSYYDYIVIGGGTAGCPLAASLSQ-N-ASVLLLERGDSPYGNPN-ITNSGSFSAEL---ADLSPTSPSQ  106 (538)
Q Consensus        33 ~~~~~~~~~~~~~~~DvIIVGsG~aG~~~A~~La~-g-~~VlvlE~G~~~~~~~~-~~~~~~~~~~~---~~~~~~~~~~  106 (538)
                      +...++.+.. .+.|||||||||++||++|.||++ + .+|||||+|+....... ...+..+...+   .+|.|.+.++
T Consensus        12 ~~~~~p~~~~-~~tyD~IIVGsG~aG~vlA~rLae~~~~~VLlLEaG~~~~~~~~~~~~p~~~~~~~~~~~dw~~~t~p~   90 (391)
T d1gpea1          12 SLLSDPSKVA-GKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPL   90 (391)
T ss_dssp             GSBCCGGGTT-TCEEEEEEECCSHHHHHHHHHHHTSTTCCEEEEESSCCCTTSCHHHHCGGGTTTTTTSTTBCCEECCCC
T ss_pred             cccCCccccc-CCeeeEEEECcCHHHHHHHHHHHHCCCCeEEEEcCCCCCCCCCceeeCHHHHHHhhCCCcccCceeeec
Confidence            4455555554 356999999999999999999999 6 79999999986433222 22232333222   2455555544


Q ss_pred             cccCCCceeecCcccccchhhhcccccccCChhhhhc-------CCCChhhhhhhhhhhccccccC--------------
Q 009272          107 RFISEDGVVSTRARVLGGGTCINAGFYTRAEPYYARE-------AGWDGRLVNESYQWVEKKVVFR--------------  165 (538)
Q Consensus       107 ~~~~~~~~~~~~g~~lGG~s~~n~~~~~r~~~~~~~~-------~gw~~~~l~~~~~~~e~~~~~~--------------  165 (538)
                        ..++.+.+.+|+++||+|.+|++++.|+.+.+++.       .+|.++++.+||++.|......              
T Consensus        91 --~~~r~~~~~~G~~lGGsS~in~~~~~rg~~~d~~~w~~~~G~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~~~~~~~  168 (391)
T d1gpea1          91 --INNRTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATC  168 (391)
T ss_dssp             --TTSCCCEECCBCSTTGGGGTSCCEECCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHTEEECCCCHHHHHHTCCCCGGG
T ss_pred             --CCCcEeeeceeeccCcccceeeeEEeeccccccccccccCCCCccccchhHHHHHHhhhccCCcchhcccccCccccc
Confidence              56788899999999999999999999999854432       5799999999999998653210              


Q ss_pred             ---------------CCCchhHHHHHHHHHHcCCCCCCCCccCCCCceeeeeeeeCCCCccccHHH--HHhhcCCCCeEE
Q 009272          166 ---------------PPMQRWQSALRDGLVEVGVLPYNGFTYDHLYGTKIGGTIIDQNSQRHTAAD--LLEYANPSGLTV  228 (538)
Q Consensus       166 ---------------~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~g~r~~~~~--~l~~~~~~~~~i  228 (538)
                                     ....+..+.+.+++.++|+.....+......++.........++.|.+...  +.+...+.|++|
T Consensus       169 ~g~~~~~~~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~~~~~g~~~~~~~~~~~~~~~~~r~s~a~~~~~p~~~r~nl~i  248 (391)
T d1gpea1         169 HGTNGTVQSGARDNGQPWSPIMKALMNTVSALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPNYQRSNLEI  248 (391)
T ss_dssp             CCBSSSEEEBCCCCSSCBCTHHHHHHHHHHHTTCCBSCCTTSSCCCEEECCEESBCTTCCBCCHHHHHTTTTTTCTTEEE
T ss_pred             cCCCCcccccccccccccCHHHHHHHHHHHhcCCceeeccccCcccccccccceeeccccccchhhhccCccccchhhhh
Confidence                           112345677888889999864432221111111111111223455655543  445778899999


Q ss_pred             EeccEEEEEEecCCCCCCCeEEEEEEEeCCCCeEEEEeccCCCceEEEcCCCcCCHHHHHHcCCCChhhhhhCCCceeec
Q 009272          229 LLHASVHKILFRNKGKARPVAHGVVFRDATDAEHIAYLRNGPKNEIIVSAGALGSPQLLMLSGVGPADHLKAHNITVVLD  308 (538)
Q Consensus       229 ~~~~~V~~I~~~~~~~~~~~~~gV~~~~~~g~~~~~~~~~~~a~~VVLaaGai~tp~lLl~SGig~~~~l~~~gi~~~~~  308 (538)
                      ++++.|+||+++++. ...+++||++.+.++..+++.    ++++||||||+|+||+|||+|||||+++|+++||+++.|
T Consensus       249 ~t~a~V~rIl~~~~~-~g~ra~GV~~~~~~g~~~~v~----A~keVILaAGai~SP~LLl~SGIGp~~~L~~~gI~~v~d  323 (391)
T d1gpea1         249 LTGQMVGKVLFKQTA-SGPQAVGVNFGTNKAVNFDVF----AKHEVLLAAGSAISPLILEYSGIGLKSVLDQANVTQLLD  323 (391)
T ss_dssp             EESCEEEEEEEEEET-TEEEEEEEEEEEETTEEEEEE----EEEEEEECSCTTTHHHHHHHTTEECHHHHHHTTCCCSEE
T ss_pred             hccceeeEEeeeCCC-CCceEEeeEEecCCCeEEEEE----eCCEEEEecchhcchHHHHhcCCCcHHHHHHCCCCEEEE
Confidence            999999999987542 123899999987677666665    457799999999999999999999999999999999999


Q ss_pred             Cc-ccCccCccCCCceEEeeCCCCccchhhHhhccccccccccccCCCCCCCCCCCCCCccceeeEeeecCcCcceEEEe
Q 009272          309 QP-LVGQGMSDNPMNAIFVPSPVPVEVSLIQVVGITQFGSYIEGASGVNFAGGSPSPRPYRGGFIFEKIIGPVSTGHLEL  387 (538)
Q Consensus       309 ~p-~vG~~l~dh~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~p~s~g~v~l  387 (538)
                      +| .||+||+||+                                                                   
T Consensus       324 lP~Gvg~nl~dh~-------------------------------------------------------------------  336 (391)
T d1gpea1         324 LPVGICSMMSREL-------------------------------------------------------------------  336 (391)
T ss_dssp             CCTTCTCBSCGGG-------------------------------------------------------------------
T ss_pred             CCcccccccccCc-------------------------------------------------------------------
Confidence            99 6999999983                                                                   


Q ss_pred             cCCCCCCCCeeecCCCCCHHHHHHHHHHHHHHHHHHcCccccccccccchhHHhhhhccCCCCCCCCCCCCCHHHHHHHH
Q 009272          388 RTRNPNDTPSVTFNYFKEPEDLQRCVQGISTIEKIIESKSFSKFKYDNMSVETLLNMTASMPLNLLPKHSNTSTSLEQFC  467 (538)
Q Consensus       388 ~~~d~~~~p~i~~~~~~~~~D~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~  467 (538)
                                                                     .                                
T Consensus       337 -----------------------------------------------~--------------------------------  337 (391)
T d1gpea1         337 -----------------------------------------------G--------------------------------  337 (391)
T ss_dssp             -----------------------------------------------T--------------------------------
T ss_pred             -----------------------------------------------c--------------------------------
Confidence                                                           1                                


Q ss_pred             HhccCCcccccccccCCCccCCCCcEeccCCceEEecccCCCCCCCchHHHHHHHHHHHHHHHHHhh
Q 009272          468 RDTVMTIWHYHGGCQVGKVVDHDYKVLGVDALRVVDGSTFYYSPGTNPQATVMMLGRYMGVRILSER  534 (538)
Q Consensus       468 ~~~~~~~~H~~Gt~~mG~VVD~~~rv~g~~nL~V~DaSv~P~~~~~NP~~Ti~ala~r~a~~i~~~~  534 (538)
                                       .|||.++||+|++||+|+|+|++|...++|++.+.+++|+++||.|+++.
T Consensus       338 -----------------~~v~~~~~v~~~~~l~~~~~s~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  387 (391)
T d1gpea1         338 -----------------GVVDATAKVYGTQGLRVIDGSIPPTQVSSHVMTIFYGMALKVADAILDDY  387 (391)
T ss_dssp             -----------------CSBCTTCBBTTCBSEEECSTTCCSSCCSSCSHHHHHHHHHHHHHHHHHHH
T ss_pred             -----------------ceeeeeeeecCCCChhhhccccCccccccchhhhhhhhHhhhhHHHHHHh
Confidence                             46889999999999999999999999999999999999999999888663



>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure