Citrus Sinensis ID: 009511

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530---

MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVTIL

cccccccccccccccccccHHHHEHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccEEEHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccccEEEccHHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHcccccHHHHHccccccEEEEccccHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHccccEEEEEcHHHHHHHHHcccHHHHccEEEEEcccccccEEEEEEc

cccccccccccccccccccEEEEHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHccccccccHHHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHHccccHEEEEcccHcHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHccccHHcccccccccEEEEEEcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHccccEEEEEEcccccEccccHHHHHHHHHHHHHHHHHHHcccEEEEEHHHccHHHHccccEEEEEccccccEEEEEcccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHccHHHHHHEEEEcccHHccccEEEEEc

maskpgiltewpwkplgsykhvvlapwamhsiycfigsrkserdyaYFLIFPFLLLRMLHDQIWISLSRYRTAKrnnrivdkaiefdqvdrernwddqiVFNGLIFYIVRMlippsysnlrfwrsdGVILTILVHMGPVEFLYYWFHRALHHHYLysryhshhhssvvtepitsviHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFmnnmghcnfefipmwlftvfpplkflmytpsyhslhhtqfrtnyslfmpiydyiygtidrssdsVYEKSLkrsgeeeeesaddvdvvhlthlttpesiYHLRIGFaslaskphrytYTLSQWYLQLLWPFTASCSVLVSWIYGrtfvsesntldklklqtwVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLlnqgeelnrngeiylerqpnklkikvVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVTIL

maskpgiltewpwkplGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSryrtakrnnrivdkaiefdqvdrernwdDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRsgeeeeesaddvdvVHLTHLttpesiyhLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVsesntldklklqtwvVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVeaqhnlvlstsyaahktVTMVTIL

MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFhralhhhylysryhshhhssVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGeeeeeSADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGtvtankvanavaSSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVTIL

******ILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTID************************VDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVT**

***KPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSD******************DDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDY**********AQHNLVLSTSYAAHKTVTMVTIL

MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSS*********************VDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVTIL

*****GILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTVTMVTIL

ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		533	2.2.26 [Sep-21-2011]
F4HVY0		625	Protein ECERIFERUM 1 OS=A	yes	no	0.947	0.808	0.643	0.0
F4HVX7		627	Protein CER1-like 1 OS=Ar	no	no	0.943	0.802	0.580	1e-161
F4IR05		613	Protein CER1-like 2 OS=Ar	no	no	0.930	0.809	0.569	1e-156
Q8H1Z0		632	Protein ECERIFERUM 3 OS=A	no	no	0.947	0.799	0.345	1e-84
Q8J207		356	C-5 sterol desaturase OS=	N/A	no	0.264	0.396	0.266	4e-08
Q6ZNB7		445	Alkylglycerol monooxygena	yes	no	0.232	0.278	0.300	3e-06
Q7SBB6		344	Probable C-5 sterol desat	N/A	no	0.264	0.409	0.24	2e-05
Q8BS35		447	Alkylglycerol monooxygena	yes	no	0.369	0.440	0.246	6e-05
Q5M8F9		446	Alkylglycerol monooxygena	yes	no	0.234	0.280	0.263	7e-05
Q96IV6		333	Uncharacterized protein C	no	no	0.348	0.558	0.213	9e-05

>sp\|F4HVY0\|CER1_ARATH Protein ECERIFERUM 1 OS=Arabidopsis thaliana GN=CER1 PE=1 SV=1	Back alignment and function desciption

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/522 (64%), Positives = 422/522 (80%), Gaps = 17/522 (3%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MA+KPG+LT+WPW PLGS+K++V+APWA+HS Y F+     +RD  YFL+FPFLL R+LH
Sbjct: 1   MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSRY T+    RIVDK I+F+QVDRE NWDDQI+FNG++FYI   L+P +   L
Sbjct: 61  NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEA-KQL 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
            +WR+DGV++  L+H GPVEFLYYW H+ALHHH+LYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PWWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YF+LFAIPL+TT++ K ASI SF GYIIY+DFMNNMGHCNFE IP  LF +FPPLK
Sbjct: 180 EHIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           FL YTPSYHSLHHTQFRTNYSLFMP+YDYIYGT+D S+D++YEK+L+R         D V
Sbjct: 240 FLCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGD-------DIV 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTPESIYHLRIG AS AS P  Y     +W+++LLWPFT S S++ +  Y R
Sbjct: 293 DVVHLTHLTTPESIYHLRIGLASFASYPFAY-----RWFMRLLWPFT-SLSMIFTLFYAR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
            FV+E N+ +KL LQ+WV+PRY +QY L WR+EAIN++IE+AILEAD KGVKV+SLGL+N
Sbjct: 347 LFVAERNSFNKLNLQSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELNRNGE+Y+   P+ +K+++VDGS LAAAVV+NS+PK T  V++ G +T  KVA  
Sbjct: 407 QGEELNRNGEVYIHNHPD-MKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLT--KVAYT 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYA 522
           +AS+LCQ G++V+T+  D+YEK++  +P E + +LV  TS A
Sbjct: 464 IASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVYLTSEA 505

Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. Core component of a very-long-chain alkane synthesis complex. Involved in epicuticular wax biosynthesis and pollen fertility.
Arabidopsis thaliana (taxid: 3702)

>sp\|F4HVX7\|CERL1_ARATH Protein CER1-like 1 OS=Arabidopsis thaliana GN=At1g02190 PE=2 SV=1	Back alignment and function description

>sp\|F4IR05\|CERL2_ARATH Protein CER1-like 2 OS=Arabidopsis thaliana GN=At2g37700 PE=2 SV=1	Back alignment and function description

>sp\|Q8H1Z0\|CER3_ARATH Protein ECERIFERUM 3 OS=Arabidopsis thaliana GN=CER3 PE=1 SV=1	Back alignment and function description

>sp\|Q8J207\|ERG3_LEPMC C-5 sterol desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1	Back alignment and function description

>sp\|Q6ZNB7\|ALKMO_HUMAN Alkylglycerol monooxygenase OS=Homo sapiens GN=AGMO PE=1 SV=1	Back alignment and function description

>sp\|Q7SBB6\|ERG3_NEUCR Probable C-5 sterol desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1	Back alignment and function description

>sp\|Q8BS35\|ALKMO_MOUSE Alkylglycerol monooxygenase OS=Mus musculus GN=Agmo PE=2 SV=1	Back alignment and function description

>sp\|Q5M8F9\|ALKMO_XENTR Alkylglycerol monooxygenase OS=Xenopus tropicalis GN=agmo PE=2 SV=1	Back alignment and function description

>sp\|Q96IV6\|CE004_HUMAN Uncharacterized protein C5orf4 OS=Homo sapiens GN=C5orf4 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		533
359489254		619	PREDICTED: protein WAX2-like [Vitis vini	0.947	0.815	0.672	0.0
297734710		631	unnamed protein product [Vitis vinifera]	0.947	0.800	0.668	0.0
359489252		619	PREDICTED: protein WAX2-like [Vitis vini	0.947	0.815	0.668	0.0
297734709		2763	unnamed protein product [Vitis vinifera]	0.947	0.182	0.660	0.0
359489250		619	PREDICTED: protein WAX2-like [Vitis vini	0.947	0.815	0.660	0.0
356504497		627	PREDICTED: protein WAX2-like [Glycine ma	0.949	0.807	0.659	0.0
356520717		624	PREDICTED: protein WAX2-like [Glycine ma	0.949	0.810	0.655	0.0
359489248		619	PREDICTED: protein WAX2-like [Vitis vini	0.947	0.815	0.659	0.0
225454042		620	PREDICTED: protein WAX2 [Vitis vinifera]	0.947	0.814	0.652	0.0
1209703		625	maize gl1 homolog [Arabidopsis thaliana]	0.947	0.808	0.641	0.0

>gi\|359489254\|ref\|XP_002265189.2\| PREDICTED: protein WAX2-like [Vitis vinifera] gi\|297734711\|emb\|CBI16762.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/522 (67%), Positives = 426/522 (81%), Gaps = 17/522 (3%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MASKPGILT+WPW PLG++K+VVLAPWA+H+IY F+   + ERD ++FLIFPFLL RMLH
Sbjct: 1   MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDISHFLIFPFLLWRMLH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSR+RTAK NNRIVDK IEF+QVDRERNWDDQI+FNG+IFYI    +P   +++
Sbjct: 61  NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVPGG-THM 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
            FWR+DGV++TIL+HMGPVEFLYYWFHRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PFWRADGVVITILLHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YFLLF+IPL+T +     SI SFVGYI Y+DFMNNMGHCNFE +P WLF++FP LK
Sbjct: 180 EHIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           +LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D+SSD +YEKSL R     EES    
Sbjct: 240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTVDKSSDVLYEKSLTRP----EESP--- 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTP+SIYH+R+GFAS+ASKP+     +S+WYL+L+WP T+   +L+ WI  R
Sbjct: 293 DVVHLTHLTTPDSIYHMRLGFASVASKPY-----ISKWYLRLMWPLTSWYMMLI-WICSR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
           TFV E N  +KLKLQTWV+P+Y +QY L  + E INSLIEEAIL+AD +GVKV+SLG+LN
Sbjct: 347 TFVLERNHFNKLKLQTWVIPKYRIQYFLKGQNEPINSLIEEAILDADQRGVKVLSLGILN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELN  GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T  VL RG ++  KVA  
Sbjct: 407 QGEELNIYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLS--KVAYF 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYA 522
            A +LCQ GI+VAT  +++Y  + +++  +    L LS +YA
Sbjct: 464 TALALCQKGIQVATFHEEEYANINMKLNTKLGGKLALSKNYA 505

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297734710\|emb\|CBI16761.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359489252\|ref\|XP_002263787.2\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297734709\|emb\|CBI16760.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359489250\|ref\|XP_003633900.1\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356504497\|ref\|XP_003521032.1\| PREDICTED: protein WAX2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356520717\|ref\|XP_003529007.1\| PREDICTED: protein WAX2-like [Glycine max]	Back alignment and taxonomy information

>gi\|359489248\|ref\|XP_002265685.2\| PREDICTED: protein WAX2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225454042\|ref\|XP_002262785.1\| PREDICTED: protein WAX2 [Vitis vinifera] gi\|297744850\|emb\|CBI38118.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|1209703\|gb\|AAB87721.1\| maize gl1 homolog [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		533
UNIPROTKB\|Q7XDI3		621	Os10g0471100 "CER1 protein, pu	0.953	0.818	0.521	5.7e-146
UNIPROTKB\|Q109K1		595	LOC_Os10g33250 "CER1 protein,	0.628	0.563	0.538	2.1e-141
TAIR\|locus:2204813		627	AT1G02190 "AT1G02190" [Arabido	0.943	0.802	0.522	1.1e-140
TAIR\|locus:2040666		613	AT2G37700 "AT2G37700" [Arabido	0.930	0.809	0.513	1.2e-134
TAIR\|locus:2174368		632	CER3 "ECERIFERUM 3" [Arabidops	0.943	0.795	0.321	7e-70
UNIPROTKB\|Q6ETL8		628	P0544B02.10 "Os02g0178800 prot	0.938	0.796	0.298	4.6e-57

UNIPROTKB\|Q7XDI3 Os10g0471100 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

 Score = 1426 (507.0 bits), Expect = 5.7e-146, P = 5.7e-146
 Identities = 273/523 (52%), Positives = 349/523 (66%)

Query:     1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
             MA+ PG+ TEWPWK LGS+K+V+LAPW  H  Y        E D  Y  I P LLLRMLH
Sbjct:     1 MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH 60

Query:    61 DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
             +Q WI++SR + A+   +IV + IEFDQVDRERNWDDQI+ +G++ Y+  + +P    +L
Sbjct:    61 NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGG-QHL 119

Query:   121 RFWRSDGVILTILVHMGPVEFLYYWFXXXXXXXXXXXXXXXXXXXXVVTEPITSVIHPFA 180
               WR+DG  L  L+H GPVEFLYYWF                    +VTEPITSVIHPFA
Sbjct:   120 PLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFA 179

Query:   181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
             E + Y LLF+IPL+   +   ASI +F  Y+IY+DFMNNMGHCNFE +P WLFT FPPLK
Sbjct:   180 ELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLK 239

Query:   241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGXXXXXSADDV 300
             +LMYTPS+HSLHHTQFRTNYSLFMP YDYIY T+D+SSD++YE SLK +        + V
Sbjct:   240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNN-----EEEEAV 294

Query:   301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
             DVVHLTHLTT  SIYH+R GFA  AS+P+     +S+WY++++WP +   S++++W YG 
Sbjct:   295 DVVHLTHLTTLHSIYHMRPGFAEFASRPY-----VSRWYMRMMWPLSW-LSMVLTWTYGS 348

Query:   361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
             +F  E N + K+++Q+W +PRY   Y L W +EAIN LIE+A+ EAD  G KV+SLGLLN
Sbjct:   349 SFTVERNVMKKIRMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLN 408

Query:   421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGXXXXXXXXXX 480
             Q   LN++GE YL + P KL  ++VDG+SLAAAVVVNS+P+ T  V+L G          
Sbjct:   409 QAHTLNKSGEQYLLKYP-KLGARIVDGTSLAAAVVVNSIPQGTDQVILAGNVSKVARAVA 467

Query:   481 XXSSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAA 523
                +LC+  IKV    K DY  LK  IP     NL  S +  A
Sbjct:   468 --QALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSFSKTGTA 508

GO:0005783 "endoplasmic reticulum" evidence=IDA

GO:0010025 "wax biosynthetic process" evidence=IDA

GO:0010143 "cutin biosynthetic process" evidence=IDA

GO:0043668 "exine" evidence=IMP

GO:0048653 "anther development" evidence=IMP

UNIPROTKB\|Q109K1 LOC_Os10g33250 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2204813 AT1G02190 "AT1G02190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2040666 AT2G37700 "AT2G37700" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2174368 CER3 "ECERIFERUM 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6ETL8 P0544B02.10 "Os02g0178800 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
F4HVY0	CER1_ARATH	No assigned EC number	0.6436	0.9474	0.808	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		533
PLN02869		620	PLN02869, PLN02869, fatty aldehyde decarbonylase	0.0
pfam04116		114	pfam04116, FA_hydroxylase, Fatty acid hydroxylase	1e-17
COG3000		271	COG3000, ERG3, Sterol desaturase [Lipid metabolism	2e-16
pfam12076		164	pfam12076, Wax2_C, WAX2 C-terminal domain	2e-15

>gnl\|CDD\|166510 PLN02869, PLN02869, fatty aldehyde decarbonylase	Back alignment and domain information

 Score =  848 bits (2192), Expect = 0.0
 Identities = 372/523 (71%), Positives = 441/523 (84%), Gaps = 18/523 (3%)

Query: 1   MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
           MASKPGILT+WPWKPLGS+K+VVLAPW +HSIY F+   + ERD +YFLIFPFLL RMLH
Sbjct: 1   MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLH 60

Query: 61  DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
           +Q+WISLSRYRTAK NNRIVDK IEF+QVDRERNWDDQI+FNG++FY+  M++P + S++
Sbjct: 61  NQLWISLSRYRTAKGNNRIVDKGIEFEQVDRERNWDDQILFNGILFYVGYMILPGA-SHM 119

Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
             WR+DGV++TIL+HMGPVEFLYYW HRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179

Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
           EHI YFLLFAIPL+TT+    ASIA+F GYI Y+DFMNNMGHCNFE IP WLF++FPPLK
Sbjct: 180 EHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK 239

Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
           +LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGT+D+SSD++YEKSLKR     EE     
Sbjct: 240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKR----PEEI---P 292

Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
           DVVHLTHLTTP+SIYHLR+GFASLASKP+       +WYL+L+WP T S S++++WIYGR
Sbjct: 293 DVVHLTHLTTPDSIYHLRLGFASLASKPYIS-----KWYLRLMWPVT-SWSMMLTWIYGR 346

Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
           TFV E N  +KL LQTWV+P+Y +QY L W+ E+INSLIEEAILEAD +GVKV+SLGLLN
Sbjct: 347 TFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIEEAILEADKRGVKVLSLGLLN 406

Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
           QGEELNR GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T  VL RG ++  KVA  
Sbjct: 407 QGEELNRYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLS--KVAYF 463

Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIP-VEAQHNLVLSTSYA 522
           +AS+LCQ GI+VAT  +D+YEKL  ++P  E    L+LS +Y+
Sbjct: 464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNYS 506

Length = 620

>gnl\|CDD\|217907 pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily	Back alignment and domain information

>gnl\|CDD\|225546 COG3000, ERG3, Sterol desaturase [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|192933 pfam12076, Wax2_C, WAX2 C-terminal domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		533
PLN02869		620	fatty aldehyde decarbonylase	100.0
KOG0873		283	consensus C-4 sterol methyl oxidase [Lipid transpo	100.0
COG3000		271	ERG3 Sterol desaturase [Lipid metabolism]	99.95
KOG0872		312	consensus Sterol C5 desaturase [Lipid transport an	99.88
KOG0874		287	consensus Sphingolipid hydroxylase [Lipid transpor	99.84
PF12076		164	Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194	99.76
PF04116		114	FA_hydroxylase: Fatty acid hydroxylase superfamily	99.71
PLN02434		237	fatty acid hydroxylase	99.19
PRK14982		340	acyl-ACP reductase; Provisional	98.26
KOG0539		240	consensus Sphingolipid fatty acid hydroxylase [Lip	97.97
PLN02601		303	beta-carotene hydroxylase	97.56
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	97.04
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	95.05
PF10520		178	Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme	94.16
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	93.48
KOG1014		312	consensus 17 beta-hydroxysteroid dehydrogenase typ	92.34
COG5322		351	Predicted dehydrogenase [General function predicti	92.23
PLN03209		576	translocon at the inner envelope of chloroplast su	91.8
PRK06482		276	short chain dehydrogenase; Provisional	91.76
COG0300		265	DltE Short-chain dehydrogenases of various substra	91.36
PRK08265		261	short chain dehydrogenase; Provisional	90.53
PRK06196		315	oxidoreductase; Provisional	90.35
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	90.35
PRK05867		253	short chain dehydrogenase; Provisional	90.08
PRK06924		251	short chain dehydrogenase; Provisional	89.72
PRK09186		256	flagellin modification protein A; Provisional	89.58
PRK06949		258	short chain dehydrogenase; Provisional	89.34
PRK07890		258	short chain dehydrogenase; Provisional	89.13
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	89.12
PRK08264		238	short chain dehydrogenase; Validated	89.12
PRK07577		234	short chain dehydrogenase; Provisional	89.09
PRK05993		277	short chain dehydrogenase; Provisional	89.07
PLN02780		320	ketoreductase/ oxidoreductase	89.04
KOG1208		314	consensus Dehydrogenases with different specificit	89.04
PRK07063		260	short chain dehydrogenase; Provisional	88.91
PRK05854		313	short chain dehydrogenase; Provisional	88.9
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	88.83
PRK08340		259	glucose-1-dehydrogenase; Provisional	88.77
PRK12829		264	short chain dehydrogenase; Provisional	88.67
PRK07062		265	short chain dehydrogenase; Provisional	88.64
PRK06841		255	short chain dehydrogenase; Provisional	88.63
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	88.51
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	88.33
PRK07478		254	short chain dehydrogenase; Provisional	88.31
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	88.31
PRK06179		270	short chain dehydrogenase; Provisional	88.16
PRK07825		273	short chain dehydrogenase; Provisional	88.09
PRK07523		255	gluconate 5-dehydrogenase; Provisional	88.08
PRK06124		256	gluconate 5-dehydrogenase; Provisional	88.04
PRK06182		273	short chain dehydrogenase; Validated	88.01
PRK07454		241	short chain dehydrogenase; Provisional	87.93
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	87.85
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	87.83
PRK07024		257	short chain dehydrogenase; Provisional	87.72
PRK08177		225	short chain dehydrogenase; Provisional	87.71
PRK09135		249	pteridine reductase; Provisional	87.7
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	87.48
PRK12742		237	oxidoreductase; Provisional	87.48
PRK06197		306	short chain dehydrogenase; Provisional	87.47
PRK05717		255	oxidoreductase; Validated	87.46
PRK05884		223	short chain dehydrogenase; Provisional	87.43
PRK05872		296	short chain dehydrogenase; Provisional	87.38
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	87.37
PLN02253		280	xanthoxin dehydrogenase	87.31
PRK06500		249	short chain dehydrogenase; Provisional	87.27
PRK08589		272	short chain dehydrogenase; Validated	87.15
PRK06180		277	short chain dehydrogenase; Provisional	87.04
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	86.91
PRK07856		252	short chain dehydrogenase; Provisional	86.61
PRK06398		258	aldose dehydrogenase; Validated	86.58
PRK06101		240	short chain dehydrogenase; Provisional	86.54
PRK07326		237	short chain dehydrogenase; Provisional	86.42
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	86.41
PRK12939		250	short chain dehydrogenase; Provisional	86.37
COG1484		254	DnaC DNA replication protein [DNA replication, rec	86.24
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	86.19
PRK08643		256	acetoin reductase; Validated	86.11
PRK05866		293	short chain dehydrogenase; Provisional	86.08
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	86.08
PRK08251		248	short chain dehydrogenase; Provisional	86.05
PRK08339		263	short chain dehydrogenase; Provisional	85.99
PRK08085		254	gluconate 5-dehydrogenase; Provisional	85.96
PRK06523		260	short chain dehydrogenase; Provisional	85.92
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	85.92
PRK08017		256	oxidoreductase; Provisional	85.88
PRK06947		248	glucose-1-dehydrogenase; Provisional	85.88
PRK09291		257	short chain dehydrogenase; Provisional	85.79
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.77
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	85.73
PRK06483		236	dihydromonapterin reductase; Provisional	85.65
PRK06194		287	hypothetical protein; Provisional	85.59
PRK08267		260	short chain dehydrogenase; Provisional	85.46
PRK07023		243	short chain dehydrogenase; Provisional	85.31
PRK10538		248	malonic semialdehyde reductase; Provisional	85.31
PRK07102		243	short chain dehydrogenase; Provisional	85.15
PRK08213		259	gluconate 5-dehydrogenase; Provisional	85.0
PRK12824		245	acetoacetyl-CoA reductase; Provisional	84.99
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	84.95
PRK12828		239	short chain dehydrogenase; Provisional	84.77
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	84.69
PRK05876		275	short chain dehydrogenase; Provisional	84.57
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	84.55
PRK08862		227	short chain dehydrogenase; Provisional	84.46
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	84.36
PRK08263		275	short chain dehydrogenase; Provisional	84.34
PRK06914		280	short chain dehydrogenase; Provisional	84.28
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	84.19
PRK06057		255	short chain dehydrogenase; Provisional	83.92
PRK06953		222	short chain dehydrogenase; Provisional	83.83
PRK07067		257	sorbitol dehydrogenase; Provisional	83.74
PRK07677		252	short chain dehydrogenase; Provisional	83.7
PRK06125		259	short chain dehydrogenase; Provisional	83.65
PRK08703		239	short chain dehydrogenase; Provisional	83.58
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	83.58
PRK06139		330	short chain dehydrogenase; Provisional	83.39
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	83.39
PRK09072		263	short chain dehydrogenase; Provisional	83.34
PRK12937		245	short chain dehydrogenase; Provisional	83.1
PRK07774		250	short chain dehydrogenase; Provisional	83.07
PRK07060		245	short chain dehydrogenase; Provisional	82.86
PRK07109		334	short chain dehydrogenase; Provisional	82.86
PRK07985		294	oxidoreductase; Provisional	82.83
CHL00194		317	ycf39 Ycf39; Provisional	82.81
PRK07097		265	gluconate 5-dehydrogenase; Provisional	82.78
PRK08936		261	glucose-1-dehydrogenase; Provisional	82.64
PLN00198		338	anthocyanidin reductase; Provisional	82.62
PRK07074		257	short chain dehydrogenase; Provisional	82.38
PRK09496		453	trkA potassium transporter peripheral membrane com	82.38
PRK05650		270	short chain dehydrogenase; Provisional	82.19
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	82.17
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	82.14
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	82.04
PRK05875		276	short chain dehydrogenase; Provisional	81.71
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	81.7
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	81.68
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	81.66
PRK07069		251	short chain dehydrogenase; Validated	81.57
PRK08226		263	short chain dehydrogenase; Provisional	81.56
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	81.53
PRK07035		252	short chain dehydrogenase; Provisional	81.32
PTZ00381		493	aldehyde dehydrogenase family protein; Provisional	81.26
PRK12746		254	short chain dehydrogenase; Provisional	81.18
PRK05693		274	short chain dehydrogenase; Provisional	81.16
PRK08277		278	D-mannonate oxidoreductase; Provisional	81.08
PRK07453		322	protochlorophyllide oxidoreductase; Validated	80.93
PRK06114		254	short chain dehydrogenase; Provisional	80.93
PRK08628		258	short chain dehydrogenase; Provisional	80.75
PRK12938		246	acetyacetyl-CoA reductase; Provisional	80.69
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	80.65
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	80.63
PRK06181		263	short chain dehydrogenase; Provisional	80.54
PLN02695		370	GDP-D-mannose-3',5'-epimerase	80.48
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	80.29
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	80.15
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	80.11
PLN02583		297	cinnamoyl-CoA reductase	80.06
PRK06138		252	short chain dehydrogenase; Provisional	80.01

>PLN02869 fatty aldehyde decarbonylase	Back alignment and domain information

Probab=100.00  E-value=3.9e-168  Score=1350.30  Aligned_cols=509  Identities=73%  Similarity=1.266  Sum_probs=488.9

Q ss_pred             CCCCCCCCCCCCCCCCCCcceeehHHHHHHHHHHhhhcccccCCcceeehHHHHHHHHHHHhHHHHhhcchhhHhcCcCC
Q 009511            1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIV   80 (533)
Q Consensus         1 m~~~~~~l~~wpw~~lg~~ky~~~~p~~~~~~~~~~~~~~~~~~~~~~~il~~~llRy~~~~~wi~~~~~~~~~~k~KIq   80 (533)
                      ||++||+||+|||++||||||++|||+|++++|++.++++++.|+.|+++|+++++|++++|+|++++|++++++|+||+
T Consensus         1 ma~~pg~lt~wpW~~lG~~Ky~~~~p~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~l~~q~W~s~sr~~~~~~~~ri~   80 (620)
T PLN02869          1 MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLHNQLWISLSRYRTAKGNNRIV   80 (620)
T ss_pred             CCCCCcccccCcccccCCeeeeeehHHHHHHHHHHHhcccccccccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhceeee
Confidence            99999999999999999999999999999999999999877788889999999999999999999999999999999999


Q ss_pred             CCCcccccchhhhcchhhHHHHHHHHHHHHHhcCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhhchhhhhhccc
Q 009511           81 DKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYH  160 (533)
Q Consensus        81 ~~~~~~~qvdrE~~~~n~iil~~ll~~l~~~~~p~~~~~lP~W~~~g~i~~lll~~lv~Df~~Yw~HRllH~~~LY~r~H  160 (533)
                      +|+++|+|+|||++||||+|+++++++++++.+| ..+.+|.|+..|++..+++|+++.|++|||+||++|++++||++|
T Consensus        81 ~~~i~f~QvDre~~wDd~iil~~l~~~~~~~~~p-~~~~~P~W~~~g~l~~~Llhv~~~Df~fYW~HRllH~~~LYwr~H  159 (620)
T PLN02869         81 DKGIEFEQVDRERNWDDQILFNGILFYVGYMILP-GASHMPLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYH  159 (620)
T ss_pred             ccCCCceeeccccccchHHHHHHHHHHHHHHhhh-hhhcCcccccchHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHH
Confidence            9999999999999999999999999999998999 789999999999999999999999999999999999999999999


Q ss_pred             cCCccCccCCcchhhccchhhHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHhhcccccceeccccchhccCCcc
Q 009511          161 SHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240 (533)
Q Consensus       161 kvHHss~~p~~~ta~~~hplE~ll~~~l~~iPll~~~llg~~s~~~~~~yli~~~~~~~~~Hsg~e~~P~~~~~~lp~Lk  240 (533)
                      ++||++.+|+|+|+..+++.|.+.+.+++.+|+++..+.+..|+.++++|+++.+++++++|||+|++|+++++.+|+++
T Consensus       160 kvHHss~~~~P~Ts~~HP~~E~L~y~ll~~IPLllli~~g~~hi~t~~~yli~~~f~~~~gHSN~El~P~~~~~~~ppLk  239 (620)
T PLN02869        160 SHHHSSIVTEPITSVIHPFAEHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK  239 (620)
T ss_pred             hhccCCCCCCchhhhcCcHHHHHHHHHHHHHHHHHHhhcccchHHHHHHHHHHHHHHhcccccCccccccchhccCCcch
Confidence            99999999999998854445777777778889987777777789999999999999999999999999999988889999


Q ss_pred             cccCCchhhhHhhhcCCCCccCccchhhhhcCCCCCCChhHHHHhhcCCCccccccCCCCCeEEecccCCccccccccch
Q 009511          241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIG  320 (533)
Q Consensus       241 ~li~Tp~~H~lHH~~~~~NYG~~f~~WDrLFGT~~~~~~~~~e~~~~g~~~~~~~~~~~pd~V~L~h~~~~~s~~h~~~~  320 (533)
                      |+++||++|++||+++++|||++|++|||+|||+++++++++|+...+.+       ++||||||||+||++|+||+|||
T Consensus       240 yll~TPsfHdlHHs~fd~NYGlfF~~WDrLFGT~d~~s~~l~e~~~~~~~-------~~pd~V~l~H~t~~~s~~h~~~~  312 (620)
T PLN02869        240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKRPE-------EIPDVVHLTHLTTPDSIYHLRLG  312 (620)
T ss_pred             heecCchHHhHHhccCCcCcccchHHHHhccCCCCCCchhHHHHhhcCcc-------cCCCEEEEeccCCHHHhhccchH
Confidence            99999999999999999999999999999999999999999999887645       79999999999999999999999


Q ss_pred             hhhhccCCCcccccccchhhhhhhhhHHHHHHHHHHHhcceeEeeccccCcccceeEEeeccCceeccchhhhHhHHHHH
Q 009511          321 FASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIE  400 (533)
Q Consensus       321 ~~s~as~p~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~w~~pr~~~~y~~~~~~~~in~~ie  400 (533)
                      |||+||+||+  +   +||||||||+| +++|+++|+|||||++|+|+|||+++|||+||||||||++|+++|+||++||
T Consensus       313 ~~s~as~p~~--~---~~~l~~~wp~~-~~~m~~~w~~~~~f~~~~~~~~~~~~~tw~vpr~~~qy~~~~~~~~in~~Ie  386 (620)
T PLN02869        313 FASLASKPYI--S---KWYLRLMWPVT-SWSMMLTWIYGRTFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIE  386 (620)
T ss_pred             HHHhccCCcc--c---hhHHHHHHHHH-HHHHHHHHHhCCceEeeeeeccceeeeEEEeccccccccCchhhhhHHHHHH
Confidence            9999999999  7   99999999999 9999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCeEEEecccccccccccccceeeccCCCCceeEEeeCCcchhhhhhhcCCcCcceEEEeccccchhhHHH
Q 009511          401 EAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA  480 (533)
Q Consensus       401 ~ai~~a~~~g~kv~slg~ln~~~~ln~~g~l~~~~~p~~l~vrvv~g~~l~aa~v~~~ip~~~~~v~l~g~~~~~k~~~a  480 (533)
                      +||+||||+||||+|||+|||||+|||||||||+||| +|||||||||||||||||||||+|||||||||++  ||||||
T Consensus       387 ~ail~ad~~Gvkv~sLg~LNk~~~LN~~G~l~v~k~p-~L~vrvv~G~tLtaAvvln~ip~~~~~vfl~G~~--sK~~ra  463 (620)
T PLN02869        387 EAILEADKRGVKVLSLGLLNQGEELNRYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNL--SKVAYF  463 (620)
T ss_pred             HHHHHHHhcCCEEEechhcchhhhhcCCceEeeecCC-CcceEEEeCCchHHHHHHHhcCCCCceEEEecCc--cHHHHH
Confidence            9999999999999999999999999999999999999 9999999999999999999999999999999999  799999


Q ss_pred             HHHHhhhcCcEEEeechhHHHHHhccCCh-hhcccceecccccccCceeeE
Q 009511          481 VASSLCQMGIKVATICKDDYEKLKLRIPV-EAQHNLVLSTSYAAHKTVTMV  530 (533)
Q Consensus       481 ia~~lc~~~~~v~~~~~~~~~~~~~~~~~-~~~~~l~~~~~~~~~~~~~~~  530 (533)
                      ||+|||||||||+++|+|||++||+|+|+ |+|+||+|||||    +||+-
T Consensus       464 ia~~lc~r~i~~~t~~~~~~~~~~~~~~~~~~~~~l~~~~~~----~~k~w  510 (620)
T PLN02869        464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNY----SEKIW  510 (620)
T ss_pred             HHHHHHhcCCeEeecCHHHHHHHHHhccchhhhhhEEEeecc----CceeE
Confidence            99999999999766999999999999999 899999999999    78753

>KOG0873 consensus C-4 sterol methyl oxidase [Lipid transport and metabolism]	Back alignment and domain information

>COG3000 ERG3 Sterol desaturase [Lipid metabolism]	Back alignment and domain information

>KOG0872 consensus Sterol C5 desaturase [Lipid transport and metabolism]	Back alignment and domain information

>KOG0874 consensus Sphingolipid hydroxylase [Lipid transport and metabolism]	Back alignment and domain information

>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised	Back alignment and domain information

>PF04116 FA_hydroxylase: Fatty acid hydroxylase superfamily; InterPro: IPR006694 This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases	Back alignment and domain information

>PLN02434 fatty acid hydroxylase	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>KOG0539 consensus Sphingolipid fatty acid hydroxylase [Lipid transport and metabolism]	Back alignment and domain information

>PLN02601 beta-carotene hydroxylase	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PF10520 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme hybrid localisation domain; InterPro: IPR019547 This entry represents part of the transcript of the fusion of two genes, the UEV1	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]	Back alignment and domain information

>COG5322 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07023 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12824 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06953 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PLN00198 anthocyanidin reductase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PTZ00381 aldehyde dehydrogenase family protein; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		533
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-05

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 45.6 bits (107), Expect = 4e-05
 Identities = 59/438 (13%), Positives = 127/438 (28%), Gaps = 115/438 (26%)

Query: 151 HHHYLYSRYHSHHHSSVVTEPI----TSVIHPFAEHIVY-FLLFAIPLVTTMVLKNASIA 205
           HHH        HHH    T         ++  F +  V  F    +  +   +L    I 
Sbjct: 1   HHH--------HHHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEID 52

Query: 206 SFVG---------YI----------IYVDFMNNMGHCNFEFIPMWLFTVF------PPLK 240
             +           +          +   F+  +   N++    +L +        P + 
Sbjct: 53  HIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYK----FLMSPIKTEQRQPSMM 108

Query: 241 FLMYTPSYHSLH----------------HTQFRTN-YSLFMPIYDYIYGTIDRSSDSVYE 283
             MY      L+                + + R     L       I G +  S  +   
Sbjct: 109 TRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG-SGKTWVA 167

Query: 284 KSLKRSGEEEEESADDVDVVHLTHLTTPESI--------YHLRIGFASLASKPHRYTYTL 335
             +  S + + +    +  ++L +  +PE++        Y +   + S +         +
Sbjct: 168 LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRI 227

Query: 336 SQWYLQLLWPFTASCSVLVSWIYGRTF-----VSESNTLDKLKL--QTWVVPRYIVQYNL 388
                +L         +L S  Y         V  +   +   L  +  +  R+      
Sbjct: 228 HSIQAELR-------RLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRF------ 274

Query: 389 PWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEI---YLERQPNKLKIKVV 445
              ++  + L         A     ISL   +     +    +   YL+ +P  L  +V+
Sbjct: 275 ---KQVTDFL--------SAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323

Query: 446 DGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKL 505
             +    +++  S+    A       V  +K+   + SSL  +        +  +++L +
Sbjct: 324 TTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE---PAEYRKMFDRLSV 380

Query: 506 -----RIPVEAQHNLVLS 518
                 IP       +LS
Sbjct: 381 FPPSAHIPTI-----LLS 393

PyMOL of 1vt4

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		533
3guy_A		230	Short-chain dehydrogenase/reductase SDR; structura	92.98
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	92.9
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	92.5
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	92.3
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	92.28
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	91.99
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	91.98
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	91.85
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	91.84
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	91.68
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	91.62
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	91.62
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	91.48
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	91.46
3i1j_A		247	Oxidoreductase, short chain dehydrogenase/reducta;	91.46
3o26_A		311	Salutaridine reductase; short chain dehydrogenase/	91.35
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	91.33
3zv4_A		281	CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox	91.26
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	91.2
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	91.2
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	91.18
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	91.15
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	91.12
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	91.12
4fgs_A		273	Probable dehydrogenase protein; PSI-biology, nysgr	91.1
2jah_A		247	Clavulanic acid dehydrogenase; short-chain dehydro	90.93
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	90.91
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	90.79
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	90.78
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	90.75
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	90.73
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	90.69
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	90.67
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	90.65
3imf_A		257	Short chain dehydrogenase; structural genomics, in	90.62
1xq1_A		266	Putative tropinone reducatse; structural genomics,	90.59
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	90.56
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	90.54
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	90.49
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	90.47
2ph3_A		245	3-oxoacyl-[acyl carrier protein] reductase; TTHA04	90.46
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	90.41
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	90.39
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	90.35
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	90.34
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	90.34
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	90.32
1zem_A		262	Xylitol dehydrogenase; rossmann fold, dinucleotide	90.29
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	90.24
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	90.23
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	90.22
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	90.22
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	90.19
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	90.18
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	90.16
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	90.16
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	90.16
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	90.14
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	90.1
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	90.1
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	90.05
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	90.05
4dqx_A		277	Probable oxidoreductase protein; structural genomi	90.04
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	90.04
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	90.01
4dry_A		281	3-oxoacyl-[acyl-carrier-protein] reductase; struct	90.0
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	89.99
4fn4_A		254	Short chain dehydrogenase; NADH-binding, rossmann	89.98
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	89.95
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	89.94
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	89.94
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	89.92
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	89.91
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	89.88
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	89.88
1spx_A		278	Short-chain reductase family member (5L265); paral	89.84
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	89.82
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	89.75
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	89.72
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	89.69
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	89.67
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	89.67
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	89.67
4g81_D		255	Putative hexonate dehydrogenase; enzyme function i	89.63
3gvc_A		277	Oxidoreductase, probable short-chain type dehydrog	89.61
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	89.59
1xg5_A		279	ARPG836; short chain dehydrogenase, human, SGC, st	89.57
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	89.57
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	89.56
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	89.56
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	89.55
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	89.52
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	89.51
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	89.51
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	89.5
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	89.49
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	89.49
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	89.46
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	89.44
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	89.43
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	89.43
3rih_A		293	Short chain dehydrogenase or reductase; structural	89.33
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	89.3
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	89.23
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	89.22
2qq5_A		260	DHRS1, dehydrogenase/reductase SDR family member 1	89.22
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	89.11
1xkq_A		280	Short-chain reductase family member (5D234); parra	89.11
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	89.08
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	89.07
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	89.06
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	89.04
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	89.03
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	89.0
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	88.95
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	88.91
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	88.91
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	88.9
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	88.88
3tsc_A		277	Putative oxidoreductase; structural genomics, seat	88.87
1yxm_A		303	Pecra, peroxisomal trans 2-enoyl COA reductase; pe	88.86
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	88.85
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	88.84
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	88.82
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	88.81
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	88.79
2dkn_A		255	3-alpha-hydroxysteroid dehydrogenase; oxidoreducta	88.64
1h5q_A		265	NADP-dependent mannitol dehydrogenase; oxidoreduct	88.6
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	88.6
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	88.55
2gk4_A		232	Conserved hypothetical protein; alpha-beta-alpha s	88.47
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	88.46
1ja9_A		274	4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p	88.45
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	88.33
3cxt_A		291	Dehydrogenase with different specificities; rossma	88.31
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	88.28
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	88.27
2bd0_A		244	Sepiapterin reductase; oxidoreductase; HET: NAP BI	88.27
3v2h_A		281	D-beta-hydroxybutyrate dehydrogenase; structural g	88.24
3pxx_A		287	Carveol dehydrogenase; structural genomics, seattl	88.18
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	88.17
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	88.1
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	88.1
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	88.1
2ekp_A		239	2-deoxy-D-gluconate 3-dehydrogenase; structural ge	88.09
1xhl_A		297	Short-chain dehydrogenase/reductase family member	88.08
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	88.07
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	88.05
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	88.01
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	87.98
1fjh_A		257	3alpha-hydroxysteroid dehydrogenase/carbonyl reduc	87.97
1zmt_A		254	Haloalcohol dehalogenase HHEC; halohydrin dehaloge	87.97
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	87.94
4fs3_A		256	Enoyl-[acyl-carrier-protein] reductase [NADPH] FA;	87.85
1uay_A		242	Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid	87.78
1dhr_A		241	Dihydropteridine reductase; oxidoreductase(acting	87.76
1u7z_A		226	Coenzyme A biosynthesis bifunctional protein coabc	87.66
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	87.64
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	87.5
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	87.39
1rpn_A		335	GDP-mannose 4,6-dehydratase; short-chain dehydroge	87.33
3sc6_A		287	DTDP-4-dehydrorhamnose reductase; RFBD, structural	87.25
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	87.2
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	87.19
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	87.14
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	87.13
2h7i_A		269	Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi	87.12
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	87.11
2ew8_A		249	(S)-1-phenylethanol dehydrogenase; transferase; 2.	87.07
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	87.06
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	87.04
2ydy_A		315	Methionine adenosyltransferase 2 subunit beta; oxi	86.93
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	86.91
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	86.87
1vl0_A		292	DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s	86.86
3uce_A		223	Dehydrogenase; rossmann fold, oxidoreductase; HET:	86.8
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	86.7
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	86.58
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	86.47
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	86.43
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	86.38
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	86.22
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	86.18
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	86.1
1xq6_A		253	Unknown protein; structural genomics, protein stru	85.86
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	85.81
3vps_A		321	TUNA, NAD-dependent epimerase/dehydratase; tunicam	85.81
1e7w_A		291	Pteridine reductase; dihydrofolate reductase, shor	85.66
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	85.61
3sc4_A		285	Short chain dehydrogenase (A0QTM2 homolog); ssgcid	85.53
1oaa_A		259	Sepiapterin reductase; tetrahydrobiopterin, oxidor	85.46
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	85.45
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	85.32
3uxy_A		266	Short-chain dehydrogenase/reductase SDR; structura	85.32
3e03_A		274	Short chain dehydrogenase; structural genomics, PS	85.12
4h15_A		261	Short chain alcohol dehydrogenase-related dehydro;	84.99
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	84.98
3r3s_A		294	Oxidoreductase; structural genomics, csgid, center	84.97
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	84.95
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	84.88
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	84.86
2p4h_X		322	Vestitone reductase; NADPH-dependent reductase, is	84.76
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	84.6
1gz6_A		319	Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF	84.52
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	84.45
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	84.41
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	84.28
1g0o_A		283	Trihydroxynaphthalene reductase; protein-NADPH-act	84.21
3d7l_A		202	LIN1944 protein; APC89317, structural genomics, PS	84.2
2yut_A		207	Putative short-chain oxidoreductase; alpha and bet	84.15
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	83.96
4hp8_A		247	2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi	83.88
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	83.87
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	83.86
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	83.86
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	83.73
1p9o_A		313	Phosphopantothenoylcysteine synthetase; ligase; 2.	83.64
2a35_A		215	Hypothetical protein PA4017; alpha-beta-alpha sand	83.62
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	83.57
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	83.56
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	83.54
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	83.41
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	83.36
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	83.28
3kvo_A		346	Hydroxysteroid dehydrogenase-like protein 2; HSDL2	83.28
3k31_A		296	Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI	83.26
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	83.24
3qlj_A		322	Short chain dehydrogenase; structural genomics, se	83.17
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	83.13
3u9l_A		324	3-oxoacyl-[acyl-carrier-protein] reductase; struct	83.09
3e9n_A		245	Putative short-chain dehydrogenase/reductase; stru	83.03
3oec_A		317	Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO;	82.98
3ay3_A		267	NAD-dependent epimerase/dehydratase; glucuronic ac	82.92
4b79_A		242	PA4098, probable short-chain dehydrogenase; oxidor	82.87
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	82.86
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	82.6
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	82.33
1orr_A		347	CDP-tyvelose-2-epimerase; rossmann fold, short-cha	82.19
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	82.03
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	81.92
3grk_A		293	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	81.83
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	81.75
1db3_A		372	GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya	81.59
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	81.56
1n7h_A		381	GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR,	81.55
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	81.5
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	81.26
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	81.15
2b69_A		343	UDP-glucuronate decarboxylase 1; UDP-glucoronic ac	81.12
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	80.93
3oml_A		613	GH14720P, peroxisomal multifunctional enzyme type	80.91
1t2a_A		375	GDP-mannose 4,6 dehydratase; structural genomics c	80.86
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	80.84
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	80.7
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	80.64
2p5y_A		311	UDP-glucose 4-epimerase; TTHA0591, structural geno	80.55
3nzo_A		399	UDP-N-acetylglucosamine 4,6-dehydratase; structura	80.39
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	80.18

>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

Probab=92.98  E-value=0.08  Score=49.76  Aligned_cols=42  Identities=7%  Similarity=0.096  Sum_probs=34.7

Q ss_pred             ceEEEeccccchhhHHHHHHHhhhcCcEEEe--echhHHHHHhccC
Q 009511          464 AHVLLRGTVTANKVANAVASSLCQMGIKVAT--ICKDDYEKLKLRI  507 (533)
Q Consensus       464 ~~v~l~g~~~~~k~~~aia~~lc~~~~~v~~--~~~~~~~~~~~~~  507 (533)
                      |-|++||++  +-+|+++|..|+++|.+|++  -++++-++++++.
T Consensus         2 k~vlVTGas--~gIG~~~a~~l~~~G~~V~~~~r~~~~~~~~~~~~   45 (230)
T 3guy_A            2 SLIVITGAS--SGLGAELAKLYDAEGKATYLTGRSESKLSTVTNCL   45 (230)
T ss_dssp             -CEEEESTT--SHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTC
T ss_pred             CEEEEecCC--chHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHHHH
Confidence            468999999  69999999999999999999  4556666776665

PyMOL of 3guy

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0	Back alignment and structure

>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A*	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli}	Back alignment and structure

>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A*	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8}	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius}	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp}	Back alignment and structure

>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens}	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0	Back alignment and structure

>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP}	Back alignment and structure

>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae}	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2	Back alignment and structure

>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A	Back alignment and structure

>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*	Back alignment and structure

>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A*	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A	Back alignment and structure

>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A*	Back alignment and structure

>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A*	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ...	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2	Back alignment and structure

>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus}	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis}	Back alignment and structure

>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A*	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile}	Back alignment and structure

>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A*	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides}	Back alignment and structure

>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV}	Back alignment and structure

>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A*	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp}	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa}	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A*	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*	Back alignment and structure

>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua}	Back alignment and structure

>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus}	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens}	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1	Back alignment and structure

>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens}	Back alignment and structure

>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A*	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium}	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}	Back alignment and structure

>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}	Back alignment and structure

>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens}	Back alignment and structure

>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A*	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A*	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster}	Back alignment and structure

>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A*	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		533
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	94.53
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	94.24
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	94.05
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	93.77
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	93.19
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	93.19
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	93.16
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	92.98
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	92.95
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	92.79
d1xq1a_		259	Tropinone reductase {Thale cress (Arabidopsis thal	92.66
d1xu9a_		269	11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom	92.66
d2c07a1		251	beta-keto acyl carrier protein reductase {Malaria	92.65
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	92.55
d1g0oa_		272	1,3,8-trihydroxynaphtalene reductase (THNR, naphto	92.48
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	92.47
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	92.44
d2h7ma1		268	Enoyl-ACP reductase {Mycobacterium tuberculosis, T	92.43
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	92.43
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	92.36
d1ulua_		256	Enoyl-ACP reductase {Thermus thermophilus [TaxId:	92.33
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	92.3
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	92.3
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	92.25
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	92.14
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	92.01
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	92.01
d1e7wa_		284	Dihydropteridin reductase (pteridine reductase) {L	91.99
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	91.9
d2pd4a1		274	Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2	91.79
d2gdza1		254	15-hydroxyprostaglandin dehydrogenase, PGDH {Human	91.77
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	91.75
d1x1ta1		260	D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas	91.71
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	91.67
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	91.41
d1iy8a_		258	Levodione reductase {Corynebacterium aquaticum [Ta	91.27
d1h5qa_		260	Mannitol dehydrogenase {Mushroom (Agaricus bisporu	91.13
d1spxa_		264	Glucose dehydrogenase (5l265) {Nematode (Caenorhab	91.07
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	91.04
d2o23a1		248	Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho	90.71
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	90.52
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	90.48
d1vl8a_		251	Gluconate 5-dehydrogenase {Thermotoga maritima [Ta	90.28
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	90.09
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	89.98
d1uaya_		241	Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t	89.76
d1yxma1		297	Peroxisomal trans 2-enoyl CoA reductase {Human (Ho	89.69
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	89.66
d2bd0a1		240	Bacterial sepiapterin reductase {Chlorobium tepidu	89.56
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	89.48
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	89.22
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	89.14
d2ew8a1		247	(s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb	89.02
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	88.92
d1geea_		261	Glucose dehydrogenase {Bacillus megaterium [TaxId:	88.87
d1uzma1		237	beta-keto acyl carrier protein reductase {Mycobact	88.8
d1sb8a_		341	UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo	88.45
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	88.26
d1wmaa1		275	Carbonyl reductase/20beta-hydroxysteroid dehydroge	87.87
d1mxha_		266	Dihydropteridin reductase (pteridine reductase) {T	87.57
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	87.14
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	86.97
d1dhra_		236	Dihydropteridin reductase (pteridine reductase) {R	86.42
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	86.2
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	86.0
d1oaaa_		259	Sepiapterin reductase {Mouse (Mus musculus) [TaxId	85.48
d1ooea_		235	Dihydropteridin reductase (pteridine reductase) {N	85.39
d1d7oa_		297	Enoyl-ACP reductase {Oil seed rape (Brassica napus	85.26
d1gz6a_		302	(3R)-hydroxyacyl-CoA dehydrogenase domain of estra	85.14
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	84.96
d1orra_		338	CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId:	84.71
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	84.63
d1snya_		248	Carbonyl reductase sniffer {Fruit fly (Drosophila	84.33
d1e6ua_		315	GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (	84.27
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	83.92
d1npya1		167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	83.87
d1zmta1		252	Halohydrin dehalogenase HheC {Agrobacterium tumefa	83.29
d1qsga_		258	Enoyl-ACP reductase {Escherichia coli [TaxId: 562]	82.49
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	82.33
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	82.07
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	81.44
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	81.25
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	81.14
d1y1pa1		342	Aldehyde reductase II {Sporobolomyces salmonicolor	80.67

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: 3-alpha,20-beta-hydroxysteroid dehydrogenase
species: Streptomyces hydrogenans [TaxId: 1905]

Probab=94.53  E-value=0.015  Score=54.80  Aligned_cols=46  Identities=13%  Similarity=0.192  Sum_probs=39.0

Q ss_pred             ceEEEeccccchhhHHHHHHHhhhcCcEEEe--echhHHHHHhccCChhh
Q 009511          464 AHVLLRGTVTANKVANAVASSLCQMGIKVAT--ICKDDYEKLKLRIPVEA  511 (533)
Q Consensus       464 ~~v~l~g~~~~~k~~~aia~~lc~~~~~v~~--~~~~~~~~~~~~~~~~~  511 (533)
                      |-++.||++  +-+|+|||..|.++|.+|++  .++|+-+++.+|.+.++
T Consensus         6 K~alVTGas--~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~   53 (254)
T d1hdca_           6 KTVIITGGA--RGLGAEAARQAVAAGARVVLADVLDEEGAATARELGDAA   53 (254)
T ss_dssp             SEEEEETTT--SHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHTTGGGE
T ss_pred             CEEEEeCcC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHhCCce
Confidence            568999999  68999999999999999999  56777888877775443

PyMOL of d1hdca_

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}	Back information, alignment and structure

>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}	Back information, alignment and structure

>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}	Back information, alignment and structure