Citrus Sinensis ID: 009523


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530--
MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSGSNSAAATAASAITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccHHHHHHHHHHHHcccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHccccccEEEEEccccHHHHHHHccccccEEEEEEccccccccHHcHHHHHHHHHHcccEEEEccccccHHccccccccccEEEEcccccccccccccccEEEccHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccEEcccccccccccccccccccccccHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccHHHHHccccccEEEcccccccccccccccccccccccccEEEEEcccccccccccccEEccEEEEEEEEEccHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHccccEEEEEccccccccccHHHHcccEEEEEcccccccccccccEEEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccEEcccccccccEEEcccccccccccHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHcc
mavsscssqkilsfssscssfecrsdpdfsgsarfdkprisaARVIGastasfsgvsslifrfppnfvrqLSTKARRNCSNIGVAQIVAASwsnsvgsgsnsaAATAASAITSGDDIALVDGLKNVQLEALADLKNeasflssdgslaihagerlgrgivtdaittpvvntsayfFKKTAELIDFKEKRRasfeygrygnpTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVpagghivtttdcyrKTRIFIETVlpkmgitatvidpadmEGLEAALnnnnvslfftesptnpflrcvDVKLVSDLchkkgaivcidgtfatplnQKALSLGADLVLHSAtkfigghndvlagsisgsgkLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEahpkvkrvhypglkshpehhiatqqmtgfggvvsfevdgdLTATIKFIdalkipyiapsfggcesivdqpaimsywdlsqseRLKYGIMDnlvrfsfgvedfEDLKADVLQALHAI
mavsscssqkilsfssscssfecrSDPDfsgsarfdkPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSGSNSAAATAASAITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGrgivtdaittpvvntsayffkktaelidfkekrrasfeygrygnpttvVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFietvlpkmgITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
MAVsscssqkilsfssscssfecrsDPDFSGSARFDKPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIvaaswsnsvgsgsnsaaataasaitsGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
*****************************************AARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSN***************AITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQ*****
**************SSSCSSFEC********************************VSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAA*******************************************************SLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
****************************FSGSARFDKPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWS***************SAITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
******************************************************GVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSN**********************************************LSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSGSNSAAATAASAITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query532 2.2.26 [Sep-21-2011]
P55217563 Cystathionine gamma-synth yes no 0.751 0.710 0.840 0.0
A2RM21380 Cystathionine beta-lyase yes no 0.678 0.95 0.395 2e-71
P0A4K2380 Cystathionine beta-lyase yes no 0.678 0.95 0.395 2e-71
O05394379 Cystathionine gamma-lyase yes no 0.695 0.976 0.372 8e-71
P0C2T9380 Cystathionine beta-lyase N/A no 0.691 0.968 0.392 2e-70
Q55DV9387 Cystathionine gamma-lyase yes no 0.703 0.966 0.354 1e-69
P13254398 Methionine gamma-lyase OS no no 0.691 0.924 0.388 6e-69
Q1M0P5380 Cystathionine gamma-synth yes no 0.697 0.976 0.374 1e-68
Q83A83387 Cystathionine beta-lyase yes no 0.693 0.953 0.367 2e-68
P56069380 Cystathionine gamma-synth yes no 0.697 0.976 0.371 2e-68
>sp|P55217|METB_ARATH Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3 Back     alignment and function desciption
 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/402 (84%), Positives = 369/402 (91%), Gaps = 2/402 (0%)

Query: 131 LADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRR 190
           L D K+  SFLSSDGSL +HAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKR 
Sbjct: 164 LTDSKH--SFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRS 221

Query: 191 ASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCY 250
            SFEYGRYGNPTTVV+E+K+SALEGAEST++MASGM ASTVMLLALVPAGGHIVTTTDCY
Sbjct: 222 VSFEYGRYGNPTTVVLEDKISALEGAESTLVMASGMCASTVMLLALVPAGGHIVTTTDCY 281

Query: 251 RKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVS 310
           RKTRIF+E  LPK+GIT TVIDPAD+ GLEAA+N   VSLFFTESPTNPFLRCVD++LVS
Sbjct: 282 RKTRIFMENFLPKLGITVTVIDPADIAGLEAAVNEFKVSLFFTESPTNPFLRCVDIELVS 341

Query: 311 DLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQ 370
            +CHK+G +VCIDGTFATPLNQKAL+LGADLV+HSATK+IGGHNDVLAG I GS KLV++
Sbjct: 342 KICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLVSE 401

Query: 371 IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLK 430
           IRNLHHVLGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA+ILEAHPKV  V+YPGL 
Sbjct: 402 IRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLP 461

Query: 431 SHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMS 490
           SHPEH +A +QMTGFGGVVSFE+DGD+  TIKF+D+LKIPYIAPSFGGCESIVDQPAIMS
Sbjct: 462 SHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAIMS 521

Query: 491 YWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 532
           YWDL Q ERLKYGI DNLVRFSFGVEDFED+KAD+LQAL AI
Sbjct: 522 YWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563




Catalyzes the formation of L-cystathionine from O-succinyl-L-homoserine (OSHS) and L-cysteine, via a gamma-replacement reaction. In the absence of thiol, catalyzes gamma-elimination to form 2-oxobutanoate, succinate and ammonia.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 4EC: 8
>sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 Back     alignment and function description
>sp|P0A4K2|METC_LACLA Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metC PE=3 SV=1 Back     alignment and function description
>sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 Back     alignment and function description
>sp|P0C2T9|METC_LACLC Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1 Back     alignment and function description
>sp|Q55DV9|CGL_DICDI Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=1 SV=1 Back     alignment and function description
>sp|P13254|MEGL_PSEPU Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2 Back     alignment and function description
>sp|Q1M0P5|METB_HELPX Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=1 SV=1 Back     alignment and function description
>sp|Q83A83|METC_COXBU Cystathionine beta-lyase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metC PE=1 SV=1 Back     alignment and function description
>sp|P56069|METB_HELPY Cystathionine gamma-synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query532
350536179540 cystathionine gamma synthase [Solanum ly 0.975 0.961 0.757 0.0
8439541539 cystathionine gamma-synthase isoform 1 [ 0.973 0.961 0.756 0.0
5804835545 cystathionine gamma synthase [Fragaria v 0.990 0.966 0.747 0.0
8439543540 cystathionine gamma-synthase isoform 2 [ 0.962 0.948 0.749 0.0
296082945497 unnamed protein product [Vitis vinifera] 0.921 0.985 0.751 0.0
224141019532 predicted protein [Populus trichocarpa] 0.984 0.984 0.765 0.0
225452877531 PREDICTED: cystathionine gamma-synthase, 0.981 0.983 0.761 0.0
297828634564 hypothetical protein ARALYDRAFT_477417 [ 0.996 0.939 0.712 0.0
3202028548 cystathionine gamma-synthase [Mesembryan 0.973 0.945 0.724 0.0
430736214534 cystathionine gamma-synthase [Cicer arie 0.956 0.953 0.731 0.0
>gi|350536179|ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum] gi|40806079|gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum] Back     alignment and taxonomy information
 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/537 (75%), Positives = 461/537 (85%), Gaps = 18/537 (3%)

Query: 13  SFSSSCSSFECRSDPDFSGSARFDKP--RISAARVIGASTASFSGVSSLIFRFPPNFVRQ 70
           S++ +  SFECRS+PDFSGS    K   R S     G++ +   G+SSLI+RFPPNFVRQ
Sbjct: 5   SYARAFPSFECRSEPDFSGSLPHPKAGVRFSGKYNSGSNRSQVYGLSSLIYRFPPNFVRQ 64

Query: 71  LSTKARRNCSNIGVAQIVAASWSNSVGS----------GSNSAAATAASAITSGDD-IAL 119
           LS KARRNCSNIGVAQ+VAASWSN+              S+++AA  +  IT+GD+ +A+
Sbjct: 65  LSIKARRNCSNIGVAQVVAASWSNNQAGPEFTPAANAVDSSASAAVTSIGITTGDEEVAV 124

Query: 120 VDGL----KNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYF 175
           V+      +NVQ++    +K  ASFL+SDGS+AIHAGERLGRGIVTDAITTPVVNTSAYF
Sbjct: 125 VENADCSDQNVQIKGSTGVK-YASFLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYF 183

Query: 176 FKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLA 235
           F KT++LIDFKEKRRASFEYGRYGNPTTVV+EEK+SALEGAEST+I+ASGM ASTVM LA
Sbjct: 184 FNKTSDLIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLIVASGMCASTVMFLA 243

Query: 236 LVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTES 295
           LVPAGGHIVTTTDCYRKTR+FIET+LPKMGITATVIDPADM  LE ALN   V LFFTES
Sbjct: 244 LVPAGGHIVTTTDCYRKTRVFIETILPKMGITATVIDPADMGALELALNQKKVDLFFTES 303

Query: 296 PTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHND 355
           PTNPFLRCVD++LVS LC +KGA+VCIDGTFATPLNQKAL+LGADLV+HSATKF+GGHND
Sbjct: 304 PTNPFLRCVDIELVSKLCREKGALVCIDGTFATPLNQKALALGADLVVHSATKFLGGHND 363

Query: 356 VLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKIL 415
           VLAG ISG  KLV+ IRNLHH+LGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMA+IL
Sbjct: 364 VLAGCISGPEKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEIL 423

Query: 416 EAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPS 475
           EAHPKVK V+YPGL SHPE+H+A +QMTGFGGVVSFEVDGDL  T KF+DAL+IPYIAPS
Sbjct: 424 EAHPKVKHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPS 483

Query: 476 FGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 532
           FGGCESIVDQPAIMSYWDLSQS+R KYGI+DNLVRFSFGVEDFED+KADVLQAL +I
Sbjct: 484 FGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 540




Source: Solanum lycopersicum

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|8439541|gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|5804835|emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca] gi|6012969|emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca] Back     alignment and taxonomy information
>gi|8439543|gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|296082945|emb|CBI22246.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141019|ref|XP_002323872.1| predicted protein [Populus trichocarpa] gi|222866874|gb|EEF04005.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225452877|ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297828634|ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] gi|297328039|gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3202028|gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum] Back     alignment and taxonomy information
>gi|430736214|gb|AGA60136.1| cystathionine gamma-synthase [Cicer arietinum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query532
TAIR|locus:2102072563 MTO1 "METHIONINE OVERACCUMULAT 0.751 0.710 0.840 7.5e-198
TAIR|locus:2006887412 AT1G33320 [Arabidopsis thalian 0.714 0.922 0.711 5.7e-146
UNIPROTKB|Q4KA19424 mdeA "Methionine gamma-lyase" 0.734 0.922 0.383 1e-68
UNIPROTKB|Q81LL6377 BAS4268 "Cys/Met metabolism PL 0.691 0.976 0.387 1.3e-68
TIGR_CMR|BA_4600377 BA_4600 "cystathionine beta-ly 0.691 0.976 0.387 1.3e-68
UNIPROTKB|Q8EG02397 mdeA "Methionine gamma-lyase M 0.740 0.992 0.374 1.9e-67
TIGR_CMR|SO_1812397 SO_1812 "methionine gamma-lyas 0.740 0.992 0.374 1.9e-67
DICTYBASE|DDB_G0269122387 cysA "cystathionine gamma-lyas 0.703 0.966 0.354 5.8e-66
TIGR_CMR|CBU_2025387 CBU_2025 "cystathionine beta-l 0.693 0.953 0.367 7.6e-64
WB|WBGene00009048392 cth-1 [Caenorhabditis elegans 0.703 0.954 0.362 9.7e-64
TAIR|locus:2102072 MTO1 "METHIONINE OVERACCUMULATION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1767 (627.1 bits), Expect = 7.5e-198, Sum P(2) = 7.5e-198
 Identities = 338/402 (84%), Positives = 369/402 (91%)

Query:   131 LADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRR 190
             L D K+  SFLSSDGSL +HAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKR 
Sbjct:   164 LTDSKH--SFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRS 221

Query:   191 ASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCY 250
              SFEYGRYGNPTTVV+E+K+SALEGAEST++MASGM ASTVMLLALVPAGGHIVTTTDCY
Sbjct:   222 VSFEYGRYGNPTTVVLEDKISALEGAESTLVMASGMCASTVMLLALVPAGGHIVTTTDCY 281

Query:   251 RKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVS 310
             RKTRIF+E  LPK+GIT TVIDPAD+ GLEAA+N   VSLFFTESPTNPFLRCVD++LVS
Sbjct:   282 RKTRIFMENFLPKLGITVTVIDPADIAGLEAAVNEFKVSLFFTESPTNPFLRCVDIELVS 341

Query:   311 DLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQ 370
              +CHK+G +VCIDGTFATPLNQKAL+LGADLV+HSATK+IGGHNDVLAG I GS KLV++
Sbjct:   342 KICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLVSE 401

Query:   371 IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLK 430
             IRNLHHVLGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA+ILEAHPKV  V+YPGL 
Sbjct:   402 IRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLP 461

Query:   431 SHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMS 490
             SHPEH +A +QMTGFGGVVSFE+DGD+  TIKF+D+LKIPYIAPSFGGCESIVDQPAIMS
Sbjct:   462 SHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAIMS 521

Query:   491 YWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 532
             YWDL Q ERLKYGI DNLVRFSFGVEDFED+KAD+LQAL AI
Sbjct:   522 YWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563


GO:0003824 "catalytic activity" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0009086 "methionine biosynthetic process" evidence=IMP
GO:0001887 "selenium compound metabolic process" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006730 "one-carbon metabolic process" evidence=RCA
GO:0003962 "cystathionine gamma-synthase activity" evidence=ISS;IDA
TAIR|locus:2006887 AT1G33320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KA19 mdeA "Methionine gamma-lyase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q81LL6 BAS4268 "Cys/Met metabolism PLP-dependent enzyme" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4600 BA_4600 "cystathionine beta-lyase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EG02 mdeA "Methionine gamma-lyase MdeA" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1812 SO_1812 "methionine gamma-lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269122 cysA "cystathionine gamma-lyase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2025 CBU_2025 "cystathionine beta-lyase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
WB|WBGene00009048 cth-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P55217METB_ARATH2, ., 5, ., 1, ., 4, 80.84070.75180.7104yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.48LOW CONFIDENCE prediction!
4th Layer4.1.99.2LOW CONFIDENCE prediction!
3rd Layer2.5.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
pfam01053382 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP 0.0
cd00614369 cd00614, CGS_like, CGS_like: Cystathionine gamma-s 1e-176
COG0626396 COG0626, MetC, Cystathionine beta-lyases/cystathio 1e-149
PRK08249398 PRK08249, PRK08249, cystathionine gamma-synthase; 1e-120
PRK06460376 PRK06460, PRK06460, hypothetical protein; Provisio 1e-106
PRK06234400 PRK06234, PRK06234, methionine gamma-lyase; Provis 1e-101
COG2873426 COG2873, MET17, O-acetylhomoserine sulfhydrylase [ 1e-100
PRK07671377 PRK07671, PRK07671, cystathionine beta-lyase; Prov 1e-100
PRK08133390 PRK08133, PRK08133, O-succinylhomoserine sulfhydry 1e-100
TIGR01325381 TIGR01325, O_suc_HS_sulf, O-succinylhomoserine sul 1e-98
PRK08064390 PRK08064, PRK08064, cystathionine beta-lyase; Prov 9e-98
PRK07811388 PRK07811, PRK07811, cystathionine gamma-synthase; 2e-97
TIGR01328391 TIGR01328, met_gam_lyase, methionine gamma-lyase 2e-96
PRK07503403 PRK07503, PRK07503, methionine gamma-lyase; Provis 4e-94
PRK08574385 PRK08574, PRK08574, cystathionine gamma-synthase; 2e-93
PRK06176380 PRK06176, PRK06176, cystathionine gamma-synthase/c 2e-92
TIGR02080382 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (t 2e-91
TIGR01326418 TIGR01326, OAH_OAS_sulfhy, OAH/OAS sulfhydrylase 9e-91
PRK06434384 PRK06434, PRK06434, cystathionine gamma-lyase; Val 4e-89
PRK07504398 PRK07504, PRK07504, O-succinylhomoserine sulfhydry 4e-89
PRK06767386 PRK06767, PRK06767, methionine gamma-lyase; Provis 1e-88
PRK05968389 PRK05968, PRK05968, hypothetical protein; Provisio 3e-85
PRK07810403 PRK07810, PRK07810, O-succinylhomoserine sulfhydry 1e-83
PRK07582366 PRK07582, PRK07582, cystathionine gamma-lyase; Val 2e-83
PRK08247366 PRK08247, PRK08247, cystathionine gamma-synthase; 3e-81
PRK05939397 PRK05939, PRK05939, hypothetical protein; Provisio 4e-81
PRK08045386 PRK08045, PRK08045, cystathionine gamma-synthase; 5e-79
PRK07049427 PRK07049, PRK07049, methionine gamma-lyase; Valida 1e-78
TIGR01329378 TIGR01329, cysta_beta_ly_E, cystathionine beta-lya 2e-76
PRK08248431 PRK08248, PRK08248, O-acetylhomoserine aminocarbox 1e-75
PRK08776405 PRK08776, PRK08776, cystathionine gamma-synthase; 8e-75
PRK08134433 PRK08134, PRK08134, O-acetylhomoserine aminocarbox 6e-74
PRK07812436 PRK07812, PRK07812, O-acetylhomoserine aminocarbox 1e-72
PRK06084425 PRK06084, PRK06084, O-acetylhomoserine aminocarbox 3e-70
PRK08861388 PRK08861, PRK08861, cystathionine gamma-synthase; 2e-69
PRK05967395 PRK05967, PRK05967, cystathionine beta-lyase; Prov 1e-68
TIGR01324377 TIGR01324, cysta_beta_ly_B, cystathionine beta-lya 3e-68
PLN02509464 PLN02509, PLN02509, cystathionine beta-lyase 9e-66
PRK07269364 PRK07269, PRK07269, cystathionine gamma-synthase; 5e-63
PRK05613437 PRK05613, PRK05613, O-acetylhomoserine aminocarbox 4e-61
PRK09028394 PRK09028, PRK09028, cystathionine beta-lyase; Prov 1e-60
PRK05994427 PRK05994, PRK05994, O-acetylhomoserine aminocarbox 2e-56
PRK07050394 PRK07050, PRK07050, cystathionine beta-lyase; Prov 4e-56
PLN02242418 PLN02242, PLN02242, methionine gamma-lyase 5e-55
PRK06702432 PRK06702, PRK06702, O-acetylhomoserine aminocarbox 1e-46
PRK08114395 PRK08114, PRK08114, cystathionine beta-lyase; Prov 1e-45
COG1921395 COG1921, SelA, Selenocysteine synthase [seryl-tRNA 3e-06
cd00615294 cd00615, Orn_deC_like, Ornithine decarboxylase fam 9e-06
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 6e-05
pfam03841367 pfam03841, SelA, L-seryl-tRNA selenium transferase 2e-04
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 3e-04
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 0.001
PRK06425332 PRK06425, PRK06425, histidinol-phosphate aminotran 0.002
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 0.003
>gnl|CDD|216267 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme Back     alignment and domain information
 Score =  517 bits (1334), Expect = 0.0
 Identities = 174/386 (45%), Positives = 251/386 (65%), Gaps = 8/386 (2%)

Query: 146 SLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVV 205
           +LA+HAG+R  R   T A+  P+  TS Y F                ++Y R GNPT   
Sbjct: 2   TLAVHAGQRPDRQ--TGAVVVPIYLTSTYVFDTVE---ALFAGEHGGYDYSRSGNPTRDA 56

Query: 206 VEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMG 265
           +EE+++ALEG E+ +  +SGM+A    LLAL+ AG H+V T D Y  T    E VLP+ G
Sbjct: 57  LEERIAALEGGEAALAFSSGMAAIFAALLALLKAGDHVVATDDLYGGTYRLFEKVLPRFG 116

Query: 266 ITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGT 325
           I  T +DP+D++ LEAA+  N     F E+PTNP L+ VD++ ++ +  K GA+V +D T
Sbjct: 117 IEVTFVDPSDLDALEAAIKPN-TKAVFLETPTNPLLKVVDIEAIAKIAKKHGALVVVDNT 175

Query: 326 FATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSI--SGSGKLVTQIRNLHHVLGGALN 383
           FA+P  Q+ L LGAD+V+HSATK+IGGH+DV+ G +  +G  +L  ++R L +  G  L+
Sbjct: 176 FASPYLQRPLELGADIVVHSATKYIGGHSDVVGGVVVVNGREELAKRLRFLQNATGAVLS 235

Query: 384 PNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMT 443
           P  A+L++RG+KTL LR+++    AL++A+ LE HPKV++V+YPGL SHP H +A +QM+
Sbjct: 236 PFDAWLLLRGLKTLGLRMERHQENALKLAEFLEEHPKVEKVYYPGLPSHPGHELAKKQMS 295

Query: 444 GFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYG 503
           GFGG++SFE+ G L A  KF+D LK+  +A S GG ES++  PA M++  +   ER   G
Sbjct: 296 GFGGMLSFELKGGLEAASKFLDNLKLFSLAESLGGVESLISHPATMTHASIPPEEREAAG 355

Query: 504 IMDNLVRFSFGVEDFEDLKADVLQAL 529
           I D L+R S G+ED +DL AD+ QAL
Sbjct: 356 ITDGLIRLSVGIEDVDDLIADLKQAL 381


This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor. Length = 382

>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>gnl|CDD|223699 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236202 PRK08249, PRK08249, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|235807 PRK06460, PRK06460, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|168478 PRK06234, PRK06234, methionine gamma-lyase; Provisional Back     alignment and domain information
>gnl|CDD|225428 COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181076 PRK07671, PRK07671, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|181244 PRK08133, PRK08133, O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>gnl|CDD|188131 TIGR01325, O_suc_HS_sulf, O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>gnl|CDD|236146 PRK08064, PRK08064, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|236104 PRK07811, PRK07811, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|130395 TIGR01328, met_gam_lyase, methionine gamma-lyase Back     alignment and domain information
>gnl|CDD|181005 PRK07503, PRK07503, methionine gamma-lyase; Provisional Back     alignment and domain information
>gnl|CDD|236298 PRK08574, PRK08574, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|180443 PRK06176, PRK06176, cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>gnl|CDD|131135 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>gnl|CDD|130393 TIGR01326, OAH_OAS_sulfhy, OAH/OAS sulfhydrylase Back     alignment and domain information
>gnl|CDD|102374 PRK06434, PRK06434, cystathionine gamma-lyase; Validated Back     alignment and domain information
>gnl|CDD|168979 PRK07504, PRK07504, O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>gnl|CDD|180685 PRK06767, PRK06767, methionine gamma-lyase; Provisional Back     alignment and domain information
>gnl|CDD|168320 PRK05968, PRK05968, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236103 PRK07810, PRK07810, O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>gnl|CDD|236061 PRK07582, PRK07582, cystathionine gamma-lyase; Validated Back     alignment and domain information
>gnl|CDD|181320 PRK08247, PRK08247, cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235650 PRK05939, PRK05939, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|169194 PRK08045, PRK08045, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|180809 PRK07049, PRK07049, methionine gamma-lyase; Validated Back     alignment and domain information
>gnl|CDD|233359 TIGR01329, cysta_beta_ly_E, cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>gnl|CDD|236201 PRK08248, PRK08248, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181554 PRK08776, PRK08776, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|236159 PRK08134, PRK08134, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|236105 PRK07812, PRK07812, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180392 PRK06084, PRK06084, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181567 PRK08861, PRK08861, cystathionine gamma-synthase; Provisional Back     alignment and domain information
>gnl|CDD|235657 PRK05967, PRK05967, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|130391 TIGR01324, cysta_beta_ly_B, cystathionine beta-lyase, bacterial Back     alignment and domain information
>gnl|CDD|178125 PLN02509, PLN02509, cystathionine beta-lyase Back     alignment and domain information
>gnl|CDD|235983 PRK07269, PRK07269, cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>gnl|CDD|168128 PRK05613, PRK05613, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181615 PRK09028, PRK09028, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|180344 PRK05994, PRK05994, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180810 PRK07050, PRK07050, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|215134 PLN02242, PLN02242, methionine gamma-lyase Back     alignment and domain information
>gnl|CDD|102505 PRK06702, PRK06702, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181231 PRK08114, PRK08114, cystathionine beta-lyase; Provisional Back     alignment and domain information
>gnl|CDD|224832 COG1921, SelA, Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99739 cd00615, Orn_deC_like, Ornithine decarboxylase family Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|112645 pfam03841, SelA, L-seryl-tRNA selenium transferase Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|102370 PRK06425, PRK06425, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 532
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 100.0
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 100.0
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 100.0
PRK08114395 cystathionine beta-lyase; Provisional 100.0
PRK08861388 cystathionine gamma-synthase; Provisional 100.0
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 100.0
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK09028394 cystathionine beta-lyase; Provisional 100.0
PRK08249398 cystathionine gamma-synthase; Provisional 100.0
PRK05967395 cystathionine beta-lyase; Provisional 100.0
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK08045386 cystathionine gamma-synthase; Provisional 100.0
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 100.0
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 100.0
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 100.0
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 100.0
PRK07049427 methionine gamma-lyase; Validated 100.0
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 100.0
PRK08574385 cystathionine gamma-synthase; Provisional 100.0
PRK05939397 hypothetical protein; Provisional 100.0
PRK07503403 methionine gamma-lyase; Provisional 100.0
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 100.0
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 100.0
PRK08776405 cystathionine gamma-synthase; Provisional 100.0
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 100.0
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 100.0
PRK06234400 methionine gamma-lyase; Provisional 100.0
PRK07671377 cystathionine beta-lyase; Provisional 100.0
PRK06767386 methionine gamma-lyase; Provisional 100.0
PLN02509464 cystathionine beta-lyase 100.0
PRK06460376 hypothetical protein; Provisional 100.0
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 100.0
PRK06434384 cystathionine gamma-lyase; Validated 100.0
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 100.0
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 100.0
PRK07811388 cystathionine gamma-synthase; Provisional 100.0
PRK07050394 cystathionine beta-lyase; Provisional 100.0
PRK08064390 cystathionine beta-lyase; Provisional 100.0
PLN02242418 methionine gamma-lyase 100.0
PRK07269364 cystathionine gamma-synthase; Reviewed 100.0
PRK05968389 hypothetical protein; Provisional 100.0
PRK07582366 cystathionine gamma-lyase; Validated 100.0
PRK08247366 cystathionine gamma-synthase; Reviewed 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.96
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.95
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.95
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.95
PRK05957389 aspartate aminotransferase; Provisional 99.94
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.94
PRK06207405 aspartate aminotransferase; Provisional 99.94
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.94
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.94
PRK07324373 transaminase; Validated 99.94
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.94
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.94
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.94
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.94
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.94
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.93
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.93
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.93
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.93
PLN02721353 threonine aldolase 99.93
PRK07179407 hypothetical protein; Provisional 99.93
PRK07681399 aspartate aminotransferase; Provisional 99.93
PLN02651364 cysteine desulfurase 99.93
PRK06225380 aspartate aminotransferase; Provisional 99.93
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.93
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.93
PRK02948381 cysteine desulfurase; Provisional 99.93
PRK06290410 aspartate aminotransferase; Provisional 99.93
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.93
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.93
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.93
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.93
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.93
PRK08960387 hypothetical protein; Provisional 99.93
PRK06348384 aspartate aminotransferase; Provisional 99.93
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.93
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.93
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.93
PRK06108382 aspartate aminotransferase; Provisional 99.93
PRK05764393 aspartate aminotransferase; Provisional 99.93
PRK07682378 hypothetical protein; Validated 99.93
PRK08361391 aspartate aminotransferase; Provisional 99.93
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.93
PLN02187462 rooty/superroot1 99.93
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.92
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.92
PRK05942394 aspartate aminotransferase; Provisional 99.92
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.92
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.92
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.92
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.92
PRK12414384 putative aminotransferase; Provisional 99.92
PRK07337388 aminotransferase; Validated 99.92
PTZ00433412 tyrosine aminotransferase; Provisional 99.92
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.92
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.92
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.92
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.92
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.92
PRK08068389 transaminase; Reviewed 99.92
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.92
PLN02483489 serine palmitoyltransferase 99.92
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.92
PRK07550386 hypothetical protein; Provisional 99.92
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.92
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.92
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.92
PLN00175413 aminotransferase family protein; Provisional 99.92
PLN02656409 tyrosine transaminase 99.92
PRK04311464 selenocysteine synthase; Provisional 99.92
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.92
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.92
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.91
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.91
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.91
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.91
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.91
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.91
PRK07309391 aromatic amino acid aminotransferase; Validated 99.91
PRK08912387 hypothetical protein; Provisional 99.91
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.91
PRK13392410 5-aminolevulinate synthase; Provisional 99.91
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.91
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.91
PRK07777387 aminotransferase; Validated 99.91
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.91
PRK07683387 aminotransferase A; Validated 99.91
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.91
PRK09148405 aminotransferase; Validated 99.91
PRK09265404 aminotransferase AlaT; Validated 99.91
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.91
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.91
PRK09082386 methionine aminotransferase; Validated 99.91
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.91
PRK07568397 aspartate aminotransferase; Provisional 99.91
PRK03321352 putative aminotransferase; Provisional 99.9
PRK09105370 putative aminotransferase; Provisional 99.9
PRK08363398 alanine aminotransferase; Validated 99.9
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.9
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.9
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.9
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.9
PRK08175395 aminotransferase; Validated 99.9
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.9
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.9
PRK13393406 5-aminolevulinate synthase; Provisional 99.9
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.9
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.9
PRK06107402 aspartate aminotransferase; Provisional 99.9
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.9
PRK14012404 cysteine desulfurase; Provisional 99.9
PRK08636403 aspartate aminotransferase; Provisional 99.9
PTZ00377481 alanine aminotransferase; Provisional 99.9
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.9
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.9
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.9
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.89
PRK09064407 5-aminolevulinate synthase; Validated 99.89
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.89
PLN02822481 serine palmitoyltransferase 99.89
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.89
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.89
PRK06836394 aspartate aminotransferase; Provisional 99.89
PRK07392360 threonine-phosphate decarboxylase; Validated 99.89
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.89
PRK10534333 L-threonine aldolase; Provisional 99.89
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.89
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.89
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.89
PRK07908349 hypothetical protein; Provisional 99.89
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.88
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.88
PRK05839374 hypothetical protein; Provisional 99.88
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.88
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.88
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.88
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.88
PRK06855433 aminotransferase; Validated 99.88
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.88
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.87
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.87
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.87
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.87
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.87
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.87
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.87
PLN02409401 serine--glyoxylate aminotransaminase 99.87
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.87
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.87
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.87
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.87
PRK08354311 putative aminotransferase; Provisional 99.87
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.86
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.86
PLN02955476 8-amino-7-oxononanoate synthase 99.86
PRK13520371 L-tyrosine decarboxylase; Provisional 99.86
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.86
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.86
TIGR01814406 kynureninase kynureninase. This model describes ky 99.86
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.86
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.85
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.85
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.85
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.85
PLN02231534 alanine transaminase 99.85
PLN02724 805 Molybdenum cofactor sulfurase 99.84
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.84
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.84
PLN02368407 alanine transaminase 99.84
PTZ00376404 aspartate aminotransferase; Provisional 99.84
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.84
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.83
PLN026721082 methionine S-methyltransferase 99.83
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.83
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.82
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.82
PRK09275527 aspartate aminotransferase; Provisional 99.82
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.82
PRK08637388 hypothetical protein; Provisional 99.81
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.81
PRK02627396 acetylornithine aminotransferase; Provisional 99.81
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.81
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.81
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.8
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.8
PRK07505402 hypothetical protein; Provisional 99.8
PLN02397423 aspartate transaminase 99.79
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.78
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.78
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.77
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.77
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.77
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.77
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.77
PLN03032374 serine decarboxylase; Provisional 99.76
PRK02769380 histidine decarboxylase; Provisional 99.76
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.76
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.76
PLN02624474 ornithine-delta-aminotransferase 99.76
PRK13580493 serine hydroxymethyltransferase; Provisional 99.74
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.74
PLN00144382 acetylornithine transaminase 99.73
PLN03226475 serine hydroxymethyltransferase; Provisional 99.73
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.73
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.73
PRK03080378 phosphoserine aminotransferase; Provisional 99.72
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.72
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.71
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.71
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.71
PRK04260375 acetylornithine aminotransferase; Provisional 99.7
PLN02414993 glycine dehydrogenase (decarboxylating) 99.69
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.69
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.69
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.69
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.68
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.68
PLN02271586 serine hydroxymethyltransferase 99.68
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.67
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.67
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.67
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.66
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.66
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.66
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.65
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.64
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.64
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.64
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.63
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.62
PRK09792421 4-aminobutyrate transaminase; Provisional 99.62
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.61
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.61
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.6
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.6
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.6
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.6
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.6
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.6
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.59
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.58
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.58
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.58
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.58
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.57
PRK05965459 hypothetical protein; Provisional 99.57
PRK12403460 putative aminotransferase; Provisional 99.57
PRK06105460 aminotransferase; Provisional 99.57
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.56
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.56
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.56
PRK13237460 tyrosine phenol-lyase; Provisional 99.56
PRK07046453 aminotransferase; Validated 99.56
PRK15029 755 arginine decarboxylase; Provisional 99.56
PRK05367954 glycine dehydrogenase; Provisional 99.56
PLN02880490 tyrosine decarboxylase 99.55
PRK07678451 aminotransferase; Validated 99.55
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.55
PRK07482461 hypothetical protein; Provisional 99.55
PRK05367 954 glycine dehydrogenase; Provisional 99.54
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.54
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.54
PLN02590539 probable tyrosine decarboxylase 99.53
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.53
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.53
PRK06541460 hypothetical protein; Provisional 99.53
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.52
PRK06062451 hypothetical protein; Provisional 99.52
PRK07481449 hypothetical protein; Provisional 99.52
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.51
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.51
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.51
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.51
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.51
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.5
PRK13578 720 ornithine decarboxylase; Provisional 99.5
PLN02263470 serine decarboxylase 99.49
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.49
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.49
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.49
COG4100416 Cystathionine beta-lyase family protein involved i 99.49
PRK07480456 putative aminotransferase; Validated 99.49
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.49
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.49
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.48
PRK07036466 hypothetical protein; Provisional 99.47
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.47
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.47
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.47
PRK06149972 hypothetical protein; Provisional 99.46
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.46
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.46
PRK12566954 glycine dehydrogenase; Provisional 99.45
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
PRK07483443 hypothetical protein; Provisional 99.43
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.43
PRK061481013 hypothetical protein; Provisional 99.42
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.42
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.42
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.4
PRK15400 714 lysine decarboxylase CadA; Provisional 99.4
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.39
PRK06917447 hypothetical protein; Provisional 99.39
PRK08297443 L-lysine aminotransferase; Provisional 99.38
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.37
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.35
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.35
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 99.34
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.32
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.32
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.32
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.31
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.31
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.28
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.26
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.26
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.24
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.22
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.22
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 99.2
PLN02452365 phosphoserine transaminase 99.2
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.2
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 99.18
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 99.01
PRK12462364 phosphoserine aminotransferase; Provisional 98.98
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 98.98
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.89
PRK12566 954 glycine dehydrogenase; Provisional 98.87
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 98.81
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 98.73
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.66
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.55
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.55
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 98.51
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.12
KOG0629510 consensus Glutamate decarboxylase and related prot 98.0
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 97.74
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 97.7
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 97.6
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 97.42
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 97.33
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 97.28
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 97.07
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 96.24
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 96.09
KOG3843432 consensus Predicted serine hydroxymethyltransferas 93.89
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 87.1
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 82.27
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.2e-80  Score=640.01  Aligned_cols=387  Identities=43%  Similarity=0.708  Sum_probs=364.2

Q ss_pred             CccccccccCCcCCCCCCCCcccCCcccccccccCChHHHHHHhhcccCCCCCCCCCchhHHHHHHHHHhhhCCCcEEEe
Q 009523          143 SDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIM  222 (532)
Q Consensus       143 ~~~t~~v~~g~~~~~~~~~~~~~~pi~~sst~~~~~~~~~~~~~~~~~~~~~Y~R~~~p~~~~Le~~lA~l~ga~~~i~~  222 (532)
                      ++.|+++|.|...+  ..+++++||||+||||.|++.++..+.+.+...+|.|+|++||+++.||+++++++|++.++.|
T Consensus         7 ~~~T~~v~~g~~~~--~~~gav~~PI~~tStf~~~~~~~~~~~~~~~~~~~~Y~R~~nPT~~~lE~~~a~LEg~~~~~af   84 (396)
T COG0626           7 SLTTRLVHAGRRPD--DLTGAVNPPIYLTSTFVFDSAGEGLDAFAGEEGGYDYSRTGNPTRDALEEALAELEGGEDAFAF   84 (396)
T ss_pred             ccceeeEEcccccc--cCCCcccCCeeeeeeecccChhhhhhhccccccCcccccCCCccHHHHHHHHHHhhCCCcEEEe
Confidence            57899999997663  4589999999999999999998776666666778999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHhccCCCEEEEcCCCCcchHHHHHHhcccCCcEEEEeCCCCHHHHHHhhcCCCeeEEEEeCCCCCCCc
Q 009523          223 ASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLR  302 (532)
Q Consensus       223 sSG~~Ai~~al~all~~Gd~VIv~~~~y~~t~~~~~~~l~~~Gv~v~~vd~~dle~Le~al~~~~tklV~lesP~NptG~  302 (532)
                      +|||+||.+++.+++++||+|++++..|++++.++...++++|+++.++|..+.+++++++.+.+|++||+|+|+||+..
T Consensus        85 sSGmaAI~~~~l~ll~~GD~vl~~~~~YG~t~~~~~~~l~~~gi~~~~~d~~~~~~~~~~~~~~~tk~v~lEtPsNP~l~  164 (396)
T COG0626          85 SSGMAAISTALLALLKAGDHVLLPDDLYGGTYRLFEKILQKFGVEVTFVDPGDDEALEAAIKEPNTKLVFLETPSNPLLE  164 (396)
T ss_pred             cCcHHHHHHHHHHhcCCCCEEEecCCccchHHHHHHHHHHhcCeEEEEECCCChHHHHHHhcccCceEEEEeCCCCcccc
Confidence            99999999999999999999999999999999999999999999999999988888887777436999999999999999


Q ss_pred             ccCHHHHHHHHHhCCCEEEEECCCCCCCcccccccCCcEEEECCccccCCCCCcEEEEEEeCh-HHHHHHHHHhh-hcCC
Q 009523          303 CVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSG-KLVTQIRNLHH-VLGG  380 (532)
Q Consensus       303 v~dl~~I~~la~~~gi~lIvDet~a~~~~~~~l~~gaDivv~S~sK~lgg~gd~~gG~lv~~~-~li~~l~~~~~-~~G~  380 (532)
                      +.|+++|+++|+++|+++||||||++|+.++|+++|+|||++|+|||++||+|+++|+++++. ++.+.+....+ .+|.
T Consensus       165 v~DI~~i~~~A~~~g~~vvVDNTfatP~~q~PL~~GaDIVvhSaTKyl~GHsDvl~G~v~~~~~~~~~~~~~~~~~~~G~  244 (396)
T COG0626         165 VPDIPAIARLAKAYGALVVVDNTFATPVLQRPLELGADIVVHSATKYLGGHSDVLGGVVLTPNEELYELLFFAQRANTGA  244 (396)
T ss_pred             cccHHHHHHHHHhcCCEEEEECCcccccccChhhcCCCEEEEeccccccCCcceeeeEEecChHHHHHHHHHHHHhhcCC
Confidence            999999999999999999999999999999999999999999999999999999999888665 55566555444 5999


Q ss_pred             CccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhCCCceEEeCCCCCCCchhhhHhhhcCCcccEEEEEEcCCHHHH
Q 009523          381 ALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTAT  460 (532)
Q Consensus       381 ~~~~~~a~l~l~~l~tl~~r~~~~~~~a~~la~~L~~~p~v~~V~~Pgl~s~p~~~l~~~~~~g~G~~vsf~l~g~~~~~  460 (532)
                      .++|+++|+++|+++|+..||+++++|++.+++||++||.|++|+||++++||+|++++||++|+|+|++|+|+++ +++
T Consensus       245 ~l~p~dA~l~lRGlkTL~~Rm~~~~~nA~~IA~~L~~~p~V~~V~yPgl~shp~he~~~rq~~g~gg~~Sf~l~~~-~~~  323 (396)
T COG0626         245 VLSPFDAWLLLRGLRTLALRMERHNENALKIAEFLADHPKVKKVYYPGLPSHPGHELAKRQMTGYGGLFSFELKNE-EAA  323 (396)
T ss_pred             CCCHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHhcCCCeEEEECCCCCCCCcHHHHHHhcCCCceEEEEEeCCh-HHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999987 889


Q ss_pred             HHHHHHcCCCceeecCCCcccccccCccccccCCCHHHHHhcCCCCCeEEEEecCCCHHHHHHHHHHHHhhC
Q 009523          461 IKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  532 (532)
Q Consensus       461 ~~~l~~L~~~~i~vs~G~~~sl~~~pa~~s~~~~~~~~~~~~gi~~~~IRlSvG~ed~~dli~dL~~AL~~l  532 (532)
                      .+|+++|+++.+++||||++|++++|+.|+|..++.+.|.+.|+++++||||||+||++|||+||++||+++
T Consensus       324 ~~f~~~L~l~~~a~SlGgveSLi~~pa~~th~~~~~~~r~~~Gi~~~LvRlSVGlEd~eDLi~Dl~~Al~~~  395 (396)
T COG0626         324 KKFLDSLKLFKLAESLGGVESLISHPATMTHASIPLEERAKAGITDGLVRLSVGLEDVEDLIADLEQALAKA  395 (396)
T ss_pred             HHHHHhCCccEEeccCCCcccccccccccCcccCCHhHHHhcCCCCCeEEEEecCCCHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999864



>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
1qgn_A445 Cystathionine Gamma-Synthase From Nicotiana Tabacum 0.0
3mkj_A398 Methionine Gamma-Lyase From Citrobacter Freundii Wi 3e-78
3jw9_A398 Crystal Structure Of L-Methionine Gamma-Lyase From 3e-77
3jwa_A398 Crystal Structure Of L-Methionine Gamma-Lyase From 3e-77
2rfv_A398 High Resolution Structure Of L-Methionine Gamma-Lya 7e-77
1y4i_A398 Crystal Structure Of Citrobacter Freundii L-Methion 2e-76
3e6g_A400 Crystal Structure Of Xometc, A Cystathionine C-Lyas 2e-70
1pg8_A398 Crystal Structure Of L-Methionine Alpha-, Gamma-Lya 6e-70
3vk2_A398 Crystal Structure Of L-Methionine Gamma-Lyase From 1e-69
1gc0_A398 Crystal Structure Of The Pyridoxal-5'-Phosphate Dep 3e-69
1e5e_A404 Methionine Gamma-Lyase (Mgl) From Trichomonas Vagin 2e-64
3aej_A389 Reaction Intermediate Structure Of Entamoeba Histol 2e-62
3acz_A389 Crystal Structure Of Entamoeba Histolytica Methioni 7e-62
2nmp_A403 Crystal Structure Of Human Cystathionine Gamma Lyas 6e-60
3elp_B410 Structure Of Cystationine Gamma Lyase Length = 410 8e-60
1ibj_A464 Crystal Structure Of Cystathionine Beta-Lyase From 1e-59
3ndn_A414 Crystal Structure Of O-Succinylhomoserine Sulfhydry 1e-58
3qhx_A392 Crystal Structure Of Cystathionine Gamma-Synthase M 3e-57
1n8p_A393 Crystal Structure Of Cystathionine Gamma-lyase From 3e-57
1pff_A331 Crystal Structure Of Homocysteine Alpha-, Gamma-Lya 4e-57
1cs1_A386 Cystathionine Gamma-Synthase (Cgs) From Escherichia 8e-57
3ri6_A430 A Novel Mechanism Of Sulfur Transfer Catalyzed By O 3e-44
2ctz_A421 Crystal Structure Of O-Acetyl Homoserine Sulfhydryl 3e-44
2cb1_A412 Crystal Structure Of O-Actetyl Homoserine Sulfhydry 2e-39
2fq6_A415 Cystathionine Beta-Lyase (Cbl) From Escherichia Col 6e-39
1cl2_A395 Cystathionine Beta-Lyase (Cbl) From Escherichia Col 7e-39
1cl1_A395 Cystathionine Beta-Lyase (Cbl) From Escherichia Col 3e-38
>pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum Length = 445 Back     alignment and structure

Iteration: 1

Score = 741 bits (1912), Expect = 0.0, Method: Compositional matrix adjust. Identities = 355/422 (84%), Positives = 391/422 (92%), Gaps = 5/422 (1%) Query: 115 DDIALVDGL----KNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVN 170 +D+ALV+ +NVQ ++L +K ASFL+SDGS+AIHAGERLGRGIVTDAITTPVVN Sbjct: 25 EDVALVENETCNDQNVQFDSLPSMK-YASFLNSDGSVAIHAGERLGRGIVTDAITTPVVN 83 Query: 171 TSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTVIMASGMSAST 230 TSAYFF KT+ELIDFKEKRRASFEYGRYGNPTTVV+EEK+SALEGAEST++MASGM AST Sbjct: 84 TSAYFFNKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEGAESTLLMASGMCAST 143 Query: 231 VMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSL 290 VMLLALVPAGGHIVTTTDCYRKTRIFIET+LPKMGITATVIDPAD+ LE ALN V+L Sbjct: 144 VMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQKKVNL 203 Query: 291 FFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFI 350 FFTESPTNPFLRCVD++LVS LCH+KGA+VCIDGTFATPLNQKAL+LGADLVLHSATKF+ Sbjct: 204 FFTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFL 263 Query: 351 GGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALR 410 GGHNDVLAG ISG KLV++IRNLHH+LGGALNPNAAYLIIRGMKTLHLRVQQQNSTALR Sbjct: 264 GGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALR 323 Query: 411 MAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIP 470 MA+ILEAHPKV+ V+YPGL+SHPEHHIA +QMTGFGG VSFEVDGDL T KF+DALKIP Sbjct: 324 MAEILEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIP 383 Query: 471 YIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALH 530 YIAPSFGGCESIVDQPAIMSYWDLSQS+R KYGIMDNLVRFSFGVEDF+DLKAD+LQAL Sbjct: 384 YIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALD 443 Query: 531 AI 532 +I Sbjct: 444 SI 445
>pdb|3MKJ|A Chain A, Methionine Gamma-Lyase From Citrobacter Freundii With Pyridoximine-5'- Phosphate Length = 398 Back     alignment and structure
>pdb|3JW9|A Chain A, Crystal Structure Of L-Methionine Gamma-Lyase From Citrobacter Freundii With S-Ethyl-Cysteine Length = 398 Back     alignment and structure
>pdb|3JWA|A Chain A, Crystal Structure Of L-Methionine Gamma-Lyase From Citrobacter Freundii With Methionine Phosphinate Length = 398 Back     alignment and structure
>pdb|2RFV|A Chain A, High Resolution Structure Of L-Methionine Gamma-Lyase From Citrobacter Freundii Length = 398 Back     alignment and structure
>pdb|1Y4I|A Chain A, Crystal Structure Of Citrobacter Freundii L-Methionine-Lyase Length = 398 Back     alignment and structure
>pdb|3E6G|A Chain A, Crystal Structure Of Xometc, A Cystathionine C-Lyase-Like Protein From Xanthomonas Oryzae Pv.Oryzae Length = 400 Back     alignment and structure
>pdb|1PG8|A Chain A, Crystal Structure Of L-Methionine Alpha-, Gamma-Lyase Length = 398 Back     alignment and structure
>pdb|3VK2|A Chain A, Crystal Structure Of L-Methionine Gamma-Lyase From Pseudomonas Putida C116h Mutant. Length = 398 Back     alignment and structure
>pdb|1GC0|A Chain A, Crystal Structure Of The Pyridoxal-5'-Phosphate Dependent L- Methionine Gamma-Lyase From Pseudomonas Putida Length = 398 Back     alignment and structure
>pdb|1E5E|A Chain A, Methionine Gamma-Lyase (Mgl) From Trichomonas Vaginalis In Complex With Propargylglycine Length = 404 Back     alignment and structure
>pdb|3AEJ|A Chain A, Reaction Intermediate Structure Of Entamoeba Histolytica Methionine Gamma-Lyase 1 Tetramer Containing Michaelis Complex And Methionine- Pyridoxal-5'-Phosphate Length = 389 Back     alignment and structure
>pdb|3ACZ|A Chain A, Crystal Structure Of Entamoeba Histolytica Methionine Gamma-Lyase 1 Length = 389 Back     alignment and structure
>pdb|2NMP|A Chain A, Crystal Structure Of Human Cystathionine Gamma Lyase Length = 403 Back     alignment and structure
>pdb|3ELP|B Chain B, Structure Of Cystationine Gamma Lyase Length = 410 Back     alignment and structure
>pdb|1IBJ|A Chain A, Crystal Structure Of Cystathionine Beta-Lyase From Arabidopsis Thaliana Length = 464 Back     alignment and structure
>pdb|3NDN|A Chain A, Crystal Structure Of O-Succinylhomoserine Sulfhydrylase From Mycobacterium Tuberculosis Covalently Bound To Pyridoxal-5- Length = 414 Back     alignment and structure
>pdb|3QHX|A Chain A, Crystal Structure Of Cystathionine Gamma-Synthase Metb (Cgs) From Mycobacterium Ulcerans Agy99 Bound To Hepes Length = 392 Back     alignment and structure
>pdb|1N8P|A Chain A, Crystal Structure Of Cystathionine Gamma-lyase From Yeast Length = 393 Back     alignment and structure
>pdb|1PFF|A Chain A, Crystal Structure Of Homocysteine Alpha-, Gamma-Lyase At 1.8 Angstroms Length = 331 Back     alignment and structure
>pdb|1CS1|A Chain A, Cystathionine Gamma-Synthase (Cgs) From Escherichia Coli Length = 386 Back     alignment and structure
>pdb|3RI6|A Chain A, A Novel Mechanism Of Sulfur Transfer Catalyzed By O-Acetylhomoserine Sulfhydrylase In Methionine Biosynthetic Pathway Of Wolinella Succinogenes Length = 430 Back     alignment and structure
>pdb|2CTZ|A Chain A, Crystal Structure Of O-Acetyl Homoserine Sulfhydrylase From Thermus Thermophilus Hb8 Length = 421 Back     alignment and structure
>pdb|2CB1|A Chain A, Crystal Structure Of O-Actetyl Homoserine Sulfhydrylase From Thermus Thermophilus Hb8,Oah2 Length = 412 Back     alignment and structure
>pdb|2FQ6|A Chain A, Cystathionine Beta-Lyase (Cbl) From Escherichia Coli In Complex With N-Hydrazinocarbonylmethyl-2-Trifluoromethyl-Benzamide Length = 415 Back     alignment and structure
>pdb|1CL2|A Chain A, Cystathionine Beta-Lyase (Cbl) From Escherichia Coli In Complex With Aminoethoxyvinylglycine Length = 395 Back     alignment and structure
>pdb|1CL1|A Chain A, Cystathionine Beta-Lyase (Cbl) From Escherichia Coli Length = 395 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 0.0
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 1e-154
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 1e-153
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 1e-152
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 1e-152
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 1e-149
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 1e-148
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 1e-147
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 1e-146
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 1e-145
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 1e-144
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 1e-141
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 1e-138
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 1e-135
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 2e-99
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 1e-94
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 4e-93
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 1e-61
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 3e-61
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 5e-55
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 4e-50
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 7e-42
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-04
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 1e-04
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 2e-04
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 7e-04
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Length = 445 Back     alignment and structure
 Score =  575 bits (1484), Expect = 0.0
 Identities = 357/440 (81%), Positives = 391/440 (88%), Gaps = 9/440 (2%)

Query: 102 SAAATAASAITSGDDIALVDGLKNVQLEALADLK---------NEASFLSSDGSLAIHAG 152
            AAA AA+AI   D   + + +  V+ E   D             ASFL+SDGS+AIHAG
Sbjct: 6   DAAAAAAAAIAPVDTTVVNEDVALVENETCNDQNVQFDSLPSMKYASFLNSDGSVAIHAG 65

Query: 153 ERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSA 212
           ERLGRGIVTDAITTPVVNTSAYFF KT+ELIDFKEKRRASFEYGRYGNPTTVV+EEK+SA
Sbjct: 66  ERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISA 125

Query: 213 LEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVID 272
           LEGAEST++MASGM ASTVMLLALVPAGGHIVTTTDCYRKTRIFIET+LPKMGITATVID
Sbjct: 126 LEGAESTLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVID 185

Query: 273 PADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQ 332
           PAD+  LE ALN   V+LFFTESPTNPFLRCVD++LVS LCH+KGA+VCIDGTFATPLNQ
Sbjct: 186 PADVGALELALNQKKVNLFFTESPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQ 245

Query: 333 KALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIR 392
           KAL+LGADLVLHSATKF+GGHNDVLAG ISG  KLV++IRNLHH+LGGALNPNAAYLIIR
Sbjct: 246 KALALGADLVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIR 305

Query: 393 GMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFE 452
           GMKTLHLRVQQQNSTALRMA+ILEAHPKV+ V+YPGL+SHPEHHIA +QMTGFGG VSFE
Sbjct: 306 GMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFE 365

Query: 453 VDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFS 512
           VDGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDLSQS+R KYGIMDNLVRFS
Sbjct: 366 VDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFS 425

Query: 513 FGVEDFEDLKADVLQALHAI 532
           FGVEDF+DLKAD+LQAL +I
Sbjct: 426 FGVEDFDDLKADILQALDSI 445


>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Length = 398 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Length = 398 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Length = 404 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Length = 389 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Length = 414 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Length = 386 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Length = 415 Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} PDB: 3qi6_A* Length = 392 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Length = 403 Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} PDB: 3e6g_A* 3nnp_A* Length = 400 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Length = 464 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Length = 393 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Length = 331 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Length = 430 Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Length = 412 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Length = 421 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Length = 431 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Length = 374 Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Length = 427 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Length = 427 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Length = 409 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Length = 446 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Length = 755 Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Length = 715 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query532
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 100.0
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 100.0
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 100.0
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 100.0
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 100.0
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 100.0
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 100.0
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 100.0
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 100.0
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 100.0
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 100.0
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 100.0
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 100.0
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 100.0
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 100.0
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 100.0
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 100.0
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 100.0
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 100.0
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.96
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.96
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.96
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.96
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.96
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.96
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.96
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.96
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.96
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.96
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.96
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.95
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.95
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.95
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.95
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.95
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.95
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.95
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.95
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.95
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.95
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.95
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.95
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.95
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.95
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.95
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.95
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.95
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.94
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.94
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.94
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.94
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.94
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.94
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.94
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.94
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.94
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.94
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.94
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.94
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.94
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.94
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.94
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.94
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.94
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.94
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.94
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.94
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.94
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.94
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.94
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.94
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.94
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.94
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.94
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.94
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.94
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.94
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.94
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.94
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.94
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.94
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.94
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.94
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.93
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.93
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.93
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.93
3ele_A398 Amino transferase; RER070207001803, structural gen 99.93
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.93
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.93
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.93
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.93
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.93
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.93
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.93
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.93
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.93
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.93
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.93
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.93
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.93
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.93
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.93
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.93
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.93
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.93
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.93
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.93
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.93
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.93
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.92
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.92
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.92
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.92
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.92
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.92
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.92
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.92
2fnu_A375 Aminotransferase; protein-product complex, structu 99.92
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.92
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.92
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.92
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.92
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.92
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.92
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.92
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.92
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.92
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.91
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.91
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.91
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.91
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.91
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.91
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.91
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.91
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.9
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.9
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
3rq1_A418 Aminotransferase class I and II; structural genomi 99.9
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.9
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.9
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.9
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.9
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.9
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.9
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.9
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.89
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.89
1svv_A359 Threonine aldolase; structural genomics, structura 99.89
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.89
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.89
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.89
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.89
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.88
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.88
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.88
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.88
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.88
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.88
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.88
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.88
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.88
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.88
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.8
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.87
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.87
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.87
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.87
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.87
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.87
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.87
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.86
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.86
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.86
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.86
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.86
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.86
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.86
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.86
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.86
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.86
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.86
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.85
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.85
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.85
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.85
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.85
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.85
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.85
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.85
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.85
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.85
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.84
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.84
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.84
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.84
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.84
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.84
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.84
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.84
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.83
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.83
3hmu_A472 Aminotransferase, class III; structural genomics, 99.82
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.82
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.82
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.82
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.82
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.82
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.82
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.82
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.82
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.82
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.82
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.82
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.82
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.81
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.8
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.8
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.79
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.78
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.74
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.59
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.73
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.71
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.66
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.61
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.61
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.6
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.56
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.53
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.51
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.47
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
Probab=100.00  E-value=4.8e-66  Score=551.21  Aligned_cols=385  Identities=32%  Similarity=0.487  Sum_probs=308.9

Q ss_pred             CCCccccccccCCcCCCCCCCCcccCCcccccccccCChHHHHHHhhcccCCCCCCCCCchhHHHHHHHHHhhhCCCcEE
Q 009523          141 LSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEGAESTV  220 (532)
Q Consensus       141 ~~~~~t~~v~~g~~~~~~~~~~~~~~pi~~sst~~~~~~~~~~~~~~~~~~~~~Y~R~~~p~~~~Le~~lA~l~ga~~~i  220 (532)
                      |.+++|++||+|..++  ..+++++||||+|+||.|++.+++.+.+.+...+|.|+|+++|+.++||++||+++|.+.++
T Consensus        24 m~~~~t~~~h~~~~~~--~~~~~~~~pi~~s~t~~~~~~~~~~~~~~~~~~~~~y~r~~~p~~~~le~~lA~l~g~~~~v  101 (430)
T 3ri6_A           24 MRGFTTRALHVPKAKR--DVHGALRTPVYDNAAFEFENSDEIAQVSLGRALGHVYSRSSNPTVEDLEQRLKNLTGALGVL  101 (430)
T ss_dssp             -CCHHHHHHCCC----------------------------------------------CCHHHHHHHHHHHHHHTCSEEE
T ss_pred             cCCcchhheeCCCCCC--CCCCCcCCCcccccccccCCHHHHHHHhhcccCCccccCCCCHHHHHHHHHHHHHHCCCcEE
Confidence            4568999999997653  34789999999999999999988777776667789999999999999999999999999999


Q ss_pred             EeCCHHHHHHHHHHHhccCCCEEEEcCCCCcchHHHHHHhcccCCcEEEEeCCCCHHHHHHhhcCCCeeEEEEeCCCCCC
Q 009523          221 IMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPF  300 (532)
Q Consensus       221 ~~sSG~~Ai~~al~all~~Gd~VIv~~~~y~~t~~~~~~~l~~~Gv~v~~vd~~dle~Le~al~~~~tklV~lesP~Npt  300 (532)
                      +++||++|+.+++++++++||+|+++++.|+++...+...++..|+++++++.+|+++|++++++ +|++|++|+|+||+
T Consensus       102 ~~~sG~~Ai~~al~al~~~Gd~Vi~~~~~y~~~~~~~~~~~~~~G~~~~~v~~~d~~~l~~ai~~-~t~~v~~e~p~Npt  180 (430)
T 3ri6_A          102 ALGSGMAAISTAILTLARAGDSVVTTDRLFGHTLSLFQKTLPSFGIEVRFVDVMDSLAVEHACDE-TTKLLFLETISNPQ  180 (430)
T ss_dssp             EESCHHHHHHHHHHHHCCTTCEEEEETTCCHHHHHHHHTHHHHTTCEEEEECTTCHHHHHHHCCT-TEEEEEEESSCTTT
T ss_pred             EECCHHHHHHHHHHHHhCCCCEEEEcCCCchhHHHHHHHHHHHcCCEEEEeCCCCHHHHHHhhCC-CCeEEEEECCCCCC
Confidence            99999999999999999999999999999999988776677888999999999999999999987 79999999999999


Q ss_pred             CcccCHHHHHHHHHhCCCEEEEECCCCCCCcccccccCCcEEEECCccccCCCCCcEEEEEEe--ChHH-----------
Q 009523          301 LRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISG--SGKL-----------  367 (532)
Q Consensus       301 G~v~dl~~I~~la~~~gi~lIvDet~a~~~~~~~l~~gaDivv~S~sK~lgg~gd~~gG~lv~--~~~l-----------  367 (532)
                      |.+.|+++|+++|+++|+++|+|++|+.+..+++...|+|++++|+||+++||+++++|+++.  +..+           
T Consensus       181 G~~~dl~~i~~la~~~g~~livD~a~~~~~~~~~~~~g~div~~S~sK~l~g~g~~~gG~vv~~~~~~~~~~~~~~~l~~  260 (430)
T 3ri6_A          181 LQVADLEALSKVVHAKGIPLVVDTTMTPPYLLEAKRLGVDIEVLSSTKFISGGGTSVGGVLIDHGLFEWKSLPSLAPYYA  260 (430)
T ss_dssp             CCCCCHHHHHHHHHTTTCCEEEECTTSCTTTCCGGGGTCSEEEEECCCEEETTEEECCEEEEECSCSCGGGSTTTHHHHH
T ss_pred             CeecCHHHHHHHHHHcCCEEEEECCCcccccCChHHcCCEEEEECCcccccCCCCceEEEEEECChHHhhhccchhhhhh
Confidence            999999999999999999999999999988889999999999999999999999999999994  3222           


Q ss_pred             -------HHHHH-HHhhhcCCCccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhCCCceEEeCCCCCCCchhhhHh
Q 009523          368 -------VTQIR-NLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIAT  439 (532)
Q Consensus       368 -------i~~l~-~~~~~~G~~~~~~~a~l~l~~l~tl~~r~~~~~~~a~~la~~L~~~p~v~~V~~Pgl~s~p~~~l~~  439 (532)
                             +++++ .....+|..++++.+|+++++++++..|++++.+|+++++++|+++|.|.+|.||+++++|+|++++
T Consensus       261 ~~g~~~~i~~~~~~~~~~~g~~~~~~~a~l~l~~l~~l~~r~~~~~~na~~la~~L~~~p~v~~V~~P~l~~~p~~~~~~  340 (430)
T 3ri6_A          261 KAGPMAFLYKARKEVFQNLGPSLSPHNAYLQSLGLETMALRIERSCQNAQELAHWLLSIPQVKCVNHPSLPDSPFYAIAK  340 (430)
T ss_dssp             HHGGGHHHHHHHHTHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCTTCEEEECTTSTTSTTHHHHH
T ss_pred             hhchhhHHHHHHHHHHHhcCCCCCHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHhCCCCccEEECCCCCCCccHHHHH
Confidence                   33333 2345678889999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCccc-EEEEEEcCCHHHHHHHHHHcCCCceeecCCCcccccccCccccccCCCHHHHHhcCCCCCeEEEEecCCCH
Q 009523          440 QQMTGFGG-VVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDF  518 (532)
Q Consensus       440 ~~~~g~G~-~vsf~l~g~~~~~~~~l~~L~~~~i~vs~G~~~sl~~~pa~~s~~~~~~~~~~~~gi~~~~IRlSvG~ed~  518 (532)
                      +|+ |+|+ |+||+++ +.+.+.+|+++++++++++|+|+.+|++++|++++|..++++++.+.|+++++||||||+|++
T Consensus       341 ~~~-g~Gg~~lsf~l~-~~~~~~~~~~~l~~~~~~~s~G~~~sli~~p~~~~h~~~~~~~~~~~g~~~~liRlsvG~E~~  418 (430)
T 3ri6_A          341 RQF-RYAGSILTFELE-SKEASYRFMDALKLIRRATNIHDNKSLILSPYHVIYALNSHEERLKLEISPAMMRLSVGIEEI  418 (430)
T ss_dssp             HHC-SSCCSEEEEECS-SHHHHHHHHHHCSSSEECSCCSCSSCEEECTGGGC---------CGGGSCTTEEEEECCSSCH
T ss_pred             HhC-CCCceEEEEEEC-CHHHHHHHHHhCCcceecCCCCCCCceeeCCcccccccCCHHHHHhcCCCCCeEEEEeccCCH
Confidence            999 9999 9999998 567889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHh
Q 009523          519 EDLKADVLQALH  530 (532)
Q Consensus       519 ~dli~dL~~AL~  530 (532)
                      +|+++||++||+
T Consensus       419 ~dl~~dl~~al~  430 (430)
T 3ri6_A          419 EDLKEDILQALC  430 (430)
T ss_dssp             HHHHHHHHHHHC
T ss_pred             HHHHHHHHHhhC
Confidence            999999999984



>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 532
d1qgna_398 c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {C 1e-119
d1y4ia1397 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Ci 1e-110
d1gc0a_392 c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudom 1e-103
d2ctza1421 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydry 3e-95
d1e5ea_394 c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichom 4e-92
d1ibja_380 c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale 5e-84
d1cs1a_384 c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {E 8e-84
d1n8pa_393 c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Ba 2e-82
d1pffa_331 c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichom 2e-76
d1cl1a_391 c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Esche 8e-69
d2aeua1366 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Ar 2e-28
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-10
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 2e-07
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 2e-06
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 3e-06
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 4e-06
d1m6sa_343 c.67.1.1 (A:) Low-specificity threonine aldolase { 3e-04
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 0.002
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 398 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Cystathionine gamma-synthase, CGS
species: Common tobacco (Nicotiana tabacum) [TaxId: 4097]
 Score =  354 bits (910), Expect = e-119
 Identities = 346/395 (87%), Positives = 375/395 (94%)

Query: 138 ASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGR 197
           ASFL+SDGS+AIHAGERLGRGIVTDAITTPVVNTSAYFF KT+ELIDFKEKRRASFEYGR
Sbjct: 4   ASFLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGR 63

Query: 198 YGNPTTVVVEEKMSALEGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFI 257
           YGNPTTVV+EEK+SALEGAEST++MASGM ASTVMLLALVPAGGHIVTTTDCYRKTRIFI
Sbjct: 64  YGNPTTVVLEEKISALEGAESTLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFI 123

Query: 258 ETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKG 317
           ET+LPKMGITATVIDPAD+  LE ALN   V+LFFTESPTNPFLRCVD++LVS LCH+KG
Sbjct: 124 ETILPKMGITATVIDPADVGALELALNQKKVNLFFTESPTNPFLRCVDIELVSKLCHEKG 183

Query: 318 AIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHV 377
           A+VCIDGTFATPLNQKAL+LGADLVLHSATKF+GGHNDVLAG ISG  KLV++IRNLHH+
Sbjct: 184 ALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNLHHI 243

Query: 378 LGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHI 437
           LGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMA+ILEAHPKV+ V+YPGL+SHPEHHI
Sbjct: 244 LGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSHPEHHI 303

Query: 438 ATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQS 497
           A +QMTGFGG VSFEVDGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDLSQS
Sbjct: 304 AKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQS 363

Query: 498 ERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 532
           +R KYGIMDNLVRFSFGVEDF+DLKAD+LQAL +I
Sbjct: 364 DRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI 398


>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Length = 397 Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Length = 392 Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Length = 421 Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Length = 394 Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 380 Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Length = 384 Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Length = 331 Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 366 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Length = 343 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query532
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 100.0
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 100.0
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 100.0
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 100.0
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 100.0
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 100.0
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 100.0
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 100.0
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.94
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.94
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.94
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.94
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.93
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.93
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.93
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.92
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.92
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.92
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.92
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.91
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.9
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.9
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.9
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.89
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.89
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.89
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.89
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.89
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.88
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.88
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.88
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.88
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.87
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.87
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.86
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.86
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.86
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.86
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.85
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.83
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.82
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.82
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.82
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.82
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.8
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.79
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.78
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.77
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.77
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.75
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.73
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.73
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.73
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.73
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.72
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.71
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.7
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.68
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.68
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.67
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.67
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.65
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.65
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.65
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.64
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.64
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.61
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.61
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.6
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.57
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.56
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.54
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.53
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.49
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.49
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.46
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.45
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.44
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.33
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.33
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.33
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.27
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.26
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.31
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Cystathionine gamma-synthase, CGS
species: Common tobacco (Nicotiana tabacum) [TaxId: 4097]
Probab=100.00  E-value=2.1e-82  Score=662.28  Aligned_cols=396  Identities=87%  Similarity=1.314  Sum_probs=380.3

Q ss_pred             hhcccCCCccccccccCCcCCCCCCCCcccCCcccccccccCChHHHHHHhhcccCCCCCCCCCchhHHHHHHHHHhhhC
Q 009523          136 NEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVVVEEKMSALEG  215 (532)
Q Consensus       136 ~~~~~~~~~~t~~v~~g~~~~~~~~~~~~~~pi~~sst~~~~~~~~~~~~~~~~~~~~~Y~R~~~p~~~~Le~~lA~l~g  215 (532)
                      +|.+|++...|++||+|...+++..+++++||||+||||.|++.+++.+.+.++..+|.|+|.+||+++.||++||+++|
T Consensus         2 ~~~~~~~~~~T~avH~G~~~~~~~~~~av~~PI~~sst~~~~~~~~~~~~~~~~~~~~~Y~R~~nPt~~~LE~~la~LEg   81 (398)
T d1qgna_           2 KYASFLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGRYGNPTTVVLEEKISALEG   81 (398)
T ss_dssp             CCCTTCCSHHHHHHHTTTTTCCSSCCSBSSCCBCCCSBBCBSSHHHHHHHHTTSSCCCCBGGGCCHHHHHHHHHHHHHHT
T ss_pred             CccccCCCCccEEEeCCCcCCCCCCCCCccCCeeCCCcEEeCCHHHHHHHhcCCcCCceecCCCChHHHHHHHHHHHHhC
Confidence            57899999999999999876555568999999999999999999999999988889999999999999999999999999


Q ss_pred             CCcEEEeCCHHHHHHHHHHHhccCCCEEEEcCCCCcchHHHHHHhcccCCcEEEEeCCCCHHHHHHh-hcCCCeeEEEEe
Q 009523          216 AESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAA-LNNNNVSLFFTE  294 (532)
Q Consensus       216 a~~~i~~sSG~~Ai~~al~all~~Gd~VIv~~~~y~~t~~~~~~~l~~~Gv~v~~vd~~dle~Le~a-l~~~~tklV~le  294 (532)
                      ++.+++++|||+|+..++.+++++||+||+++..|++++.++...++++|+++.+++..+.++.++. +++ +|++||+|
T Consensus        82 g~~a~~~sSGMaAi~~~l~~l~~~Gd~iv~~~~~Yg~t~~l~~~~~~~~gi~~~~~~~~~~~~~~~~~~~~-~t~~v~~E  160 (398)
T d1qgna_          82 AESTLLMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFIETILPKMGITATVIDPADVGALELALNQK-KVNLFFTE  160 (398)
T ss_dssp             CSEEEEESCHHHHHHHHHHHHSCSSCEEEEETTSCHHHHHHHHHTGGGGTCEEEEECSSCHHHHHHHHHHS-CEEEEEEE
T ss_pred             CceEEEecCcchHHHHHHhhcccccccccccccccchhhhhhcccccccccccccccccchhhhhhhhccc-cceEEEcc
Confidence            9999999999999999999999999999999999999999999999999999999998777766654 455 79999999


Q ss_pred             CCCCCCCcccCHHHHHHHHHhCCCEEEEECCCCCCCcccccccCCcEEEECCccccCCCCCcEEEEEEeChHHHHHHHHH
Q 009523          295 SPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNL  374 (532)
Q Consensus       295 sP~NptG~v~dl~~I~~la~~~gi~lIvDet~a~~~~~~~l~~gaDivv~S~sK~lgg~gd~~gG~lv~~~~li~~l~~~  374 (532)
                      +|+||++.+.|+++|+++||++|+++|||+||++|+.++|+++|+|||++|+|||++||+|+++|+++++++++..++..
T Consensus       161 spsNP~l~v~Di~~ia~ia~~~g~~~vVDnT~atP~~~~Pl~~GaDiVihS~TKy~~Ghsdv~~G~v~~~~~~~~~~~~~  240 (398)
T d1qgna_         161 SPTNPFLRCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAGCISGPLKLVSEIRNL  240 (398)
T ss_dssp             SSCTTTCCCCCHHHHHHHHHHTTCEEEEECTTTCTTTCCTTTTTCSEEEECTTTTTTCSSSCCCEEEEECHHHHHHHHHH
T ss_pred             CccccccccchHHHHHHHHhhcCCEEEecceeeccccCCchhhCCCEEEEechhhcCcccceeehhhcchhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCCCccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhCCCceEEeCCCCCCCchhhhHhhhcCCcccEEEEEEc
Q 009523          375 HHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVD  454 (532)
Q Consensus       375 ~~~~G~~~~~~~a~l~l~~l~tl~~r~~~~~~~a~~la~~L~~~p~v~~V~~Pgl~s~p~~~l~~~~~~g~G~~vsf~l~  454 (532)
                      +..+|..++|+++|+++++++|+..||+++++|+..+++||++||.|.+|+||+|++||+|+++++|+.|+|++++|+++
T Consensus       241 ~~~~G~~l~p~~a~ll~rgl~TL~lRm~~~~~nA~~lA~~L~~hp~V~~V~yPgL~s~p~~~~~~~~~~g~g~~~sf~~~  320 (398)
T d1qgna_         241 HHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVD  320 (398)
T ss_dssp             HHHHCCCCCHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHTCTTEEEEECTTSSSSTTHHHHHHHCSCCCSEEEEEES
T ss_pred             cccCCCcCCHHHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHhCCCeeecCCCCCCCCcchhhhhhhcCCCCceeeeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHcCCCceeecCCCcccccccCccccccCCCHHHHHhcCCCCCeEEEEecCCCHHHHHHHHHHHHhhC
Q 009523          455 GDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  532 (532)
Q Consensus       455 g~~~~~~~~l~~L~~~~i~vs~G~~~sl~~~pa~~s~~~~~~~~~~~~gi~~~~IRlSvG~ed~~dli~dL~~AL~~l  532 (532)
                      ++.+.+.+|+++|+++.+++|||+++|++++|++++|..++++++...|+++++||||||+||++|||+||++||++|
T Consensus       321 g~~~~a~~f~~~L~l~~~a~SlGg~~SLi~~p~~~th~~~~~~~~~~~Gi~~~liRlSvGlEd~eDLi~Dl~~AL~~i  398 (398)
T d1qgna_         321 GDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  398 (398)
T ss_dssp             SCHHHHHHHHHHCSSSEECSCCCSSSCEEECHHHHHSTTSCHHHHHTTTCCSSEEEEECCSSCHHHHHHHHHHHHHHC
T ss_pred             CCHHHHHHHHHcCCcceeeeCCCCCcceeeCcchhccccCCHHHHHhcCCCcCEEEEEeccCCHHHHHHHHHHHHhcC
Confidence            888899999999999999999999999999999999999999999999999999999999999999999999999976



>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure