Citrus Sinensis ID: 009560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530--
MDIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
ccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccEEccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHccccccEEEEccccccEEEEccccEEEEcccccEEEEEcccccccccEEEEcccccEEEEEccccEEEEEcccccEEEcccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHcccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccccHHHcHHHcEccEccccccEEEEEEccEEEEEccccccEEEEEccccccccEEEEEEEEccEEEEEEEccEEEEEcccccEEEEEEcccccccEEEEEEccccEEEEEcccccEEEEEcccEEEEccccccccccccccHHHcccccccccHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHccccEEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHcccccccccEEEEEEEEEEEccHHHcccHHHHHHHHHHccccccEEEEcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcc
MDIVFSKWVFAFSLSCClifsiapsveglhgnskvrgVNLGGWLVIEgwikpslfdgilngdmldgtqVQIKSVTLEKYVcaesgggtdvsvTRDVASSWETFTLWRVSESefqfrtsqgqfltcdgegcvvsatakspstpetfeiernndsrvhIKLKSGTYLQATLgnqltsdypgmpgwddnaATFEMAIVANNLhgdyqlangyghERAKEVLKRHRNTFITIEDFNFLYrhgintvripvgwwiafdpdppapfiggsLEALDNALSWAEAYNIKCIIdlhaapgsqngmehsasrdgttdwpasdyisQTLDVIDFLASRYAKHPALLGIEllnepsaatvpldiLVPYYKQGYQIVRKYSPTAYVIVCQRignadplelyQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVnewnvtsgtqkdyqDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNnylqlgnspnmqIFNSLVLLGIIFAWLYLHHIL
MDIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCaesgggtdvsvtrDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSAtakspstpetfeiernndsrvhIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
MDIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
**IVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVS*********************VHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHA*******************WPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHI*
**IVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
MDIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPG**************TDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
*DIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIVFSKWVFAFSLSCCLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTLEKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATAKSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEWNIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query532 2.2.26 [Sep-21-2011]
B0XN12416 Probable glucan 1,3-beta- N/A no 0.539 0.689 0.319 6e-35
Q4WK60416 Probable glucan 1,3-beta- yes no 0.539 0.689 0.319 7e-35
A1CRV0415 Probable glucan 1,3-beta- N/A no 0.537 0.689 0.313 3e-34
Q0CR35416 Probable glucan 1,3-beta- N/A no 0.518 0.663 0.322 1e-33
A2RAR6416 Probable glucan 1,3-beta- yes no 0.531 0.680 0.297 2e-33
A1D4Q5416 Probable glucan 1,3-beta- N/A no 0.539 0.689 0.319 3e-33
Q5B5X8405 Probable glucan 1,3-beta- no no 0.447 0.587 0.377 3e-33
Q7Z9L3405 Glucan 1,3-beta-glucosida yes no 0.449 0.590 0.344 3e-32
B8N151405 Probable glucan 1,3-beta- N/A no 0.449 0.590 0.344 3e-32
Q12700425 Glucan 1,3-beta-glucosida N/A no 0.402 0.503 0.342 2e-30
>sp|B0XN12|EXGA_ASPFC Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgA PE=3 SV=1 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 105/329 (31%), Positives = 157/329 (47%), Gaps = 42/329 (12%)

Query: 202 DYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFI 261
           ++ L    G ++AK VL +H +TFIT +DF  + + G+N VRIP+G+W A    P  P++
Sbjct: 72  EWTLTATLGQDQAKAVLSQHWSTFITQDDFQQIAQAGMNHVRIPIGYW-AVSSLPDEPYV 130

Query: 262 GGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVI 321
            G LE LDNA+SWA    +K +IDLH APGSQNG ++S  R G   W   D +SQT+D  
Sbjct: 131 DGQLEYLDNAISWAREAGLKVVIDLHGAPGSQNGFDNSG-RKGPIAWQQGDTVSQTVDAF 189

Query: 322 DFLASRY-AKHPALLGIELLNEPS-AATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRI 379
             LA RY  +   +  IE LNEP+    V    L  YY Q   +VR+  P   V +    
Sbjct: 190 RALAERYLPQSDVVTAIEALNEPNIPGGVSEAGLRDYYNQIADVVRQIDPDTSVFLSDGF 249

Query: 380 GNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMST----------------VDNILFI 423
            + +    ++      ++V+D H+Y +FD + +++                   D  + +
Sbjct: 250 LSTESWNGFKTG---EDVVMDTHHYEMFDNYLISLDIDGHVKSACDFGKQIEGSDKPVVV 306

Query: 424 YKSREAQLQALNNANGPLV---FIGEWVNE------WNVTSGTQKDYQD--------FGS 466
            +   A      + NG  V   + GE+ N        N T G+  D  D        F  
Sbjct: 307 GEWSGAVTDCTKHLNGKGVSTRYQGEYANNVKYGDCANTTQGSVADLSDQERTDTRRFIE 366

Query: 467 AQLEVYNAASFGWAYWTLKND-RKHWDFE 494
           AQL+ Y   + GW +WT K +    WD +
Sbjct: 367 AQLDAYEGKN-GWLFWTWKTEGAPGWDMQ 394
Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. It could also function biosynthetically as a transglycosylase.
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (taxid: 451804)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 8
>sp|Q4WK60|EXGA_ASPFU Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|A1CRV0|EXGA_ASPCL Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgA PE=3 SV=2 Back     alignment and function description
>sp|Q0CR35|EXGA_ASPTN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|A2RAR6|EXGA_ASPNC Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|A1D4Q5|EXGA_NEOFI Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q5B5X8|EXGA_EMENI Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=exgA PE=3 SV=2 Back     alignment and function description
>sp|Q7Z9L3|EXGA_ASPOR Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgA PE=1 SV=1 Back     alignment and function description
>sp|B8N151|EXGA_ASPFN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q12700|EXG_SCHOC Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query532
255585772515 conserved hypothetical protein [Ricinus 0.960 0.992 0.808 0.0
357463267533 Glucan 1,3-beta-glucosidase [Medicago tr 1.0 0.998 0.776 0.0
359480510539 PREDICTED: probable glucan 1,3-beta-gluc 0.968 0.955 0.767 0.0
297741840592 unnamed protein product [Vitis vinifera] 0.996 0.895 0.760 0.0
449451405530 PREDICTED: probable glucan 1,3-beta-gluc 0.981 0.984 0.743 0.0
224097198494 predicted protein [Populus trichocarpa] 0.885 0.953 0.805 0.0
242095140539 hypothetical protein SORBIDRAFT_10g00750 0.949 0.936 0.663 0.0
357141656538 PREDICTED: probable glucan 1,3-beta-gluc 0.956 0.946 0.633 0.0
125561948537 hypothetical protein OsI_29647 [Oryza sa 0.968 0.959 0.631 0.0
42408166532 putative 1,3-beta glucanase [Oryza sativ 0.919 0.919 0.649 0.0
>gi|255585772|ref|XP_002533566.1| conserved hypothetical protein [Ricinus communis] gi|223526566|gb|EEF28823.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/517 (80%), Positives = 461/517 (89%), Gaps = 6/517 (1%)

Query: 17  CLIFSIAPSVEGLHGNSKVRGVNLGGWLVIEGWIKPSLFDGILNGDMLDGTQVQIKSVTL 76
           CLI      VEGL  +SKVRGVNLGGWLV+EGWIKPSLFDGI NGDMLDGT+VQ+KSV  
Sbjct: 4   CLI-----QVEGLREDSKVRGVNLGGWLVVEGWIKPSLFDGIPNGDMLDGTEVQLKSVIS 58

Query: 77  EKYVCAESGGGTDVSVTRDVASSWETFTLWRVSESEFQFRTSQGQFLTCDGEGCVVSATA 136
           +KY+ AE+GGG  V+V RD ASSWETF LWR SE EFQ  TSQGQFLTCDGEGC +SATA
Sbjct: 59  QKYLSAENGGGMGVTVDRDAASSWETFRLWRHSELEFQLHTSQGQFLTCDGEGCSISATA 118

Query: 137 KSPSTPETFEIERNNDSRVHIKLKSGTYLQATLGNQLTSDYPGMPGWDDNAATFEMAIVA 196
            S S   TF IERNN++RVHIKL SGTYLQA+ GNQL +DYPG PGWDDNAATFEM ++A
Sbjct: 119 NSSSAGTTFFIERNNNNRVHIKLNSGTYLQASTGNQLRADYPGKPGWDDNAATFEMTVIA 178

Query: 197 NNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDP 256
           NNLHGDYQLANGYGH +AKE+LK+HRNT IT+EDF FL++HGINTVRIPVGWWIAFDPDP
Sbjct: 179 NNLHGDYQLANGYGHSKAKEILKKHRNTLITVEDFKFLFKHGINTVRIPVGWWIAFDPDP 238

Query: 257 PAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPAS-DYIS 315
           PAPFIGGSLEALDNA SWA+AY+I+CIIDLHAAPGSQNGMEHSASRDGTT WP S DYIS
Sbjct: 239 PAPFIGGSLEALDNAFSWAQAYDIRCIIDLHAAPGSQNGMEHSASRDGTTGWPTSADYIS 298

Query: 316 QTLDVIDFLASRYAKHPALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIV 375
           QTL+VIDFLASRYA+HPALLGIELLNEPSAA+VPL++LVPYYKQGY+IVRKYSP AYVI+
Sbjct: 299 QTLNVIDFLASRYARHPALLGIELLNEPSAASVPLEVLVPYYKQGYEIVRKYSPNAYVII 358

Query: 376 CQRIGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALN 435
           CQRIGNADPLELYQANIG HNIVVDLHYYNLFDTFFVNMS+ DNI FIYKSREAQLQALN
Sbjct: 359 CQRIGNADPLELYQANIGSHNIVVDLHYYNLFDTFFVNMSSEDNIQFIYKSREAQLQALN 418

Query: 436 NANGPLVFIGEWVNEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKNDRKHWDFEW 495
           +ANGPL+FIGEWVNEWNVTSG+Q DYQDFG AQLEVY+AASFGWAYWTLKNDRKHWDFEW
Sbjct: 419 SANGPLIFIGEWVNEWNVTSGSQTDYQDFGKAQLEVYDAASFGWAYWTLKNDRKHWDFEW 478

Query: 496 NIRNNYLQLGNSPNMQIFNSLVLLGIIFAWLYLHHIL 532
           NIRN YLQ GNSP  +IFN + LLG++    +LHH++
Sbjct: 479 NIRNRYLQFGNSPAKEIFNRVALLGLVSTCFFLHHLI 515

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357463267|ref|XP_003601915.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355490963|gb|AES72166.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359480510|ref|XP_002262875.2| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741840|emb|CBI33153.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449451405|ref|XP_004143452.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224097198|ref|XP_002310872.1| predicted protein [Populus trichocarpa] gi|222853775|gb|EEE91322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242095140|ref|XP_002438060.1| hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor] gi|241916283|gb|EER89427.1| hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357141656|ref|XP_003572302.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|125561948|gb|EAZ07396.1| hypothetical protein OsI_29647 [Oryza sativa Indica Group] gi|125603795|gb|EAZ43120.1| hypothetical protein OsJ_27710 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|42408166|dbj|BAD09304.1| putative 1,3-beta glucanase [Oryza sativa Japonica Group] gi|42409390|dbj|BAD10703.1| putative 1,3-beta glucanase [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query532
ASPGD|ASPL0000016384405 exgC [Emericella nidulans (tax 0.445 0.585 0.366 2.7e-49
POMBASE|SPBC1105.05407 exg1 "glucan 1,6-beta-glucosid 0.372 0.486 0.339 2e-41
CGD|CAL0006153438 XOG1 [Candida albicans (taxid: 0.404 0.490 0.346 1.3e-30
UNIPROTKB|P29717438 XOG1 "Glucan 1,3-beta-glucosid 0.404 0.490 0.346 1.3e-30
CGD|CAL0006247525 SPR1 [Candida albicans (taxid: 0.454 0.460 0.25 1.4e-23
UNIPROTKB|Q59Z61525 SPR1 "Putative uncharacterized 0.454 0.460 0.25 1.4e-23
CGD|CAL0006050479 EXG2 [Candida albicans (taxid: 0.295 0.327 0.313 2.2e-22
UNIPROTKB|Q5AIA1479 EXG2 "Putative uncharacterized 0.295 0.327 0.313 2.2e-22
SGD|S000005716445 SPR1 "Sporulation-specific exo 0.377 0.451 0.328 3.1e-21
POMBASE|SPBC2D10.05464 exg3 "glucan 1,3-beta-glucosid 0.509 0.584 0.274 1e-20
ASPGD|ASPL0000016384 exgC [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 2.7e-49, Sum P(3) = 2.7e-49
 Identities = 91/248 (36%), Positives = 132/248 (53%)

Query:   202 DYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFI 261
             +Y L    G E A   L  H NTFIT EDF  +   G+N VRIP+G+W A   D   P++
Sbjct:    59 EYTLTEVLGVEEAAARLSEHWNTFITEEDFALIAEAGLNYVRIPIGYWAAAPLDGE-PYV 117

Query:   262 GGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVI 321
              G LE LDNA++WA A+N+K I+DLH APGSQNG ++S  R G   W   D + QT+   
Sbjct:   118 SGQLEHLDNAVAWARAHNLKVIVDLHGAPGSQNGFDNSGRR-GPIGWQQGDTVEQTILAF 176

Query:   322 DFLASRY-AKHPALLGIELLNEPSA-ATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQRI 379
             + LA RY A    +  IE LNEP     +  D L  YY++    VRK SP A +++    
Sbjct:   177 ETLAQRYLADDDTVTMIEALNEPHVPGGINQDQLKDYYEETLARVRKNSPEATLLLHDGF 236

Query:   380 GNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQALNNANG 439
                +    +       N+++D H+Y +F+    N  +++    I  + +   Q L  A+ 
Sbjct:   237 VQTEGWNGFMTG---ENVMMDTHHYEVFEGG-QNAWSIEK--HIDAACQLGRQHLQAADK 290

Query:   440 PLVFIGEW 447
             P++ +GEW
Sbjct:   291 PVI-VGEW 297
GO:0004338 "glucan exo-1,3-beta-glucosidase activity" evidence=IEA;RCA
GO:0044042 "glucan metabolic process" evidence=RCA
GO:0009277 "fungal-type cell wall" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0046557 "glucan endo-1,6-beta-glucosidase activity" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0006073 "cellular glucan metabolic process" evidence=IEA
POMBASE|SPBC1105.05 exg1 "glucan 1,6-beta-glucosidase Exg1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006153 XOG1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P29717 XOG1 "Glucan 1,3-beta-glucosidase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
CGD|CAL0006247 SPR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59Z61 SPR1 "Putative uncharacterized protein SPR1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
CGD|CAL0006050 EXG2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AIA1 EXG2 "Putative uncharacterized protein EXG2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000005716 SPR1 "Sporulation-specific exo-1,3-beta-glucanase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPBC2D10.05 exg3 "glucan 1,3-beta-glucosidase Exg3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.4LOW CONFIDENCE prediction!
3rd Layer3.2.10.691
3rd Layer3.2.1.58LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
COG2730407 COG2730, BglC, Endoglucanase [Carbohydrate transpo 1e-22
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 2e-22
cd00257119 cd00257, Fascin, Fascin-like domain; members inclu 2e-12
cd00257119 cd00257, Fascin, Fascin-like domain; members inclu 3e-05
pfam06268108 pfam06268, Fascin, Fascin domain 2e-04
>gnl|CDD|225344 COG2730, BglC, Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score =  100 bits (250), Expect = 1e-22
 Identities = 76/340 (22%), Positives = 127/340 (37%), Gaps = 37/340 (10%)

Query: 198 NLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWI--AFDPD 255
            L G        G+  A+ +L+ H   FIT EDF+ +   G N VRIP+G+W   A D D
Sbjct: 46  QLVGVSWFGLNLGNHLAQGLLESHWGNFITEEDFDQIKSAGFNAVRIPIGYWALQATDGD 105

Query: 256 PPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYIS 315
            P       L+ LD A++WA+   I  +IDLH  PG  NG EHS       +   ++ + 
Sbjct: 106 NPYLIGLTQLKILDEAINWAKKLGIYVLIDLHGYPGGNNGHEHSGYTSDYKE--ENENVE 163

Query: 316 QTLDVIDFLASRYAKHPALLGIELLNEPSAATVP---LDILVPYYKQGYQIVRKYSPTAY 372
            T+D+  F+A+R+  +  ++G EL+NEP+               Y      +   +P   
Sbjct: 164 ATIDIWKFIANRFKNYDTVIGFELINEPNGIVTSETWNGGDDEAYDVVRNAILSNAPHWL 223

Query: 373 VIV---CQRIGNADPLELY-QANIGLHNIVVDLHYYNLFDTFFVNMSTVDNI-LFIYKSR 427
           + V               Y  ++ G  N V  +   +   T   ++         +    
Sbjct: 224 IRVGGQGLNGWRVIMAHTYGSSDGGNDNGVYIVPVDDPGLTANKHLYAPHVYGDDVLNGG 283

Query: 428 EA---------------QLQALNN---ANGPLVFIGEWVNEWNVTSGTQKD-----YQDF 464
                             L  + +    NG    IGE+   +N  +   +D      + +
Sbjct: 284 SWTVGGEFDLAETDCAIWLNYVGHGARKNGYPTVIGEFGGNYNANNPNPQDERKDNVKVY 343

Query: 465 GSAQLEVYNAASFGWAYWTLK-NDRKHWDFEWNIRNNYLQ 503
              QL+V++     W        +   +D E +I      
Sbjct: 344 LENQLDVFDTT-TYWINNPWSGGNDTGYDIEDDINLGLFP 382

Length = 407
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information
>gnl|CDD|238160 cd00257, Fascin, Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>gnl|CDD|238160 cd00257, Fascin, Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>gnl|CDD|203418 pfam06268, Fascin, Fascin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 532
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 100.0
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.95
cd00257119 Fascin Fascin-like domain; members include actin-b 99.84
TIGR03356427 BGL beta-galactosidase. 99.74
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.73
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 99.72
PF06268111 Fascin: Fascin domain; InterPro: IPR022768 This fa 99.68
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 99.67
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 99.51
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.5
PRK13511 469 6-phospho-beta-galactosidase; Provisional 99.49
PLN02849 503 beta-glucosidase 99.48
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 99.47
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.47
PLN02814 504 beta-glucosidase 99.46
PLN02998 497 beta-glucosidase 99.46
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 99.45
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 99.44
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.39
PRK10150604 beta-D-glucuronidase; Provisional 99.34
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 99.26
KOG0626 524 consensus Beta-glucosidase, lactase phlorizinhydro 99.24
cd00257119 Fascin Fascin-like domain; members include actin-b 99.17
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 99.15
PF06268111 Fascin: Fascin domain; InterPro: IPR022768 This fa 99.06
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 99.04
PF06229191 FRG1: FRG1-like family; InterPro: IPR010414 This e 98.96
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 98.92
PF06229191 FRG1: FRG1-like family; InterPro: IPR010414 This e 98.7
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 98.7
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 98.63
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 98.49
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 98.49
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.47
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 98.29
PF14488166 DUF4434: Domain of unknown function (DUF4434) 98.29
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.19
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 98.06
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 97.93
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 97.81
PLN03059 840 beta-galactosidase; Provisional 97.62
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 97.57
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 97.48
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 97.41
COG3250 808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 97.35
PF02055496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 97.13
KOG3962246 consensus Predicted actin-bundling protein [Cytosk 97.12
COG5520433 O-Glycosyl hydrolase [Cell envelope biogenesis, ou 96.9
PF07468153 Agglutinin: Agglutinin; InterPro: IPR008998 Agglut 96.74
PRK12568 730 glycogen branching enzyme; Provisional 96.53
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 96.26
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 96.25
PLN02447 758 1,4-alpha-glucan-branching enzyme 96.15
smart00791139 Agglutinin Amaranthus caudatus agglutinin or amara 96.11
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 95.81
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 95.8
PRK14705 1224 glycogen branching enzyme; Provisional 95.78
PF00167122 FGF: Fibroblast growth factor; InterPro: IPR002348 95.76
smart00642166 Aamy Alpha-amylase domain. 95.73
PRK10785598 maltodextrin glucosidase; Provisional 95.7
PLN00197 573 beta-amylase; Provisional 95.66
PLN02161 531 beta-amylase 95.62
PF13200316 DUF4015: Putative glycosyl hydrolase domain 95.61
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 95.59
PRK05402 726 glycogen branching enzyme; Provisional 95.56
PLN02801 517 beta-amylase 95.54
PRK12313 633 glycogen branching enzyme; Provisional 95.53
PLN02803 548 beta-amylase 95.44
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 95.34
PLN02705 681 beta-amylase 95.26
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 95.25
KOG2233 666 consensus Alpha-N-acetylglucosaminidase [Intracell 95.13
PLN02960 897 alpha-amylase 95.09
PLN02905 702 beta-amylase 95.08
KOG2230 867 consensus Predicted beta-mannosidase [Carbohydrate 94.99
KOG0496 649 consensus Beta-galactosidase [Carbohydrate transpo 94.98
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 94.88
PF01373402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 94.84
PF00167122 FGF: Fibroblast growth factor; InterPro: IPR002348 94.54
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 94.51
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 94.03
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 93.84
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 93.8
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 93.75
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 93.63
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 93.6
smart00791139 Agglutinin Amaranthus caudatus agglutinin or amara 93.43
PF05089333 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-b 93.28
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 93.24
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 92.59
PLN02877 970 alpha-amylase/limit dextrinase 92.42
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 92.32
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 92.21
KOG3962246 consensus Predicted actin-bundling protein [Cytosk 91.68
PRK03705 658 glycogen debranching enzyme; Provisional 91.35
PRK14706 639 glycogen branching enzyme; Provisional 91.28
cd00058123 FGF Acidic and basic fibroblast growth factor fami 91.16
PF07468153 Agglutinin: Agglutinin; InterPro: IPR008998 Agglut 91.08
PLN00196428 alpha-amylase; Provisional 91.02
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 90.97
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 90.95
KOG2566518 consensus Beta-glucocerebrosidase [Carbohydrate tr 90.31
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 90.05
PLN02361401 alpha-amylase 90.02
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 89.79
smart00442126 FGF Acidic and basic fibroblast growth factor fami 89.6
PRK05904353 coproporphyrinogen III oxidase; Provisional 89.16
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 88.8
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 88.43
PRK09505 683 malS alpha-amylase; Reviewed 87.77
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 87.62
PRK07379400 coproporphyrinogen III oxidase; Provisional 87.35
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 87.04
cd00058123 FGF Acidic and basic fibroblast growth factor fami 86.91
COG3664 428 XynB Beta-xylosidase [Carbohydrate transport and m 86.72
smart00442126 FGF Acidic and basic fibroblast growth factor fami 86.69
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 86.15
PRK05799374 coproporphyrinogen III oxidase; Provisional 86.04
PRK05628375 coproporphyrinogen III oxidase; Validated 84.8
PRK06294370 coproporphyrinogen III oxidase; Provisional 84.57
PRK08208430 coproporphyrinogen III oxidase; Validated 84.29
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 83.8
PRK05660378 HemN family oxidoreductase; Provisional 83.78
PRK14511 879 maltooligosyl trehalose synthase; Provisional 83.73
PLN02784894 alpha-amylase 83.68
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 83.3
KOG0470 757 consensus 1,4-alpha-glucan branching enzyme/starch 81.65
PRK08599377 coproporphyrinogen III oxidase; Provisional 81.38
PRK08446350 coproporphyrinogen III oxidase; Provisional 81.08
PRK13347453 coproporphyrinogen III oxidase; Provisional 81.03
COG3589360 Uncharacterized conserved protein [Function unknow 80.93
PRK09249453 coproporphyrinogen III oxidase; Provisional 80.37
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=100.00  E-value=2.4e-34  Score=289.46  Aligned_cols=253  Identities=30%  Similarity=0.404  Sum_probs=183.2

Q ss_pred             hcccc-CCHHHHHHHHHcCCCEEEEccccccccCCCCCCCCCcChHHHHHHHHHHHHHcCCEEEEEcCCCCCCCCCCCCC
Q 009560          221 HRNTF-ITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHS  299 (532)
Q Consensus       221 hw~t~-ite~d~~~la~~G~N~VRIpv~ww~~~~~~~~~~~~~~~l~~Ld~~v~~a~k~Gi~VILDlH~~pGsqn~~~~s  299 (532)
                      ||.+. +++++|+.|+++|+|+|||||.|....++.++..+++..+++||++|++|+++||+||||+|..|+..+..   
T Consensus        16 ~w~~~~~~~~~~~~~~~~G~n~VRi~v~~~~~~~~~~~~~~~~~~~~~ld~~v~~a~~~gi~vild~h~~~~w~~~~---   92 (281)
T PF00150_consen   16 HWYNPSITEADFDQLKALGFNTVRIPVGWEAYQEPNPGYNYDETYLARLDRIVDAAQAYGIYVILDLHNAPGWANGG---   92 (281)
T ss_dssp             TTSGGGSHHHHHHHHHHTTESEEEEEEESTSTSTTSTTTSBTHHHHHHHHHHHHHHHHTT-EEEEEEEESTTCSSST---
T ss_pred             ccCCCCCHHHHHHHHHHCCCCEEEeCCCHHHhcCCCCCccccHHHHHHHHHHHHHHHhCCCeEEEEeccCccccccc---
Confidence            35543 88999999999999999999998666656665567788999999999999999999999999986542211   


Q ss_pred             CCCCCCCCCCChhhHHHHHHHHHHHHHHhCCCCcEEEEEeccCCCCCCCC-------cccHHHHHHHHHHHHHhhCCCcE
Q 009560          300 ASRDGTTDWPASDYISQTLDVIDFLASRYAKHPALLGIELLNEPSAATVP-------LDILVPYYKQGYQIVRKYSPTAY  372 (532)
Q Consensus       300 g~~~g~~~W~~~~~~~~~~~~w~~la~ry~~~p~v~g~EL~NEP~~~~~~-------~~~l~~~~~~~~~aIR~~~~~~~  372 (532)
                           ......+...+.+.++|+.|++||++++.+++|||+|||......       .+.+.+++++++++||+++|+++
T Consensus        93 -----~~~~~~~~~~~~~~~~~~~la~~y~~~~~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~~~~~~~~Ir~~~~~~~  167 (281)
T PF00150_consen   93 -----DGYGNNDTAQAWFKSFWRALAKRYKDNPPVVGWELWNEPNGGNDDANWNAQNPADWQDWYQRAIDAIRAADPNHL  167 (281)
T ss_dssp             -----STTTTHHHHHHHHHHHHHHHHHHHTTTTTTEEEESSSSGCSTTSTTTTSHHHTHHHHHHHHHHHHHHHHTTSSSE
T ss_pred             -----cccccchhhHHHHHhhhhhhccccCCCCcEEEEEecCCccccCCccccccccchhhhhHHHHHHHHHHhcCCcce
Confidence                 111122456777889999999999999999999999999985322       26789999999999999999999


Q ss_pred             EEEeCC-CCCCCchh-hhhcc-CCCCcEEEEeeecccCCCccccC-ChhhhHHHHHHHHHHHHHHHHhcCCCcEEEeccC
Q 009560          373 VIVCQR-IGNADPLE-LYQAN-IGLHNIVVDLHYYNLFDTFFVNM-STVDNILFIYKSREAQLQALNNANGPLVFIGEWV  448 (532)
Q Consensus       373 Viv~~~-~~~~~~~~-~~~~~-~~~~nvv~s~H~Y~~f~~~~~~~-~~~~~i~~i~~~~~~~~~~~~~~~g~pv~vGEwG  448 (532)
                      |++++. |+ .+... ....| ....++++++|+|.++....... ........+...+...... ....+.||+|||||
T Consensus       168 i~~~~~~~~-~~~~~~~~~~P~~~~~~~~~~~H~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~g~pv~~gE~G  245 (281)
T PF00150_consen  168 IIVGGGGWG-ADPDGAAADNPNDADNNDVYSFHFYDPYDFSDQWNPGNWGDASALESSFRAALNW-AKKNGKPVVVGEFG  245 (281)
T ss_dssp             EEEEEHHHH-TBHHHHHHHSTTTTTTSEEEEEEEETTTCHHTTTSTCSHHHHHHHHHHHHHHHHH-HHHTTSEEEEEEEE
T ss_pred             eecCCCccc-cccchhhhcCcccccCceeEEeeEeCCCCcCCccccccchhhhHHHHHHHHHHHH-HHHcCCeEEEeCcC
Confidence            999863 32 23222 23333 24789999999999865321111 1122223333333333333 34567899999999


Q ss_pred             cccCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEEcccCC
Q 009560          449 NEWNVTSGTQKDYQDFGSAQLEVYNAASFGWAYWTLKND  487 (532)
Q Consensus       449 ~~~~~~~a~~~~~~~~~~~ql~~~~~~~~Gw~yW~~k~e  487 (532)
                      ..... +.   ....+..+.++.+++.++||+||+|+.+
T Consensus       246 ~~~~~-~~---~~~~~~~~~~~~~~~~~~g~~~W~~~~~  280 (281)
T PF00150_consen  246 WSNND-GN---GSTDYADAWLDYLEQNGIGWIYWSWKPN  280 (281)
T ss_dssp             SSTTT-SC---HHHHHHHHHHHHHHHTTCEEEECEESSS
T ss_pred             CcCCC-CC---cCHHHHHHHHHHHHHCCCeEEEEecCCC
Confidence            86321 11   3344555557888889999999999974

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG3962 consensus Predicted actin-bundling protein [Cytoskeleton] Back     alignment and domain information
>COG5520 O-Glycosyl hydrolase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07468 Agglutinin: Agglutinin; InterPro: IPR008998 Agglutinins are sugar-specific lectins that can agglutinate erythrocytes and other cell types Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>smart00791 Agglutinin Amaranthus caudatus agglutinin or amaranthin is a lectin from the ancient South American crop, amaranth grain Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00167 FGF: Fibroblast growth factor; InterPro: IPR002348 The interleukin-1 (IL1) and heparin-binding growth factor (HBGF) families share low sequence similarity (about 25% []) but have very similar structures Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>KOG2230 consensus Predicted beta-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0496 consensus Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00167 FGF: Fibroblast growth factor; InterPro: IPR002348 The interleukin-1 (IL1) and heparin-binding growth factor (HBGF) families share low sequence similarity (about 25% []) but have very similar structures Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00791 Agglutinin Amaranthus caudatus agglutinin or amaranthin is a lectin from the ancient South American crop, amaranth grain Back     alignment and domain information
>PF05089 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain; InterPro: IPR024733 Alpha-N-acetylglucosaminidase is a lysosomal enzyme that is required for the stepwise degradation of heparan sulphate [] Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>KOG3962 consensus Predicted actin-bundling protein [Cytoskeleton] Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd00058 FGF Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin Back     alignment and domain information
>PF07468 Agglutinin: Agglutinin; InterPro: IPR008998 Agglutinins are sugar-specific lectins that can agglutinate erythrocytes and other cell types Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>KOG2566 consensus Beta-glucocerebrosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>smart00442 FGF Acidic and basic fibroblast growth factor family Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd00058 FGF Acidic and basic fibroblast growth factor family; FGFs are mitogens, which stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin Back     alignment and domain information
>COG3664 XynB Beta-xylosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00442 FGF Acidic and basic fibroblast growth factor family Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
1eqp_A394 Exo-B-(1,3)-Glucanase From Candida Albicans Length 8e-28
3n9k_A399 F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase 9e-28
2pc8_A400 E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida 1e-27
2pbo_A400 E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida A 1e-27
2pb1_A400 Exo-b-(1,3)-glucanase From Candida Albicans In Comp 1e-27
1cz1_A394 Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 2e-27
3o6a_A399 F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase 5e-27
2pf0_A400 F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida 7e-27
1h4p_A408 Crystal Structure Of Exo-1,3-Beta Glucanse From Sac 6e-21
1cec_A343 A Common Protein Fold And Similar Active Site In Tw 3e-10
1cen_A343 Cellulase (Celc) Mutant With Glu 140 Replaced By Gl 4e-10
3mmu_A317 Crystal Structure Of Endoglucanase Cel5a From The H 2e-06
3azr_A317 Diverse Substrates Recognition Mechanism Revealed B 2e-06
3amg_A317 Crystal Structures Of Thermotoga Maritima Cel5a In 1e-05
3aof_A317 Crystal Structures Of Thermotoga Maritima Cel5a In 1e-05
1vjz_A341 Crystal Structure Of Endoglucanase (Tm1752) From Th 8e-04
>pdb|1EQP|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans Length = 394 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 123/227 (54%), Gaps = 14/227 (6%)
Query: 202 DYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFI 261
           +Y      G E A  +L++H +T+IT +DF  +   G+N VRIP+G+W AF      P++
Sbjct: 45  EYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYW-AFQLLDNDPYV 103
Query: 262 GGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVI 321
            G ++ L+ AL WA   NI+  IDLH APGSQNG ++S  RD + ++   D    TL+V+
Sbjct: 104 QGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRD-SYNFQNGDNTQVTLNVL 162
Query: 322 DFLASRYAKHP---ALLGIELLNEPSAATVPLDILVPYYKQGYQIVRKYSPTAYVIVCQR 378
           + +  +Y  +     ++GIELLNEP    + +D L  ++  GY  +R+      VI    
Sbjct: 163 NTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVI---- 218
Query: 379 IGNADPLELYQANI-----GLHNIVVDLHYYNLFDTFFVNMSTVDNI 420
           I +A  +  Y  N      G  N+VVD H+Y +F    ++ +  D+I
Sbjct: 219 IHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHI 265
>pdb|3N9K|A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A Length = 399 Back     alignment and structure
>pdb|2PC8|A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A Length = 400 Back     alignment and structure
>pdb|2PBO|A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Length = 400 Back     alignment and structure
>pdb|2PB1|A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A Length = 400 Back     alignment and structure
>pdb|1CZ1|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution Length = 394 Back     alignment and structure
>pdb|3O6A|A Chain A, F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans At 2 A Length = 399 Back     alignment and structure
>pdb|2PF0|A Chain A, F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.9 A Length = 400 Back     alignment and structure
>pdb|1H4P|A Chain A, Crystal Structure Of Exo-1,3-Beta Glucanse From Saccharomyces Cerevisiae Length = 408 Back     alignment and structure
>pdb|1CEC|A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases Length = 343 Back     alignment and structure
>pdb|1CEN|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln Complexed With Cellohexaose Length = 343 Back     alignment and structure
>pdb|3MMU|A Chain A, Crystal Structure Of Endoglucanase Cel5a From The Hyperthermophilic Thermotoga Maritima Length = 317 Back     alignment and structure
>pdb|3AZR|A Chain A, Diverse Substrates Recognition Mechanism Revealed By Thermotoga Maritima Cel5a Structures In Complex With Cellobiose Length = 317 Back     alignment and structure
>pdb|3AMG|A Chain A, Crystal Structures Of Thermotoga Maritima Cel5a In Complex With Cellobiose Substrate, Mutant Form Length = 317 Back     alignment and structure
>pdb|3AOF|A Chain A, Crystal Structures Of Thermotoga Maritima Cel5a In Complex With Mannotriose Substrate Length = 317 Back     alignment and structure
>pdb|1VJZ|A Chain A, Crystal Structure Of Endoglucanase (Tm1752) From Thermotoga Maritima At 2.05 A Resolution Length = 341 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query532
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 5e-60
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 3e-07
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 4e-58
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 6e-08
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 1e-54
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 2e-51
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 3e-45
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 2e-37
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 2e-27
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 4e-27
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 3e-26
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 6e-26
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 3e-25
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 3e-25
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 3e-25
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 5e-25
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 5e-24
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 1e-23
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 2e-23
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 2e-22
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 1e-21
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 2e-21
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 1e-20
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 2e-20
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 5e-20
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 1e-19
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 2e-19
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 3e-19
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 2e-18
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 2e-17
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 2e-15
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 3e-15
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 9e-14
3q7x_A132 De novo designed beta-trefoil architecture with S 8e-10
3q7x_A132 De novo designed beta-trefoil architecture with S 2e-04
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 1e-09
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 2e-08
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 5e-08
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 2e-07
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 1e-06
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 1e-07
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 Back     alignment and structure
 Score =  202 bits (515), Expect = 5e-60
 Identities = 81/365 (22%), Positives = 141/365 (38%), Gaps = 45/365 (12%)

Query: 180 MPGWDDNAATFEMAIVANNLHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGI 239
            P   +   T +          +Y      G + AK  L+ H +TF   +DF  +   G 
Sbjct: 29  TPSLFEAFRTNDDNDEGIP-VDEYHFCQYLGKDLAKSRLQSHWSTFYQEQDFANIASQGF 87

Query: 240 NTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHS 299
           N VRIP+G+W     D      G     LD A+ WA   ++K  +DLH A GSQNG ++S
Sbjct: 88  NLVRIPIGYWAFQILDDDPYVSGLQESYLDQAIGWARNNSLKVWVDLHGAAGSQNGFDNS 147

Query: 300 ASRDGTTDWPASDYISQTLDVIDFLASRYAKHPA---LLGIELLNEPSAATVPLD-ILVP 355
             R  +  +     ++ T++V++++  +Y+       ++GIEL+NEP    + +D +   
Sbjct: 148 GLR-DSYKFLEDSNLAVTINVLNYILKKYSAEEYLDIVIGIELINEPLGPVLDMDKMKND 206

Query: 356 YYKQGYQIVRKYSPTAYVIVCQRIGNADP--LELYQANIGLHNIVVDLHYYNLFDTFFVN 413
           Y    Y+ +R    +  VI+            +    N G   + +D H+Y +F +  + 
Sbjct: 207 YLAPAYEYLRNNIKSDQVIIIHDAFQPYNYWDDFMTENDGYWGVTIDHHHYQVFASDQLE 266

Query: 414 MSTVDNILFIYKSREAQLQA-------------------LNNANGPLVFIGEWVNEWNVT 454
            S  ++I    +     L                     LN+      + G WVN    +
Sbjct: 267 RSIDEHIKVACEWGTGVLNESHWIVCGEFAAALTDCIKWLNSVGFGARYDGSWVNGDQTS 326

Query: 455 S----------------GTQKDYQDFGSAQLEVYNAASFGWAYWTLKN-DRKHWDFEWNI 497
           S                  +++ + +  AQL+ +     GW  W  K      WD +  +
Sbjct: 327 SYIGSCANNDDIAYWSDERKENTRRYVEAQLDAFEMRG-GWIIWCYKTESSLEWDAQRLM 385

Query: 498 RNNYL 502
            N   
Sbjct: 386 FNGLF 390
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Length = 344 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Length = 353 Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Length = 155 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Length = 491 Back     alignment and structure
>3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Length = 132 Back     alignment and structure
>3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Length = 132 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Length = 440 Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Length = 373 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Length = 383 Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Length = 399 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query532
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 100.0
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 100.0
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 100.0
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 100.0
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 100.0
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 100.0
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 100.0
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 100.0
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 100.0
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 100.0
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 100.0
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 100.0
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 100.0
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 100.0
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 100.0
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 100.0
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 100.0
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.98
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.98
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.98
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.97
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.97
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.97
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.97
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.97
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.96
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.94
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.94
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.92
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.92
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.91
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 99.88
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.87
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.86
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 99.85
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 99.85
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.84
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.77
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.75
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.74
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.73
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.73
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.72
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.72
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 99.7
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 99.7
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.69
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.67
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.66
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.66
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.65
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.64
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.61
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.6
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.6
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.55
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 99.55
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.54
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.54
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.51
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.49
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.49
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 99.49
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.48
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 99.48
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.47
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.44
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.44
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 99.43
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.42
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.42
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.41
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 99.41
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.4
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.39
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.39
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.38
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.37
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.37
3fn9_A 692 Putative beta-galactosidase; structural genomics, 99.37
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 99.37
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.36
3cmg_A667 Putative beta-galactosidase; structural genomics, 99.36
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.34
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.32
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.3
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.28
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.26
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.25
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 99.23
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.16
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.13
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 99.13
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 99.11
3d3a_A 612 Beta-galactosidase; protein structure initiative I 99.07
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.07
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 99.05
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 99.02
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 99.02
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 98.99
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 98.98
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 98.96
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 98.96
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 98.93
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 98.92
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 98.91
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.91
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.86
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 98.82
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 98.8
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 98.79
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 98.71
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 98.65
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.64
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 98.57
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 98.57
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 98.57
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 98.52
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 98.52
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 98.48
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.36
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 98.27
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 98.22
3clw_A507 Conserved exported protein; structural genomics, u 98.18
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 98.17
3vny_A 488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 98.15
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 98.11
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 98.09
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 97.98
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 97.94
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 97.93
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 97.93
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 97.81
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 97.76
1jlx_A303 Agglutinin, amaranthin, ACA; complex (lectin/sacch 97.17
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 97.05
1hcd_A118 Hisactophilin; actin binding; NMR {Dictyostelium d 97.02
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 96.91
4aw7_A 591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 96.87
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 96.85
1jlx_A303 Agglutinin, amaranthin, ACA; complex (lectin/sacch 96.85
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 96.84
3kl0_A401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 96.75
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 96.61
3ik2_A 517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 96.4
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 96.4
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 96.37
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 96.33
3q7x_A132 De novo designed beta-trefoil architecture with S 96.27
2yih_A 524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 96.17
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 96.1
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 96.05
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 96.05
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 96.04
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 95.98
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 95.76
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 95.75
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 95.66
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 95.61
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 95.5
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 95.49
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 95.49
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 95.45
3tp4_A 475 Computational design of enzyme; structural genomic 95.19
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 95.1
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 95.04
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 94.99
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 94.97
3p6j_A142 De novo designed beta-trefoil architecture with S 94.85
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 94.74
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 94.52
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 94.46
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 94.34
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 94.31
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 94.19
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 94.14
3snv_A143 Symfoil-4T/permutation #1 synthetic protein; beta- 94.13
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 94.07
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 93.53
3snv_A143 Symfoil-4T/permutation #1 synthetic protein; beta- 93.52
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 93.49
3p6i_A142 De novo designed beta-trefoil architecture with S 93.4
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 92.88
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 92.61
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 92.57
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 92.47
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 92.47
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 92.34
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 92.23
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 92.09
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 91.98
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 91.96
1hcd_A118 Hisactophilin; actin binding; NMR {Dictyostelium d 91.91
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 91.88
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 91.63
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 91.6
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 91.56
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 91.56
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 91.55
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 91.53
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 91.4
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 91.21
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 91.21
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 91.16
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 91.03
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 90.97
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 90.75
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 90.69
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 90.54
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 90.43
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 90.2
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 90.11
3ef2_A293 Agglutinin, lectin; beta-trefoil, calcium-binding, 89.91
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 89.85
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 89.65
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 89.62
3p6j_A142 De novo designed beta-trefoil architecture with S 89.43
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 88.95
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 88.69
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 88.67
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 88.45
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 88.31
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 88.14
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 88.03
2e4t_A 519 Endoglucanase, xyloglucanase; TIM barrel, TIM-like 87.91
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 87.42
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 87.41
3q7x_A132 De novo designed beta-trefoil architecture with S 86.96
3phz_A286 Ricin B-related lectin; beta trefoil, saccharide b 86.89
1bfg_A146 Basic fibroblast growth factor; 1.60A {Homo sapien 86.87
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 86.32
1rg8_A146 Heparin-binding growth factor 1; beta-trefoil, hor 85.96
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 85.76
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 85.56
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 85.37
1yht_A367 DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact 84.43
1nun_A145 Fibroblast growth factor-10; beta-trefoil fold, im 84.06
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 83.96
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 83.55
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 83.01
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 82.97
3p6i_A142 De novo designed beta-trefoil architecture with S 82.94
4acy_A382 Endo-alpha-mannosidase; hydrolase, endomannosidase 82.47
1q1u_A144 FGF-12, fibrobast growth factor homologous factor 82.25
3klk_A1039 Glucansucrase; native form, open conformation, mul 81.91
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 81.56
1ihk_A174 GLIA-activating factor; B-trefoil fold, hormone/gr 81.4
1qql_A140 Fibroblast growth factor 7/1 chimera; beta-trefoil 80.63
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 80.51
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
Probab=100.00  E-value=5.1e-62  Score=514.12  Aligned_cols=301  Identities=28%  Similarity=0.503  Sum_probs=259.8

Q ss_pred             CCccceeecccChhhHHHHHHhhccccCCHHHHHHHHHcCCCEEEEccccccccCCCCCCCCCcChHHHHHHHHHHHHHc
Q 009560          199 LHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAY  278 (532)
Q Consensus       199 ~~~e~~l~~~~G~~~a~~~~~~hw~t~ite~d~~~la~~G~N~VRIpv~ww~~~~~~~~~~~~~~~l~~Ld~~v~~a~k~  278 (532)
                      ..+||+||+.+|.++|..++++||++||||+||+.||++|+|+|||||+||.+ ++.+++||..+.+++||++|++|+++
T Consensus        47 ~~dE~~l~~~lG~~~a~~~~~~hw~~~ite~D~~~ik~~G~N~VRipi~~~~~-~~~~~~py~~~~~~~ld~vV~~a~~~  125 (399)
T 3n9k_A           47 PVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAF-QLLDNDPYVQGQVQYLEKALGWARKN  125 (399)
T ss_dssp             CCSHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCEEEEEEEGGGT-CCCTTCCCCCCHHHHHHHHHHHHHHT
T ss_pred             cccHHHHHHHhCHHHHHHHHHHhhcccCcHHHHHHHHHcCCCEEEEcccHHHc-cCCCCCccchhHHHHHHHHHHHHHHC
Confidence            45899999999999999999999999999999999999999999999999975 45556688777999999999999999


Q ss_pred             CCEEEEEcCCCCCCCCCCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHHhCCC---CcEEEEEeccCCCCCCCCcccHHH
Q 009560          279 NIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKH---PALLGIELLNEPSAATVPLDILVP  355 (532)
Q Consensus       279 Gi~VILDlH~~pGsqn~~~~sg~~~g~~~W~~~~~~~~~~~~w~~la~ry~~~---p~v~g~EL~NEP~~~~~~~~~l~~  355 (532)
                      ||+||||+|++||+||+++++|.. +...|.++.++++++++|++||+||+++   |.|++|||+|||..+..+.+.|++
T Consensus       126 Gl~VILDlH~~pG~qng~~~sG~~-~~~~w~~~~~~~~~~~~w~~iA~ry~~~~y~~~V~~~el~NEP~~~~~~~~~~~~  204 (399)
T 3n9k_A          126 NIRVWIDLHGAPGSQNGFDNSGLR-DSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQ  204 (399)
T ss_dssp             TCEEEEEEEECTTCSSCCGGGSST-TCCCTTSTTHHHHHHHHHHHHHHHHSSGGGTTTEEEEESCSCCCGGGSCHHHHHH
T ss_pred             CCEEEEEecCCCcccccccCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHhhcccCCCceEEEEeccCCCCCCCCHHHHHH
Confidence            999999999999999999998865 4568998889999999999999999998   999999999999976556789999


Q ss_pred             HHHHHHHHHHhhCCCcEEEEeCCCCCC-CchhhhhccCCCCcEEEEeeecccCCCccccCChhhhHHHHHHHHHHHHHHH
Q 009560          356 YYKQGYQIVRKYSPTAYVIVCQRIGNA-DPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQAL  434 (532)
Q Consensus       356 ~~~~~~~aIR~~~~~~~Viv~~~~~~~-~~~~~~~~~~~~~nvv~s~H~Y~~f~~~~~~~~~~~~i~~i~~~~~~~~~~~  434 (532)
                      |+++++++||+++|+++|++++++... .+..++..+.+++|+||++|+|.+|+.....++.+++++.+|+.. ..   +
T Consensus       205 ~~~~a~~~IR~~~p~~~Iii~dg~~~~~~W~~~l~~~~~~~nvv~d~H~Y~~f~~~~~~~~~~~~i~~~c~~~-~~---~  280 (399)
T 3n9k_A          205 FFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWG-WD---A  280 (399)
T ss_dssp             HHHHHHHHHHHTTCCCCEEEECTTCCTTTTTTSSCGGGTCCSEEEEEECCSCSSHHHHTSCHHHHHHHHHHHH-HH---H
T ss_pred             HHHHHHHHHHhcCCCCeEEEeCCCCChHHHHhhcccccCCCCEEEEeccccCCCcccccCCHHHHHHHHHHHH-HH---H
Confidence            999999999999999999999887542 334455443467999999999999987777788999999998743 22   2


Q ss_pred             HhcCCCcEEEeccCcccCCCC------------------------------------CCHHHHHHHHHHHHHHHHhCCCc
Q 009560          435 NNANGPLVFIGEWVNEWNVTS------------------------------------GTQKDYQDFGSAQLEVYNAASFG  478 (532)
Q Consensus       435 ~~~~g~pv~vGEwG~~~~~~~------------------------------------a~~~~~~~~~~~ql~~~~~~~~G  478 (532)
                      .+ .+.|+|||||++..+.+.                                    ..++.+++|+++|+++|++ +.|
T Consensus       281 ~~-~~~~~ivGEwS~a~~dc~~~lng~~~g~r~~gt~~~~~~~g~c~~~~~~~~~~~~~k~~~~~f~~aQ~~~~e~-~~G  358 (399)
T 3n9k_A          281 KK-ESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEY-TGG  358 (399)
T ss_dssp             HT-CSSEEEEEECCSCSSSCSTTTTCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHHHHHHHHHHHHHHHT-TTE
T ss_pred             hc-CCCCEEEEecccccccchhhccCCCccccccccCCCCCcCCcCcCcCccccccHHHHHHHHHHHHHHHHHHHc-CCc
Confidence            33 347899999998764210                                    1245689999999999996 569


Q ss_pred             EEEEcccCC-CCCCchHhhHhCCcccCCCC
Q 009560          479 WAYWTLKND-RKHWDFEWNIRNNYLQLGNS  507 (532)
Q Consensus       479 w~yW~~k~e-~~~Ws~~~~~~~g~~~~~~~  507 (532)
                      |+||+||.| ...|||+.++++|+||..+.
T Consensus       359 w~fWtwK~e~~~~W~~~~~~~~g~~p~~~~  388 (399)
T 3n9k_A          359 WVFWSWKTENAPEWSFQTLTYNGLFPQPVT  388 (399)
T ss_dssp             EEESCSCCSSCGGGCHHHHHHTTCSCSSTT
T ss_pred             EEEeeeecCCCCCCCHHHHHhCCCcCCChh
Confidence            999999999 68899999999999996553
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>3p6j_A De novo designed beta-trefoil architecture with S primary structure; de novo protein; 1.35A {Synthetic} Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3snv_A Symfoil-4T/permutation #1 synthetic protein; beta-trefoil, de novo protein; 2.20A {Homo sapiens} Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>3snv_A Symfoil-4T/permutation #1 synthetic protein; beta-trefoil, de novo protein; 2.20A {Homo sapiens} Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3p6i_A De novo designed beta-trefoil architecture with S primary structure; de novo protein; HET: SO4; 1.32A {Synthetic} PDB: 3ogf_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3p6j_A De novo designed beta-trefoil architecture with S primary structure; de novo protein; 1.35A {Synthetic} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>2e4t_A Endoglucanase, xyloglucanase; TIM barrel, TIM-like barrel, composite domain of glycosyl HY families 5, 30, 39 and 51, hydrolase; 0.96A {Clostridium thermocellum} PDB: 2e0p_A 2eo7_A* 2ej1_A* 2eex_A* 2eqd_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>1bfg_A Basic fibroblast growth factor; 1.60A {Homo sapiens} SCOP: b.42.1.1 PDB: 1iil_A 1ii4_A 1bas_A 1bla_A 1bld_A 1bfb_A* 1bfc_A* 4fgf_A 1fga_A 2fgf_A 1ev2_A 1cvs_A 1fq9_A* 1bff_A 2bfh_A Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1rg8_A Heparin-binding growth factor 1; beta-trefoil, hormone/growth factor complex; 1.10A {Homo sapiens} SCOP: b.42.1.1 PDB: 1jqz_A 3fjb_A 1jt3_A 1jt4_A 1jtc_A 3baq_A 3bah_A 3fja_A 3fj9_A 3fjk_A 3hom_A 3fjc_A 3ba5_A 3fjh_A 1jt5_A 1k5v_A 3fjj_A 1jy0_A 3bao_A 3fjf_A ... Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 Back     alignment and structure
>1nun_A Fibroblast growth factor-10; beta-trefoil fold, immunoglobulin-like domain, hormone/growth factor/membrane protein complex; HET: 15P; 2.90A {Homo sapiens} SCOP: b.42.1.1 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3p6i_A De novo designed beta-trefoil architecture with S primary structure; de novo protein; HET: SO4; 1.32A {Synthetic} PDB: 3ogf_A Back     alignment and structure
>4acy_A Endo-alpha-mannosidase; hydrolase, endomannosidase, glycoside hydrolase, CAZY, enzyme-carbohydrate interaction, mannose; HET: MSE; 1.69A {Bacteroides thetaiotaomicron} PDB: 4acz_A 4ad0_A* 4acz_B Back     alignment and structure
>1q1u_A FGF-12, fibrobast growth factor homologous factor 1, FGF12B; human, hormone/growth factor complex; 1.70A {Homo sapiens} SCOP: b.42.1.1 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>1ihk_A GLIA-activating factor; B-trefoil fold, hormone/growth factor complex; 2.20A {Homo sapiens} SCOP: b.42.1.1 PDB: 1g82_A* Back     alignment and structure
>1qql_A Fibroblast growth factor 7/1 chimera; beta-trefoil, hormone/growth factor complex; 2.30A {Rattus norvegicus} SCOP: b.42.1.1 PDB: 1qqk_A Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 532
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 1e-51
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 4e-06
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 7e-49
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 2e-07
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 3e-32
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 2e-27
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 1e-23
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 5e-23
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 2e-21
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 3e-19
d1dfca3123 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens 2e-17
d1ur4a_387 c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus lichen 2e-16
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 1e-15
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 2e-15
d1dfca4111 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens 2e-14
d2c0ha1350 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue 4e-14
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 1e-13
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 2e-13
d1dfca1133 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens 2e-13
d1dfca1133 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens 6e-07
d1dfca1133 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens 0.002
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 2e-12
d1rh9a1370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 2e-12
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 6e-12
d1hcda_118 b.42.5.2 (A:) Histidine-rich actin-binding protein 2e-11
d1hcda_118 b.42.5.2 (A:) Histidine-rich actin-binding protein 0.003
d1hcda_118 b.42.5.2 (A:) Histidine-rich actin-binding protein 0.004
d1uuqa_410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 6e-09
d1hjsa_332 c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heter 5e-07
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 4e-06
d1foba_334 c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergi 5e-06
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  179 bits (454), Expect = 1e-51
 Identities = 76/342 (22%), Positives = 130/342 (38%), Gaps = 44/342 (12%)

Query: 203 YQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIG 262
           Y      G + AK  L+ H +TF   +DF  +   G N VRIP+G+W     D      G
Sbjct: 51  YHFCQYLGKDLAKSRLQSHWSTFYQEQDFANIASQGFNLVRIPIGYWAFQILDDDPYVSG 110

Query: 263 GSLEALDNALSWAEAYNIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVID 322
                LD A+ WA   ++K  +DLH A GSQNG ++S  R  +  +     ++ T++V++
Sbjct: 111 LQESYLDQAIGWARNNSLKVWVDLHGAAGSQNGFDNSGLR-DSYKFLEDSNLAVTINVLN 169

Query: 323 FLASRYAKHPAL---LGIELLNEPSAATVPL-DILVPYYKQGYQIVRKYSPTAYVIVCQR 378
           ++  +Y+    L   +GIEL+NEP    + +  +   Y    Y+ +R    +  VI+   
Sbjct: 170 YILKKYSAEEYLDIVIGIELINEPLGPVLDMDKMKNDYLAPAYEYLRNNIKSDQVIIIHD 229

Query: 379 --IGNADPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNIL--------------- 421
                    +    N G   + +D H+Y +F +  +  S  ++I                
Sbjct: 230 AFQPYNYWDDFMTENDGYWGVTIDHHHYQVFASDQLERSIDEHIKVACEWGTGVLNESHW 289

Query: 422 FIYKSREAQLQALNNANGPLVFIGEWVNEWNVTSGTQ--------------------KDY 461
            +     A L         + F   +   W     T                     ++ 
Sbjct: 290 IVCGEFAAALTDCIKWLNSVGFGARYDGSWVNGDQTSSYIGSCANNDDIAYWSDERKENT 349

Query: 462 QDFGSAQLEVYNAASFGWAYWTLKN-DRKHWDFEWNIRNNYL 502
           + +  AQL+ +     GW  W  K      WD +  + N   
Sbjct: 350 RRYVEAQLDAFE-MRGGWIIWCYKTESSLEWDAQRLMFNGLF 390
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Length = 387 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Length = 332 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Length = 334 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query532
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 100.0
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 100.0
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 100.0
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.98
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.97
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.92
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.92
d1dfca3123 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.89
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.89
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.88
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.81
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.8
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 99.79
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.69
d1dfca4111 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.66
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.65
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.65
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.63
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.61
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.56
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.55
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.55
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.55
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 99.54
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 99.53
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.52
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.48
d1dfca3123 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.33
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 99.32
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.25
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 99.19
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 99.05
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 99.04
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 98.96
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.91
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.87
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.82
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 98.82
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.81
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.72
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.72
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 98.71
d1dfca4111 Fascin {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 98.58
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 98.4
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 98.24
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 98.22
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 98.22
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 98.21
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 98.02
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 97.81
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 97.75
d1dfca2119 Fascin {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.17
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 96.82
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 96.8
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 96.53
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 96.42
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 96.27
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 96.24
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 96.14
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 95.97
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 95.86
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 95.76
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 95.75
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 95.7
d1dfca2119 Fascin {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 95.39
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 95.23
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 94.95
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 94.89
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 94.87
d1wdpa1 490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 94.77
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 94.7
d1jlxa1153 Agglutinin {Love-lies-bleeding (Amaranthus caudatu 94.63
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 94.53
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 94.53
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 94.51
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 94.51
d1fa2a_ 498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 94.43
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 94.37
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 94.33
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 94.28
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 94.22
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 94.16
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 94.07
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 93.64
d1jlxa2146 Agglutinin {Love-lies-bleeding (Amaranthus caudatu 93.52
d2fdbm1147 Fibroblast growth factor 8, FGF8 {Human (Homo sapi 93.44
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 93.32
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 93.23
d1jlxa2146 Agglutinin {Love-lies-bleeding (Amaranthus caudatu 93.02
d1bfga_126 Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 960 92.96
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 92.92
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 92.9
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 92.51
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 92.45
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 92.41
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 91.81
d1nuna_139 Fibroblast growth factor-10, FGF10 {Human (Homo sa 91.61
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 90.54
d1yhta1344 Dispersin B, DspB {Actinobacillus actinomycetemcom 89.65
d1rg8a_141 Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 96 89.44
d1qqka_132 Keratinocyte growth factor, FGF7 {Rat (Rattus norv 89.43
d1bfga_126 Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 960 89.31
d1rg8a_141 Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 96 88.86
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 88.29
d1nuna_139 Fibroblast growth factor-10, FGF10 {Human (Homo sa 88.17
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 88.15
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 88.09
d1q1ua_138 Fibrobast growth factor homologous factor 1 (FHF1b 87.63
d1jlxa1153 Agglutinin {Love-lies-bleeding (Amaranthus caudatu 87.6
d1ihka_157 Fibroblast growth factor 9, FGF9 {Human (Homo sapi 87.55
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 87.44
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 85.63
d2fdbm1147 Fibroblast growth factor 8, FGF8 {Human (Homo sapi 85.24
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 82.75
d1q1ua_138 Fibrobast growth factor homologous factor 1 (FHF1b 81.94
d1ihka_157 Fibroblast growth factor 9, FGF9 {Human (Homo sapi 81.76
d1nowa1353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 80.94
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 80.93
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 80.74
d1ijta_128 Fibroblast growth factor 4 (FGF4) {Human (Homo sap 80.32
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 80.05
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Yeast (Candida albicans) [TaxId: 5476]

Probab=100.00  E-value=1.5e-57  Score=478.56  Aligned_cols=301  Identities=28%  Similarity=0.500  Sum_probs=252.9

Q ss_pred             CCccceeecccChhhHHHHHHhhccccCCHHHHHHHHHcCCCEEEEccccccccCCCCCCCCCcChHHHHHHHHHHHHHc
Q 009560          199 LHGDYQLANGYGHERAKEVLKRHRNTFITIEDFNFLYRHGINTVRIPVGWWIAFDPDPPAPFIGGSLEALDNALSWAEAY  278 (532)
Q Consensus       199 ~~~e~~l~~~~G~~~a~~~~~~hw~t~ite~d~~~la~~G~N~VRIpv~ww~~~~~~~~~~~~~~~l~~Ld~~v~~a~k~  278 (532)
                      ..+||++|+.+|.+.|.++|+.||++||||+||+.||++|||+|||||+||.+.. .++++|.++.+++||++|++|+++
T Consensus        42 ~~~e~~~~~~~g~~~~~~~~~~h~~~~it~~D~~~i~~~G~N~VRiPv~~~~~~~-~~~~~~~~~~~~~ld~~i~~a~~~  120 (394)
T d2pb1a1          42 PVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQL-LDNDPYVQGQVQYLEKALGWARKN  120 (394)
T ss_dssp             CCSHHHHHHHHCHHHHHHHHHHHHHHSSCHHHHHHHHHTTCCEEEEEEEGGGTCC-CTTCCCCCCHHHHHHHHHHHHHHT
T ss_pred             cchHHHHHHHhChHHHHHHHHHHHhccCCHHHHHHHHHCCCCEEEEEecHHHhcC-CCCCccchhHHHHHHHHHHHHHHC
Confidence            4589999999999999999999999999999999999999999999999987644 455678888999999999999999


Q ss_pred             CCEEEEEcCCCCCCCCCCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHHhCCCC---cEEEEEeccCCCCCCCCcccHHH
Q 009560          279 NIKCIIDLHAAPGSQNGMEHSASRDGTTDWPASDYISQTLDVIDFLASRYAKHP---ALLGIELLNEPSAATVPLDILVP  355 (532)
Q Consensus       279 Gi~VILDlH~~pGsqn~~~~sg~~~g~~~W~~~~~~~~~~~~w~~la~ry~~~p---~v~g~EL~NEP~~~~~~~~~l~~  355 (532)
                      ||+||||||.+||+|++++++|.. +...|.++.++++++++|++||+||+++|   .|++|||+|||..+....+.+.+
T Consensus       121 gl~VilDlH~~pg~~~~~~~~g~~-~~~~~~~~~~~~~~~~~~~~ia~~~~~~~~~~~v~g~el~NEP~~~~~~~~~~~~  199 (394)
T d2pb1a1         121 NIRVWIDLHGAPGSQNGFDNSGLR-DSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQ  199 (394)
T ss_dssp             TCEEEEEEEECTTCSSCCGGGSST-TCCCTTSTTHHHHHHHHHHHHHHHHSSGGGTTTEEEEESCSCCCGGGSCHHHHHH
T ss_pred             CcEEEEEeeccCCcccCcCCcCcc-CccccccHHHHHHHHHHHHHHHHHHccCCCCCceEEEeecccCCcccccHHHHHH
Confidence            999999999999999999998854 45578889999999999999999999876   69999999999876556778999


Q ss_pred             HHHHHHHHHHhhCCCcEEEEeCCCCCC-CchhhhhccCCCCcEEEEeeecccCCCccccCChhhhHHHHHHHHHHHHHHH
Q 009560          356 YYKQGYQIVRKYSPTAYVIVCQRIGNA-DPLELYQANIGLHNIVVDLHYYNLFDTFFVNMSTVDNILFIYKSREAQLQAL  434 (532)
Q Consensus       356 ~~~~~~~aIR~~~~~~~Viv~~~~~~~-~~~~~~~~~~~~~nvv~s~H~Y~~f~~~~~~~~~~~~i~~i~~~~~~~~~~~  434 (532)
                      |+++++++||+++|+++|++++++.+. .+..++..+...+|+||++|+|.+|+......+..+++..+++...    ..
T Consensus       200 ~~~~~~~~IR~~~~~~~I~i~~~~~~~~~~~~~~~~~~~~~~vv~d~H~Y~~f~~~~~~~~~~~~i~~~~~~~~----~~  275 (394)
T d2pb1a1         200 FFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGW----DA  275 (394)
T ss_dssp             HHHHHHHHHHHTTCCCCEEEECTTCCTTTTTTSSCGGGTCCSEEEEEECCSCSSHHHHTCCHHHHHHHHHHHHH----HH
T ss_pred             HHHHHHHHHHHhCCCCeEEEcCCCcchhhhhhhccCCCCCceEEEeeecccccCCccccCCHHHHHHhhhhhhh----hh
Confidence            999999999999999999999877543 2244444445678999999999999877777777777777665322    12


Q ss_pred             HhcCCCcEEEeccCcccCCCC------------------------------------CCHHHHHHHHHHHHHHHHhCCCc
Q 009560          435 NNANGPLVFIGEWVNEWNVTS------------------------------------GTQKDYQDFGSAQLEVYNAASFG  478 (532)
Q Consensus       435 ~~~~g~pv~vGEwG~~~~~~~------------------------------------a~~~~~~~~~~~ql~~~~~~~~G  478 (532)
                      . ....|+++|||+...+.+.                                    ..++.+++|+++|+++|+ .+.|
T Consensus       276 ~-~~~~~~~~ge~s~~~~d~~~~~~~~~~~~~~~g~~~~~~~~Ge~~~~~d~~~~~~~~~~~~r~~~~aQ~~~~e-~~~G  353 (394)
T d2pb1a1         276 K-KESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFE-YTGG  353 (394)
T ss_dssp             H-TCSSEEEEEECCSCSSCCSTTTTCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHHHHHHHHHHHHHHH-TTTE
T ss_pred             h-cccCcceeceecccchhhhhhhcccccccccccccCCCccccccccccChhhcCHHHHHHHHHHHHHHHHHHh-cCCc
Confidence            2 3456788999876432100                                    113468899999999997 6789


Q ss_pred             EEEEcccCC-CCCCchHhhHhCCcccCCCC
Q 009560          479 WAYWTLKND-RKHWDFEWNIRNNYLQLGNS  507 (532)
Q Consensus       479 w~yW~~k~e-~~~Ws~~~~~~~g~~~~~~~  507 (532)
                      |+||+||.+ ++.|||+.+++.|+||.+++
T Consensus       354 W~fWt~K~~~~~~W~~~~~~~~G~iP~~~~  383 (394)
T d2pb1a1         354 WVFWSWKTENAPEWSFQTLTYNGLFPQPVT  383 (394)
T ss_dssp             EEESCSCCSSCGGGCHHHHHHTTCSCSSTT
T ss_pred             EEEeccccCCCCCCCHHHHHHCCCcCCCch
Confidence            999999988 77899999999999997553
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1jlxa1 b.42.3.1 (A:1-153) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1jlxa2 b.42.3.1 (A:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} Back     information, alignment and structure
>d2fdbm1 b.42.1.1 (M:34-180) Fibroblast growth factor 8, FGF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jlxa2 b.42.3.1 (A:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} Back     information, alignment and structure
>d1bfga_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure
>d1rg8a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bfga_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rg8a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1q1ua_ b.42.1.1 (A:) Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlxa1 b.42.3.1 (A:1-153) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} Back     information, alignment and structure
>d1ihka_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d2fdbm1 b.42.1.1 (M:34-180) Fibroblast growth factor 8, FGF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1q1ua_ b.42.1.1 (A:) Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihka_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1ijta_ b.42.1.1 (A:) Fibroblast growth factor 4 (FGF4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure