Citrus Sinensis ID: 009581

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-

MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSESVASMNENIPRNFF

cccccccccEEEEccccccHHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccEEEEEEccHHHHHHcccccccccccccEEEEEccccccHHHHHHcccccHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccEEEcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccc

cccccccEEEEEEccccccccHHHccHHHHHHccccccccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEEccHHHHHHcccccccHHHcccEEEEccHHcccHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEEcccHHHHHHccccEEcccccHHHHHHHHHHHHHHHHcccccHEEEEEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHHHHcHccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccc

mnpmgsgelkyiedssvpaveEGLVDFADRMTENadklmapvepkttlaieltpenptttfdsldmdnssisniKSSFDDFLAGvnesfsssmikgenavKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSidqtggsagskltnFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYgttkeslppeIRDALNLYEDRAvklwrpvgsaLQQVSVAIEGLerslgfdpndpivPFVVFLGTSATLWIFYWWWtyggysgdlspkstLELLRGKENAVLIDVRhedlrerdgipdlrrgarFRYASvylpevggSVKKLLRGGRELDDTLTAAVIRNLKivqdrskvivmdadgtrskGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILedinsspvqflGFGVTIYRRvasyndaedfKQDVRLLLAPVRIGARAFSWAagkletnrpglptspssvDVQNRVLQAAAkhesqpadtegiqdpssesvasmneniprnff

mnpmgsgelkyiedssvpAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSikkstseavdnVVSRVFSsidqtggsagskLTNFSTDLKEASSKATVAAVDVLRNTIVALeesmtngaSFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAvlidvrhedlrerdgipdlrrgarfryasvylpevggsvkkllrggreldDTLTAAVIrnlkivqdrskvivmdadgtrskgiarSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLetnrpglptspssVDVQNRVLQAAakhesqpadtegiqdpssesvasmneniprnff

MNPMGSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVkssldtitssltsikkstsEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSESVASMNENIPRNFF

*************************************************************************************************************************************************************ATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGK**********************************************************

**********YIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTT**********************LAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIV*********************************LYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKL****************************************************P**F*

********LKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSLDMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQ**********************VASMNENIPRNFF

*****SGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPE*******************KSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINSSPVQFLGFGVTIYRRVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLET*R*G***************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		531	2.2.26 [Sep-21-2011]
Q9FN48		387	Calcium sensing receptor,	no	no	0.329	0.452	0.296	1e-15

>sp\|Q9FN48\|CAS_ARATH Calcium sensing receptor, chloroplastic OS=Arabidopsis thaliana GN=CAS PE=1 SV=1	Back alignment and function desciption

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 94/189 (49%), Gaps = 14/189 (7%)

Query: 222 QQVSVAIEGLE--RSLGFDPNDPIVPFVVFLGTSATLWIFYWW--------WTYGGYSGD 271
           QQ S AIE  +   S   D      P V+ +   A    +           + + GY GD
Sbjct: 161 QQTSKAIEDAKPIASSTMDTISSADPSVIVVAAGAAFLAYLLLPPVFSAISFNFRGYKGD 220

Query: 272 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 331
           L+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+   VK ++R
Sbjct: 221 LTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEELPNKVKGIVR 279

Query: 332 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGF-- 389
             + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    ++V  GF  
Sbjct: 280 NSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNCYIVTDGFSG 339

Query: 390 -QSWVKEGL 397
            + W++  L
Sbjct: 340 GRGWLQSRL 348

Modulates cytoplasmic Ca(2+) concentration and is crucial for proper stomatal regulation in response to elevated levels of external Ca(2+). May function by regulating concentrations of inositol 1,4,5-trisphosphate (IP3), which in turn triggers release of Ca(2+) from internal stores. May play a role in de-etiolation.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		531
224121764		554	predicted protein [Populus trichocarpa]	0.979	0.938	0.652	0.0
359478275		649	PREDICTED: uncharacterized protein LOC10	0.973	0.796	0.620	0.0
356540095		643	PREDICTED: uncharacterized protein LOC10	0.988	0.816	0.580	0.0
356569155		650	PREDICTED: uncharacterized protein LOC10	0.988	0.807	0.577	0.0
357462747		620	hypothetical protein MTR_3g084020 [Medic	0.971	0.832	0.586	1e-176
334186137		686	rhodanese/Cell cycle control phosphatase	0.934	0.723	0.573	1e-171
449450369		619	PREDICTED: uncharacterized protein LOC10	0.952	0.817	0.575	1e-164
449494443		619	PREDICTED: uncharacterized LOC101220363	0.952	0.817	0.573	1e-164
297817278		690	predicted protein [Arabidopsis lyrata su	0.924	0.711	0.499	1e-138
115441603		623	Os01g0896500 [Oryza sativa Japonica Grou	0.796	0.678	0.511	1e-124

>gi\|224121764\|ref\|XP_002330647.1\| predicted protein [Populus trichocarpa] gi\|222872251\|gb\|EEF09382.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/547 (65%), Positives = 432/547 (78%), Gaps = 27/547 (4%)

Query: 5   GSGELKYIEDSSVPAVEEGLVDFADRMTENADKLMAPVEPKTTLAIELTPENPTTTFDSL 64
           G G+LK  E  ++  VEE L+D  D++TEN D ++  VEP+TT  I++TPE P+   +SL
Sbjct: 3   GGGKLKSFESYNIADVEEELMDSTDQLTENTDSVIGLVEPQTTSTIDITPEKPSLGSESL 62

Query: 65  DMDNSSISNIKSSFDDFLAGVNESFSSSMIKGENAVKSSLDTITSSLTSIKKSTSEAVDN 124
           +MD+ S+S+ K+S DD L G  +S ++S+ +GENAV+SSL+TIT+S+TSIKKS SE  D+
Sbjct: 63  EMDSDSLSSAKTSLDDLLGGFKDSINTSVNQGENAVQSSLNTITTSITSIKKSASETADS 122

Query: 125 VVSRVFSSIDQTGGSAGSKLTNFSTDLKEASSKATVAAVDVLRNTIVALEESMTNGASFV 184
            +S+VFS+ +QTG  AG +LT+FSTDL+EA  K T A+V+VLR  IVA+EES+  GASFV
Sbjct: 123 ALSKVFSTFNQTGELAGDRLTSFSTDLREAIKKTTGASVEVLRGAIVAVEESIVKGASFV 182

Query: 185 VYYYGTTKESLPPEIRDALNLYEDRAVKLWRPVGSALQQVSVAIEGLERSLGFDPNDPIV 244
           VY YG+ KE LPPEIR ALNL E+RA K+ RP+G+  QQV +AIEGLE+SLG DPNDP+V
Sbjct: 183 VYSYGSAKELLPPEIRGALNLSEERATKILRPIGATFQQVYIAIEGLEKSLGLDPNDPVV 242

Query: 245 PFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIP 304
           PFV+FLGTSATLW FYW W YGGYSGDLSP+ TL+LL  K + +LIDVR E LRERDGIP
Sbjct: 243 PFVLFLGTSATLWGFYWVWAYGGYSGDLSPQLTLKLLAEKGDTILIDVRPEVLRERDGIP 302

Query: 305 DLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADG 364
           DLRR ARFRYASV LP+V GSV+KLL+GG++LDDTL AAVIRNLK VQDR +VIVMDA+G
Sbjct: 303 DLRRAARFRYASVTLPQVDGSVRKLLKGGKDLDDTLIAAVIRNLKAVQDRYQVIVMDANG 362

Query: 365 TRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNEDAEAILEDINS 424
           +RSKGIARSLRKLGV R ++VQGGFQSWVK+GLR+KELK ETALTILNE+AEAILE+I  
Sbjct: 363 SRSKGIARSLRKLGVKRPYVVQGGFQSWVKQGLRVKELKPETALTILNEEAEAILEEIRP 422

Query: 425 SPVQFLGFGV--------------------------TIYRRVASYNDAEDFKQDVRLLLA 458
           SPVQ LG GV                          TIYRRVASYN  EDFKQD+RLLL+
Sbjct: 423 SPVQALGCGVGFAAASYALLEWEKTLQFIAIVGLGQTIYRRVASYNGPEDFKQDMRLLLS 482

Query: 459 PVRIGARAFSWAAGKLETNRPGLPTSPSSVDVQNRVLQAAAKHESQPADTEGIQDPSSES 518
           PVR+GA+AFSWA GKLE NR GLPTSPSS DVQNRVLQAAAKHESQP++T G+Q+PS  S
Sbjct: 483 PVRVGAQAFSWATGKLENNRLGLPTSPSSTDVQNRVLQAAAKHESQPSET-GVQNPSPNS 541

Query: 519 VASMNEN 525
           VA +NEN
Sbjct: 542 VAPLNEN 548

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359478275\|ref\|XP_002274820.2\| PREDICTED: uncharacterized protein LOC100249037 [Vitis vinifera] gi\|296084312\|emb\|CBI24700.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356540095\|ref\|XP_003538526.1\| PREDICTED: uncharacterized protein LOC100786142 [Glycine max]	Back alignment and taxonomy information

>gi\|356569155\|ref\|XP_003552771.1\| PREDICTED: uncharacterized protein LOC100786123 [Glycine max]	Back alignment and taxonomy information

>gi\|357462747\|ref\|XP_003601655.1\| hypothetical protein MTR_3g084020 [Medicago truncatula] gi\|355490703\|gb\|AES71906.1\| hypothetical protein MTR_3g084020 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|334186137\|ref\|NP_191537.4\| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana] gi\|332646447\|gb\|AEE79968.1\| rhodanese/Cell cycle control phosphatase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449450369\|ref\|XP_004142935.1\| PREDICTED: uncharacterized protein LOC101220363 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449494443\|ref\|XP_004159547.1\| PREDICTED: uncharacterized LOC101220363 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297817278\|ref\|XP_002876522.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297322360\|gb\|EFH52781.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|115441603\|ref\|NP_001045081.1\| Os01g0896500 [Oryza sativa Japonica Group] gi\|113534612\|dbj\|BAF06995.1\| Os01g0896500 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		531
TAIR\|locus:2178287		387	CaS "calcium sensing receptor"	0.252	0.346	0.326	1.3e-13

TAIR\|locus:2178287 CaS "calcium sensing receptor" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 200 (75.5 bits), Expect = 1.3e-13, Sum P(2) = 1.3e-13
 Identities = 45/138 (32%), Positives = 79/138 (57%)

Query:   263 WTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEV 322
             + + GY GDL+P  TL+LL  K N +++D+R E  +E+ GIP L   A+ R  S+ L E+
Sbjct:   212 FNFRGYKGDLTPAQTLDLLCTK-NYLMVDIRSEKDKEKAGIPRLPSNAKNRVISIPLEEL 270

Query:   323 GGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRA 382
                VK ++R  + ++  + A  I  LK +   S +I++D+    +K +A++L+ LG    
Sbjct:   271 PNKVKGIVRNSKRVEAEIAALKISYLKKINKGSNIIILDSYTDSAKIVAKTLKVLGYKNC 330

Query:   383 FLVQGGF---QSWVKEGL 397
             ++V  GF   + W++  L
Sbjct:   331 YIVTDGFSGGRGWLQSRL 348

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0005739 "mitochondrion" evidence=IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0009579 "thylakoid" evidence=IDA

GO:0071277 "cellular response to calcium ion" evidence=IMP

GO:0090333 "regulation of stomatal closure" evidence=IMP

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0009704 "de-etiolation" evidence=IMP

GO:0000023 "maltose metabolic process" evidence=RCA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0006364 "rRNA processing" evidence=RCA

GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA

GO:0009416 "response to light stimulus" evidence=RCA

GO:0009637 "response to blue light" evidence=RCA

GO:0009657 "plastid organization" evidence=RCA

GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA

GO:0010114 "response to red light" evidence=RCA

GO:0010207 "photosystem II assembly" evidence=RCA

GO:0010218 "response to far red light" evidence=RCA

GO:0015979 "photosynthesis" evidence=RCA

GO:0015994 "chlorophyll metabolic process" evidence=RCA

GO:0019216 "regulation of lipid metabolic process" evidence=RCA

GO:0019252 "starch biosynthetic process" evidence=RCA

GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019684 "photosynthesis, light reaction" evidence=RCA

GO:0031408 "oxylipin biosynthetic process" evidence=RCA

GO:0043085 "positive regulation of catalytic activity" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_1420041	hypothetical protein (555 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		531
smart00450		100	smart00450, RHOD, Rhodanese Homology Domain	2e-10
COG0607		110	COG0607, PspE, Rhodanese-related sulfurtransferase	2e-08
cd00158		89	cd00158, RHOD, Rhodanese Homology Domain (RHOD); a	4e-06
PRK08762		376	PRK08762, PRK08762, molybdopterin biosynthesis pro	3e-05
cd01527		99	cd01527, RHOD_YgaP, Member of the Rhodanese Homolo	0.003
pfam03735		74	pfam03735, ENT, ENT domain	0.004
pfam00581		106	pfam00581, Rhodanese, Rhodanese-like domain	0.004

>gnl\|CDD\|197731 smart00450, RHOD, Rhodanese Homology Domain	Back alignment and domain information

 Score = 57.9 bits (140), Expect = 2e-10
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 16/115 (13%)

Query: 283 GKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTA 342
             E  VL+DVR  +  E   IP           +V +P     + +LL    ELD     
Sbjct: 1   NDEKVVLLDVRSPEEYEGGHIPG----------AVNIP-----LSELLDRRGELDILEFE 45

Query: 343 AVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGL 397
            +++ L + +D+  V+V    G RS   A  LR+LG    +L+ GG++ W   G 
Sbjct: 46  ELLKRLGLDKDK-PVVVYCRSGNRSAKAAWLLRELGFKNVYLLDGGYKEWSAAGP 99

An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions. Length = 100

>gnl\|CDD\|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein	Back alignment and domain information

>gnl\|CDD\|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>gnl\|CDD\|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>gnl\|CDD\|146396 pfam03735, ENT, ENT domain	Back alignment and domain information

>gnl\|CDD\|216005 pfam00581, Rhodanese, Rhodanese-like domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		531
PRK11784		345	tRNA 2-selenouridine synthase; Provisional	99.89
TIGR03167		311	tRNA_sel_U_synt tRNA 2-selenouridine synthase. The	99.87
cd01533		109	4RHOD_Repeat_2 Member of the Rhodanese Homology Do	99.82
cd01518		101	RHOD_YceA Member of the Rhodanese Homology Domain	99.8
cd01527		99	RHOD_YgaP Member of the Rhodanese Homology Domain	99.78
PRK11493		281	sseA 3-mercaptopyruvate sulfurtransferase; Provisi	99.78
PLN02723		320	3-mercaptopyruvate sulfurtransferase	99.78
PRK00162		108	glpE thiosulfate sulfurtransferase; Validated	99.78
cd01534		95	4RHOD_Repeat_3 Member of the Rhodanese Homology Do	99.78
PLN02160		136	thiosulfate sulfurtransferase	99.77
cd01523		100	RHOD_Lact_B Member of the Rhodanese Homology Domai	99.77
cd01448		122	TST_Repeat_1 Thiosulfate sulfurtransferase (TST),	99.77
COG2897		285	SseA Rhodanese-related sulfurtransferase [Inorgani	99.76
cd01519		106	RHOD_HSP67B2 Member of the Rhodanese Homology Doma	99.76
PRK09629		610	bifunctional thiosulfate sulfurtransferase/phospha	99.75
cd01449		118	TST_Repeat_2 Thiosulfate sulfurtransferase (TST),	99.75
cd01521		110	RHOD_PspE2 Member of the Rhodanese Homology Domain	99.74
cd01526		122	RHOD_ThiF Member of the Rhodanese Homology Domain	99.74
cd01444		96	GlpE_ST GlpE sulfurtransferase (ST) and homologs a	99.74
cd01528		101	RHOD_2 Member of the Rhodanese Homology Domain sup	99.74
cd01520		128	RHOD_YbbB Member of the Rhodanese Homology Domain	99.73
TIGR03865		162	PQQ_CXXCW PQQ-dependent catabolism-associated CXXC	99.73
PRK11493		281	sseA 3-mercaptopyruvate sulfurtransferase; Provisi	99.73
cd01525		105	RHOD_Kc Member of the Rhodanese Homology Domain su	99.73
smart00450		100	RHOD Rhodanese Homology Domain. An alpha beta fold	99.72
cd01447		103	Polysulfide_ST Polysulfide-sulfurtransferase - Rho	99.72
PF00581		113	Rhodanese: Rhodanese-like domain This Prosite entr	99.71
cd01524		90	RHOD_Pyr_redox Member of the Rhodanese Homology Do	99.71
cd01535		145	4RHOD_Repeat_4 Member of the Rhodanese Homology Do	99.71
KOG1530		136	consensus Rhodanese-related sulfurtransferase [Ino	99.7
PRK09629		610	bifunctional thiosulfate sulfurtransferase/phospha	99.7
PLN02723		320	3-mercaptopyruvate sulfurtransferase	99.7
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	99.69
cd01530		121	Cdc25 Cdc25 phosphatases are members of the Rhodan	99.69
cd01445		138	TST_Repeats Thiosulfate sulfurtransferases (TST) c	99.69
COG0607		110	PspE Rhodanese-related sulfurtransferase [Inorgani	99.69
cd01529		96	4RHOD_Repeats Member of the Rhodanese Homology Dom	99.68
cd01522		117	RHOD_1 Member of the Rhodanese Homology Domain sup	99.68
cd01532		92	4RHOD_Repeat_1 Member of the Rhodanese Homology Do	99.67
cd01531		113	Acr2p Eukaryotic arsenate resistance proteins are	99.64
PRK05320		257	rhodanese superfamily protein; Provisional	99.64
PRK01415		247	hypothetical protein; Validated	99.62
TIGR02981		101	phageshock_pspE phage shock operon rhodanese PspE.	99.61
COG2897		285	SseA Rhodanese-related sulfurtransferase [Inorgani	99.61
cd01443		113	Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda	99.61
cd00158		89	RHOD Rhodanese Homology Domain (RHOD); an alpha be	99.6
PRK10287		104	thiosulfate:cyanide sulfurtransferase; Provisional	99.58
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	99.56
PRK00142		314	putative rhodanese-related sulfurtransferase; Prov	99.55
PRK07411		390	hypothetical protein; Validated	99.52
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	99.45
cd01446		132	DSP_MapKP N-terminal regulatory rhodanese domain o	99.44
KOG2017		427	consensus Molybdopterin synthase sulfurylase [Coen	99.42
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	99.36
PRK01269		482	tRNA s(4)U8 sulfurtransferase; Provisional	99.06
KOG1529		286	consensus Mercaptopyruvate sulfurtransferase/thios	98.99
COG1054		308	Predicted sulfurtransferase [General function pred	98.96
KOG1529		286	consensus Mercaptopyruvate sulfurtransferase/thios	98.76
COG2603		334	Predicted ATPase [General function prediction only	98.55
KOG3772		325	consensus M-phase inducer phosphatase [Cell cycle	98.49
PRK09564		444	coenzyme A disulfide reductase; Reviewed	98.36
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	98.12
PRK07846		451	mycothione reductase; Reviewed	98.03
PRK14727		479	putative mercuric reductase; Provisional	98.03
PRK06370		463	mercuric reductase; Validated	98.01
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	97.99
PRK13512		438	coenzyme A disulfide reductase; Provisional	97.97
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	97.93
PRK13748		561	putative mercuric reductase; Provisional	97.88
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	97.8
TIGR02053		463	MerA mercuric reductase. This model represents the	97.77
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	97.77
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	97.71
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.71
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.7
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	97.69
PLN02507		499	glutathione reductase	97.68
PRK14694		468	putative mercuric reductase; Provisional	97.63
PRK07845		466	flavoprotein disulfide reductase; Reviewed	97.63
PLN02546		558	glutathione reductase	97.61
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.6
PTZ00058		561	glutathione reductase; Provisional	97.57
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.53
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.51
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.49
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	97.39
PRK06116		450	glutathione reductase; Validated	97.32
COG5105		427	MIH1 Mitotic inducer, protein phosphatase [Cell di	97.28
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.25
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.19
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	97.03
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	96.85
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	96.81
PRK14989		847	nitrite reductase subunit NirD; Provisional	96.74
PTZ00052		499	thioredoxin reductase; Provisional	96.54
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	95.64
PF04273		110	DUF442: Putative phosphatase (DUF442); InterPro: I	94.86
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	94.37
TIGR01244		135	conserved hypothetical protein TIGR01244. No membe	93.3
PF02852		110	Pyr_redox_dim: Pyridine nucleotide-disulphide oxid	92.06
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	91.67
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	90.68
PRK00142		314	putative rhodanese-related sulfurtransferase; Prov	90.23
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	84.79
KOG1093		725	consensus Predicted protein kinase (contains TBC a	83.64
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	82.95
PF13350		164	Y_phosphatase3: Tyrosine phosphatase family; PDB:	82.69
KOG1717		343	consensus Dual specificity phosphatase [Defense me	80.94

>PRK11784 tRNA 2-selenouridine synthase; Provisional	Back alignment and domain information

Probab=99.89  E-value=4.3e-23  Score=215.47  Aligned_cols=182  Identities=20%  Similarity=0.227  Sum_probs=134.6

Q ss_pred             CHHHHHHHHhCCCCcEEEEeCChhhhhhcCCccccccccccccccCcccccc--hhhhhhcCch--------------hh
Q 009581          273 SPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGG--SVKKLLRGGR--------------EL  336 (531)
Q Consensus       273 Sp~El~elL~~~~~avLIDVRs~eEf~~GHIPGAi~a~~~~~~nIPl~eL~~--~~~~Llk~p~--------------eL  336 (531)
                      ...++.+++.  ++.+|||||++.||..||||||+        |+|+.+...  .++.+++...              .+
T Consensus         4 ~~~~~~~~~~--~~~~lIDVRsp~Ef~~ghIpgAi--------niPl~~~~er~~vgt~Ykq~g~~~a~~lg~~lv~~~l   73 (345)
T PRK11784          4 DAQDFRALFL--NDTPLIDVRSPIEFAEGHIPGAI--------NLPLLNDEERAEVGTCYKQQGQFAAIALGHALVAGNI   73 (345)
T ss_pred             cHHHHHHHHh--CCCEEEECCCHHHHhcCCCCCee--------eCCCCChhHHHhhchhhcccCHHHHHHhhhhhcchhH
Confidence            4566766653  57899999999999999999999        999754322  2233332211              11


Q ss_pred             HHHHHHHHHhhhcccC-CCcEEEEEe-CCCcHHHHHHHHHHHccCCceEEecchHHHHHHcCCceeccccchhhhhhhhc
Q 009581          337 DDTLTAAVIRNLKIVQ-DRSKVIVMD-ADGTRSKGIARSLRKLGVMRAFLVQGGFQSWVKEGLRIKELKSETALTILNED  414 (531)
Q Consensus       337 ~~~L~algI~~Lk~l~-kd~~IVVyC-~sG~RS~~AA~~L~~lGf~nV~~L~GG~~aW~~aGLPV~~~~p~~a~s~l~~~  414 (531)
                      .+.+...    +..++ ++++||+|| ++|.||..+++.|+.+|| ++++|.||+.+|++.+++.....+          
T Consensus        74 ~~~~~~~----~~~~~~~~~~ivvyC~rgG~RS~~aa~~L~~~G~-~v~~L~GG~~awr~~~~~~~~~~~----------  138 (345)
T PRK11784         74 AAHREEA----WADFPRANPRGLLYCWRGGLRSGSVQQWLKEAGI-DVPRLEGGYKAYRRFVIDTLEEAP----------  138 (345)
T ss_pred             HHHHHHH----HHhcccCCCeEEEEECCCChHHHHHHHHHHHcCC-CcEEEcCCHHHHHHhhHHHHhhhc----------
Confidence            1111111    11223 789999999 578999999999999999 599999999999998775544211          


Q ss_pred             HHHHHhhhcCCCceEE----chhHHHHH-HHHhcCChhhHHHHHHHhhcccccccceeecccCccccCCCCCCCCCChhH
Q 009581          415 AEAILEDINSSPVQFL----GFGVTIYR-RVASYNDAEDFKQDVRLLLAPVRIGARAFSWAAGKLETNRPGLPTSPSSVD  489 (531)
Q Consensus       415 ~~el~~~i~p~pv~vl----G~g~T~~~-rl~~~~~~~~~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~gl~~~p~~~~  489 (531)
                              .+.+..++    |.|||.++ +|...+.+   ++|+|++++   ||||+|    |     .+++ ..|||++
T Consensus       139 --------~~~~~ivl~G~TGsGKT~iL~~L~~~~~~---vlDlE~~ae---hrGS~f----G-----~~~~-~qpsQ~~  194 (345)
T PRK11784        139 --------AQFPLVVLGGNTGSGKTELLQALANAGAQ---VLDLEGLAN---HRGSSF----G-----RLGG-PQPSQKD  194 (345)
T ss_pred             --------ccCceEecCCCCcccHHHHHHHHHhcCCe---EEECCchhh---hccccc----c-----CCCC-CCcchHH
Confidence                    11233333    78999887 66655544   899999999   999999    9     8888 7899999


Q ss_pred             HHHHHHHHHHhcCC
Q 009581          490 VQNRVLQAAAKHES  503 (531)
Q Consensus       490 ~~~~~~~~~~~~~~  503 (531)
                      ||+++.+++.++.+
T Consensus       195 Fe~~l~~~l~~~~~  208 (345)
T PRK11784        195 FENLLAEALLKLDP  208 (345)
T ss_pred             HHHHHHHHHHcCCC
Confidence            99999999999876

>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase	Back alignment and domain information

>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2	Back alignment and domain information

>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional	Back alignment and domain information

>PLN02723 3-mercaptopyruvate sulfurtransferase	Back alignment and domain information

>PRK00162 glpE thiosulfate sulfurtransferase; Validated	Back alignment and domain information

>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3	Back alignment and domain information

>PLN02160 thiosulfate sulfurtransferase	Back alignment and domain information

>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain	Back alignment and domain information

>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional	Back alignment and domain information

>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain	Back alignment and domain information

>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2	Back alignment and domain information

>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein	Back alignment and domain information

>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional	Back alignment and domain information

>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>smart00450 RHOD Rhodanese Homology Domain	Back alignment and domain information

>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain	Back alignment and domain information

>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family	Back alignment and domain information

>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4	Back alignment and domain information

>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional	Back alignment and domain information

>PLN02723 3-mercaptopyruvate sulfurtransferase	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain	Back alignment and domain information

>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1	Back alignment and domain information

>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1	Back alignment and domain information

>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK05320 rhodanese superfamily protein; Provisional	Back alignment and domain information

>PRK01415 hypothetical protein; Validated	Back alignment and domain information

>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE	Back alignment and domain information

>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily	Back alignment and domain information

>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein	Back alignment and domain information

>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase	Back alignment and domain information

>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional	Back alignment and domain information

>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms]	Back alignment and domain information

>COG1054 Predicted sulfurtransferase [General function prediction only]	Back alignment and domain information

>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms]	Back alignment and domain information

>COG2603 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>TIGR01244 conserved hypothetical protein TIGR01244	Back alignment and domain information

>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ]	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK00142 putative rhodanese-related sulfurtransferase; Provisional	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only]	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B	Back alignment and domain information

>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		531
2fsx_A		148	RV0390, COG0607: rhodanese-related sulfurtransfera	2e-16
1vee_A		134	Proline-rich protein family; hypothetical protein,	1e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-05
2hhg_A		139	Hypothetical protein RPA3614; MCSG, structural gen	5e-09
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	1e-07
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	3e-07
1qxn_A		137	SUD, sulfide dehydrogenase; polysulfide-sulfur tra	3e-07
3ilm_A		141	ALR3790 protein; rhodanese-like, NSR437H, NESG, st	2e-05
1tq1_A		129	AT5G66040, senescence-associated family protein; C	2e-05
3d1p_A		139	Putative thiosulfate sulfurtransferase YOR285W; at	3e-05
3hix_A		106	ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q	3e-05
3flh_A		124	Uncharacterized protein LP_1913; alpha-beta protei	8e-05
3nhv_A		144	BH2092 protein; alpha-beta protein, structural gen	2e-04
1t3k_A		152	Arath CDC25, dual-specificity tyrosine phosphatase	3e-04

>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148	Back alignment and structure

 Score = 75.5 bits (185), Expect = 2e-16
 Identities = 35/131 (26%), Positives = 50/131 (38%), Gaps = 11/131 (8%)

Query: 267 GYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSV 326
            Y+GD++P    E+L     AVL+DVR E      G+PDL            L      V
Sbjct: 2   SYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSS----------LGREVVYV 51

Query: 327 KKLLRGGRELDDTLTAAVIRNLKIVQDRSK-VIVMDADGTRSKGIARSLRKLGVMRAFLV 385
           +     G   D+ L     R         + VI +   G RS G A    + G+  A+ V
Sbjct: 52  EWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNV 111

Query: 386 QGGFQSWVKEG 396
             GF+  +   
Sbjct: 112 LDGFEGHLDAE 122

PyMOL of 2fsx

>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539	Back alignment and structure

>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137	Back alignment and structure

>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141	Back alignment and structure

>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129	Back alignment and structure

>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139	Back alignment and structure

>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106	Back alignment and structure

>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124	Back alignment and structure

>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144	Back alignment and structure

>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		531
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	99.95
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	99.95
3iwh_A		103	Rhodanese-like domain protein; alpha-beta-alpha sa	99.89
3foj_A		100	Uncharacterized protein; protein SSP1007, structur	99.88
3eme_A		103	Rhodanese-like domain protein; alpha-beta-alpha sa	99.88
3gk5_A		108	Uncharacterized rhodanese-related protein TVG08686	99.86
3hix_A		106	ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q	99.85
3d1p_A		139	Putative thiosulfate sulfurtransferase YOR285W; at	99.85
2hhg_A		139	Hypothetical protein RPA3614; MCSG, structural gen	99.85
1gmx_A		108	GLPE protein; transferase, rhodanese, sulfurtransf	99.85
1qxn_A		137	SUD, sulfide dehydrogenase; polysulfide-sulfur tra	99.84
3ilm_A		141	ALR3790 protein; rhodanese-like, NSR437H, NESG, st	99.84
1e0c_A		271	Rhodanese, sulfurtransferase; sulfur metabolism, t	99.84
3nhv_A		144	BH2092 protein; alpha-beta protein, structural gen	99.83
1tq1_A		129	AT5G66040, senescence-associated family protein; C	99.83
1e0c_A		271	Rhodanese, sulfurtransferase; sulfur metabolism, t	99.82
3flh_A		124	Uncharacterized protein LP_1913; alpha-beta protei	99.82
2wlr_A		423	Putative thiosulfate sulfurtransferase YNJE; rhoda	99.82
1urh_A		280	3-mercaptopyruvate sulfurtransferase; rhodanese; 2	99.81
1wv9_A		94	Rhodanese homolog TT1651; CDC25, phosphatase, sulf	99.8
1rhs_A		296	Sulfur-substituted rhodanese; transferase, sulfurt	99.8
1urh_A		280	3-mercaptopyruvate sulfurtransferase; rhodanese; 2	99.8
1uar_A		285	Rhodanese; sulfurtransferase, riken structural gen	99.8
3olh_A		302	MST, 3-mercaptopyruvate sulfurtransferase; structu	99.8
3i2v_A		127	Adenylyltransferase and sulfurtransferase MOCS3; r	99.8
3aay_A		277	Putative thiosulfate sulfurtransferase; sulfurtran	99.79
2fsx_A		148	RV0390, COG0607: rhodanese-related sulfurtransfera	99.79
3hzu_A		318	Thiosulfate sulfurtransferase SSEA; niaid, ssgcid,	99.79
2k0z_A		110	Uncharacterized protein HP1203; A/B domain, struct	99.78
1vee_A		134	Proline-rich protein family; hypothetical protein,	99.78
1rhs_A		296	Sulfur-substituted rhodanese; transferase, sulfurt	99.78
1t3k_A		152	Arath CDC25, dual-specificity tyrosine phosphatase	99.77
3hzu_A		318	Thiosulfate sulfurtransferase SSEA; niaid, ssgcid,	99.76
3olh_A		302	MST, 3-mercaptopyruvate sulfurtransferase; structu	99.76
3aay_A		277	Putative thiosulfate sulfurtransferase; sulfurtran	99.76
3g5j_A		134	Putative ATP/GTP binding protein; N-terminal domai	99.75
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	99.75
2jtq_A		85	Phage shock protein E; solution structure rhodanes	99.75
1uar_A		285	Rhodanese; sulfurtransferase, riken structural gen	99.75
2vsw_A		153	Dual specificity protein phosphatase 16; hydrolase	99.71
2ouc_A		142	Dual specificity protein phosphatase 10; rhodanese	99.71
1c25_A		161	CDC25A; hydrolase, cell cycle phosphatase,dual spe	99.7
1okg_A		373	Possible 3-mercaptopyruvate sulfurtransferase; rho	99.7
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	99.7
1yt8_A		539	Thiosulfate sulfurtransferase; rhodanase domains,	99.7
2j6p_A		152	SB(V)-AS(V) reductase; arsenate reductase, antimon	99.68
2a2k_A		175	M-phase inducer phosphatase 2; dual specificity, s	99.68
2wlr_A		423	Putative thiosulfate sulfurtransferase YNJE; rhoda	99.67
1qb0_A		211	Protein (M-phase inducer phosphatase 2 (CDC25B));	99.67
2eg4_A		230	Probable thiosulfate sulfurtransferase; structural	99.66
4f67_A		265	UPF0176 protein LPG2838; structural genomics, PSI-	99.65
3utn_X		327	Thiosulfate sulfurtransferase TUM1; rhodanese-like	99.64
3f4a_A		169	Uncharacterized protein YGR203W; protein phosphata	99.63
1hzm_A		154	Dual specificity protein phosphatase 6; hydrolase;	99.62
3op3_A		216	M-phase inducer phosphatase 3; structural genomics	99.62
1okg_A		373	Possible 3-mercaptopyruvate sulfurtransferase; rho	99.61
3tg1_B		158	Dual specificity protein phosphatase 10; kinase/rh	99.58
2eg4_A		230	Probable thiosulfate sulfurtransferase; structural	99.55
3utn_X		327	Thiosulfate sulfurtransferase TUM1; rhodanese-like	99.54
1whb_A		157	KIAA0055; deubiqutinating enzyme, UBPY, structural	99.52
2gwf_A		157	Ubiquitin carboxyl-terminal hydrolase 8; protein-p	99.5
3r2u_A		466	Metallo-beta-lactamase family protein; structural	99.49
3tp9_A		474	Beta-lactamase and rhodanese domain protein; struc	99.43
3r2u_A		466	Metallo-beta-lactamase family protein; structural	98.91
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	98.66
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	98.58
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	98.48
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	98.03
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	97.88
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	97.8
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	97.76
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.75
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	97.74
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	97.71
4dna_A		463	Probable glutathione reductase; structural genomic	97.65
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	97.62
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	97.51
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	97.48
1ojt_A		482	Surface protein; redox-active center, glycolysis,	97.43
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	97.36
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	97.27
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	97.23
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	97.01
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	96.93
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	96.9
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	96.87
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	96.85
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	96.81
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	96.78
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	96.77
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	96.73
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	96.71
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	96.7
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	96.64
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	96.56
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	96.55
2f46_A		156	Hypothetical protein; structural genomics, joint c	96.52
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	96.41
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	96.28
1fec_A		490	Trypanothione reductase; redox-active center, oxid	96.28
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	96.26
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	96.0
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	95.63
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	94.29
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	93.75
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	92.98
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	86.08
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	84.84

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

Probab=99.95  E-value=1.5e-29  Score=275.12  Aligned_cols=243  Identities=19%  Similarity=0.212  Sum_probs=184.8

Q ss_pred             cccccccchhhhhhhhhccc------cchhhhhhhHHHHHhhccccccccCcccccccc---ccccccchhhhhhhcccc
Q 009581           91 SSMIKGENAVKSSLDTITSS------LTSIKKSTSEAVDNVVSRVFSSIDQTGGSAGSK---LTNFSTDLKEASSKATVA  161 (531)
Q Consensus        91 ~~i~a~gda~~~~~~~~t~~------~~~a~k~~r~~~d~~~~g~~~~~~~~~~~~~~~---~~~~~tgl~e~~~~~~~~  161 (531)
                      ..|||+|||... .+.++|.      +..|.+|||.+|++++|.....+++...+.+.+   ...+++||+|+.+++.|+
T Consensus       311 ~~IyA~GD~~~~-~~~~~g~~~~~~~~~~A~~~g~~aa~~i~g~~~~~~~~~~~~~~~~~~~~~~a~vGlte~~a~~~g~  389 (588)
T 3ics_A          311 PHIYAIGDAIEV-KDFVTETETMIPLAWPANRQGRMLADIIHGHTDSLYKGTLGTSVAKVFDLTVATTGLNEKILKRLNI  389 (588)
T ss_dssp             TTEEECGGGBCE-EBTTTCCEECCCCHHHHHHHHHHHHHHHTTCCSSCCCCBCCCEEEEETTEEEEEEECCHHHHHHTTC
T ss_pred             CCEEEeeeeeec-ccccCCcccccccHHHHHHHHHHHHHHhcCCCccccCCcccceEEEECCeEEEEecCCHHHHHHcCC
Confidence            359999999988 7877774      678999999999999942667788888888766   668999999999999999


Q ss_pred             eehhhhhhhhcccceeccCCceeeEccCCcccCCCchhHhhhhhhhcccceeeec--ccc--hHHHHHHHHHHHhHhc--
Q 009581          162 AVDVLRNTIVALEESMTNGASFVVYYYGTTKESLPPEIRDALNLYEDRAVKLWRP--VGS--ALQQVSVAIEGLERSL--  235 (531)
Q Consensus       162 ~~d~l~~~~~~~e~~~~~~~~~~~y~~G~~~~~lp~~v~kl~~~~e~~tg~ilg~--~G~--~aq~v~~~~egv~k~l--  235 (531)
                      +|          +.......++..|++|.....+     |+  +++.++|+|||-  +|.  +.+.+..+--.+...+  
T Consensus       390 ~~----------~~~~~~~~~~~~~~~~~~~~~~-----k~--i~~~~~~~ilG~~~~g~~~~~e~i~~~~~ai~~~~t~  452 (588)
T 3ics_A          390 PY----------EVVHVQANSHAGYYPNATPVLI-----KL--IFNKDSGKIYGAQTLGRDGVDKRMDVIATAIKANLTV  452 (588)
T ss_dssp             CC----------EEEEEEEESSCTTSTTCCEEEE-----EE--EECTTTCBEEEEEEEESSSHHHHHHHHHHHHHTTCBT
T ss_pred             Ce----------EEEEEecCCccccCCCCceEEE-----EE--EEECCCCeEEEEEEEcCCcHHHHHHHHHHHHHcCCCH
Confidence            98          5554445566678889888888     88  888889999982  331  2222211111111111  


Q ss_pred             -Cc------------CCCCCeeehhhhHhHHHHHHHHHHHHHhCCCCCccCHHHHHHHHhCCCCcEEEEeCChhhhhhcC
Q 009581          236 -GF------------DPNDPIVPFVVFLGTSATLWIFYWWWTYGGYSGDLSPKSTLELLRGKENAVLIDVRHEDLRERDG  302 (531)
Q Consensus       236 -gv------------~~~dpVv~~~~~~G~~~~l~~~~~~~~~~g~~~~ISp~El~elL~~~~~avLIDVRs~eEf~~GH  302 (531)
                       ++            ...+++++    ++       ....+...+....|+++++.+++.  ++.+|||||++.||+.||
T Consensus       453 ~~l~~~~~~~~P~~~~~~d~i~~----aa-------~~a~n~~~~~~~~i~~~~~~~~~~--~~~~~iDvR~~~e~~~gh  519 (588)
T 3ics_A          453 LDLPDLELSYAPPYSSAKDPVNM----VG-------YAASNIVDGFVDTVQWHEIDRIVE--NGGYLIDVREPNELKQGM  519 (588)
T ss_dssp             TTGGGCCCCCSTTTCCSSCHHHH----HH-------HHHHHHHTTSCCEECTTTHHHHHH--TTCEEEECSCGGGGGGCB
T ss_pred             HHhhhhhhccCCCcccccchhhh----cc-------cccccccccccceecHHHHHHHhc--CCCEEEEcCCHHHHhcCC
Confidence             11            01222221    11       224456677778899999999985  568999999999999999


Q ss_pred             CccccccccccccccCcccccchhhhhhcCchhhHHHHHHHHHhhhcccCCCcEEEEEeCCCcHHHHHHHHHHHccCCce
Q 009581          303 IPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRA  382 (531)
Q Consensus       303 IPGAi~a~~~~~~nIPl~eL~~~~~~Llk~p~eL~~~L~algI~~Lk~l~kd~~IVVyC~sG~RS~~AA~~L~~lGf~nV  382 (531)
                      ||||+        |||+.++...+..                      ++++++||+||++|.||..+++.|+.+||+ |
T Consensus       520 i~ga~--------~ip~~~l~~~~~~----------------------l~~~~~iv~~C~~g~rs~~a~~~l~~~G~~-v  568 (588)
T 3ics_A          520 IKGSI--------NIPLDELRDRLEE----------------------VPVDKDIYITCQLGMRGYVAARMLMEKGYK-V  568 (588)
T ss_dssp             CTTEE--------ECCHHHHTTCGGG----------------------SCSSSCEEEECSSSHHHHHHHHHHHHTTCC-E
T ss_pred             CCCCE--------ECCHHHHHHHHhh----------------------CCCCCeEEEECCCCcHHHHHHHHHHHcCCc-E
Confidence            99999        9998877655443                      357899999999999999999999999998 9


Q ss_pred             EEecchHHHHHHc
Q 009581          383 FLVQGGFQSWVKE  395 (531)
Q Consensus       383 ~~L~GG~~aW~~a  395 (531)
                      ++|+|||.+|+++
T Consensus       569 ~~l~GG~~~w~~~  581 (588)
T 3ics_A          569 KNVDGGFKLYGTV  581 (588)
T ss_dssp             EEETTHHHHHHHH
T ss_pred             EEEcchHHHHHhh
Confidence            9999999999875

PyMOL of 3ics

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A	Back alignment and structure

>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp}	Back alignment and structure

>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1}	Back alignment and structure

>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A	Back alignment and structure

>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae}	Back alignment and structure

>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris}	Back alignment and structure

>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A	Back alignment and structure

>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3	Back alignment and structure

>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A	Back alignment and structure

>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X	Back alignment and structure

>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A	Back alignment and structure

>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3	Back alignment and structure

>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X	Back alignment and structure

>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A	Back alignment and structure

>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A	Back alignment and structure

>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus}	Back alignment and structure

>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A	Back alignment and structure

>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens}	Back alignment and structure

>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens}	Back alignment and structure

>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A	Back alignment and structure

>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A	Back alignment and structure

>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori}	Back alignment and structure

>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A	Back alignment and structure

>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A	Back alignment and structure

>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1	Back alignment and structure

>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A	Back alignment and structure

>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens}	Back alignment and structure

>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A	Back alignment and structure

>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile}	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A	Back alignment and structure

>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2	Back alignment and structure

>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A	Back alignment and structure

>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens}	Back alignment and structure

>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1	Back alignment and structure

>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2	Back alignment and structure

>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2	Back alignment and structure

>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major}	Back alignment and structure

>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A	Back alignment and structure

>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A	Back alignment and structure

>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A	Back alignment and structure

>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A	Back alignment and structure

>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp}	Back alignment and structure

>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A*	Back alignment and structure

>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1	Back alignment and structure

>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens}	Back alignment and structure

>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3	Back alignment and structure

>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens}	Back alignment and structure

>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A	Back alignment and structure

>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4	Back alignment and structure

>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus}	Back alignment and structure

>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus}	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491}	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		531
d1tq1a_		119	c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc	3e-06
d1gmxa_		108	c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia	2e-05
d2gwfa1		135	c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h	7e-05
d1qxna_		137	c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf	3e-04
d1yt8a1		136	c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase	5e-04
d1hzma_		154	c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat	0.003

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 44.1 bits (103), Expect = 3e-06
 Identities = 24/129 (18%), Positives = 35/129 (27%), Gaps = 20/129 (15%)

Query: 272 LSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLR 331
           +S     +LL        +DVR  +   +        GA                     
Sbjct: 10  VSVTVAHDLL--LAGHRYLDVRTPEEFSQGHAC----GAINVPYMNR------------- 50

Query: 332 GGRELDDTLTAAVIRNLKIVQDRSKVIVMDADGTRSKGIARSLRKLGVMRAFLVQGGFQS 391
            G       T  + +          +IV    G RS      L   G      + GG+ +
Sbjct: 51  -GASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSA 109

Query: 392 WVKEGLRIK 400
           W K GL  K
Sbjct: 110 WAKNGLPTK 118

PyMOL of d1tq1a_

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108	Back information, alignment and structure

>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137	Back information, alignment and structure

>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136	Back information, alignment and structure

>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		531
d1yt8a1		136	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.86
d1e0ca2		136	Sulfurtransferase {Azotobacter vinelandii [TaxId:	99.84
d1urha1		147	3-mercaptopyruvate sulfurtransferase {Escherichia	99.84
d1tq1a_		119	Thiosulfate sulfurtransferase/Senescence-associate	99.84
d1gmxa_		108	Sulfurtransferase GlpE {Escherichia coli [TaxId: 5	99.83
d1yt8a2		101	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.83
d1uara1		143	Sulfurtransferase {Thermus thermophilus [TaxId: 27	99.83
d1yt8a3		157	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.83
d1qxna_		137	Polysulfide-sulfur transferase (sulfide dehydrogen	99.83
d1rhsa1		149	Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	99.82
d1e0ca1		135	Sulfurtransferase {Azotobacter vinelandii [TaxId:	99.81
d1rhsa2		144	Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	99.79
d1uara2		141	Sulfurtransferase {Thermus thermophilus [TaxId: 27	99.77
d1yt8a4		130	Thiosulfate sulfurtransferase PA2603 {Pseudomonas	99.77
d1t3ka_		132	Dual specificity phosphatase Cdc25 {Thale cress (A	99.75
d1okga1		156	3-mercaptopyruvate sulfurtransferase {Leishmania m	99.74
d1urha2		120	3-mercaptopyruvate sulfurtransferase {Escherichia	99.73
d1okga2		139	3-mercaptopyruvate sulfurtransferase {Leishmania m	99.69
d1c25a_		161	CDC25a {Human (Homo sapiens) [TaxId: 9606]}	99.55
d2gwfa1		135	Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum	99.5
d1ymka1		174	CDC25b {Human (Homo sapiens) [TaxId: 9606]}	99.49
d1hzma_		154	Erk2 binding domain of Mapk phosphatase mkp-3 {Hum	99.35
d1nhpa3		126	NADH peroxidase {Enterococcus faecalis [TaxId: 135	97.7
d1q1ra1		185	Putidaredoxin reductase {Pseudomonas putida [TaxId	93.63
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	91.18
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	90.38
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	89.73
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	88.71
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	86.25
d1xdia2		118	Dihydrolipoamide dehydrogenase {Mycobacterium tube	85.99
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	85.54
d1ebda3		115	Dihydrolipoamide dehydrogenase {Bacillus stearothe	84.78
d1lvla3		123	Dihydrolipoamide dehydrogenase {Pseudomonas putida	84.65
d1mo9a1		261	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	84.38
d1uara1		143	Sulfurtransferase {Thermus thermophilus [TaxId: 27	82.88
d1ojta1		229	Dihydrolipoamide dehydrogenase {Neisseria meningit	81.95
d1ojta3		128	Dihydrolipoamide dehydrogenase {Neisseria meningit	81.83
d1dxla1		221	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	80.91

>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Multidomain sulfurtransferase (rhodanese)
domain: Thiosulfate sulfurtransferase PA2603
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.86  E-value=3.9e-22  Score=178.56  Aligned_cols=107  Identities=27%  Similarity=0.288  Sum_probs=95.4

Q ss_pred             CCccCHHHHHHHHhCCCCcEEEEeCChhhhhhcCCccccccccccccccCcccccchhhhhhcCchhhHHHHHHHHHhhh
Q 009581          269 SGDLSPKSTLELLRGKENAVLIDVRHEDLRERDGIPDLRRGARFRYASVYLPEVGGSVKKLLRGGRELDDTLTAAVIRNL  348 (531)
Q Consensus       269 ~~~ISp~El~elL~~~~~avLIDVRs~eEf~~GHIPGAi~a~~~~~~nIPl~eL~~~~~~Llk~p~eL~~~L~algI~~L  348 (531)
                      ...|+++++.+++..+++.+|||||++.||+.||||||+        |+|..++..++.++.+                 
T Consensus        23 ~~~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpGAi--------~ip~~~l~~~~~~l~~-----------------   77 (136)
T d1yt8a1          23 TPSLAAEEVQALLDARAEAVILDARRFDEYQTMSIPGGI--------SVPGAELVLRVAELAP-----------------   77 (136)
T ss_dssp             CCEECHHHHHHHHHTTCSEEEEECSCHHHHHHSBCTTCE--------ECCGGGHHHHHHHHCC-----------------
T ss_pred             CCccCHHHHHHHHhcCCCcEEEEcCChhhccceecCCch--------hhhhhHHHHHhhcccc-----------------
Confidence            357999999999977778999999999999999999999        9998877666554432                 


Q ss_pred             cccCCCcEEEEEeCCCcHHHHHHHHHHHccCCc-eEEecchHHHHHHcCCceeccc
Q 009581          349 KIVQDRSKVIVMDADGTRSKGIARSLRKLGVMR-AFLVQGGFQSWVKEGLRIKELK  403 (531)
Q Consensus       349 k~l~kd~~IVVyC~sG~RS~~AA~~L~~lGf~n-V~~L~GG~~aW~~aGLPV~~~~  403 (531)
                         +++++||+||++|.||..++..|+.+||+| |++|.||+.+|+.+|+|++++.
T Consensus        78 ---~~~~~iV~~C~~g~rs~~aa~~L~~~G~~~~V~~L~GG~~~W~~~G~pve~g~  130 (136)
T d1yt8a1          78 ---DPRTRVIVNCAGRTRSIIGTQSLLNAGIPNPVAALRNGTIGWTLAGQQLEHGQ  130 (136)
T ss_dssp             ---STTSEEEEECSSSHHHHHHHHHHHHTTCSSCEEEETTHHHHHHHTTCCCBCSC
T ss_pred             ---cccceEEEEcCCCCchHHHHHHHHHcCCCceEEEeCCcHHHHHHCCCCceeCC
Confidence               368899999999999999999999999986 9999999999999999999874

PyMOL of d1yt8a1

>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure