Citrus Sinensis ID: 009603


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
cHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccEEEEccccccccccccccccccccccccEEccccccccccccEEEEcccccEEEEEEEEEcccccccccccEEEEEEEcEEEEEEEcccccccccEEEEEEEEEccccEEEEEEEccccccEEEEEEEEEcccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccHHHHHHHccccccccccEEEEccccccccEEEEEEEEccccccccccccEEEEEEccccccccccccccccccEEEEEEEEEEEEEcEEEEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEccccccccccEEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccccHHHHccccc
cHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEccccHccccccccccHHHccccccEEEccccccccccEEEEEcccccEEEEEEEEEEccccccccccEEEEEEcccEEEEEEEccccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEcccccccccccccccccEEEEEEEEEcccccccccEEEccccccccccEEEccccccccccccEEEEEEccccccccccccHHHHHHccccccccccEEEEccccccccEEEEEEEHHHHHHcccccEEEEEEEEcccEccccccHHHcccccEEEEEcccccccccEEEEEEEccccccccEEEEEEEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEEccccccc
MLRFHFLWLLVFCSAlnsssarhapfamriscgarqnihspptntlwfkdfaytggipanatrpsfitpplktlryfplsegpencyiinrvpkghynvRIFFGLvtltsfdheplfdisvegtqiyslksgwsdhdDRAFAEALVFLRDGTvsicfhstghgdpailSLEIlqvddkayyfgqgwgeGLILRTAtrlscgngkpkfdvdysgdhwggdrfwnpilsfgqnadqrrSTESSIKQaskapnfypealYQTAlvstdsqpdlqytmdvdpnrnySIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAvngrtltvtlhpkggsHAIINAIEVFEIIAVESKTLPEEVRALQVLKnsldlphrfgwngdpcvpqqhpwsgadcqfdrtshkwvidglgldnqglrgflpngiskLRHLQSInlsgnsirgaipsslgtiASLEVLDLSynffngsipesLGQLTALRRLNLngntlsgrvpaalggrllhrASFKYVWAMDYL
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPanatrpsfitppLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
**RFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFG*********************FYPEALYQTALVST****DLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMD**
*LRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPAN********PPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQN**************SKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWA**YL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYVWAMDYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query531 2.2.26 [Sep-21-2011]
Q9ZQQ7 886 Putative leucine-rich rep no no 0.851 0.510 0.298 3e-36
Q9LIG2 899 Receptor-like protein kin no no 0.877 0.518 0.277 6e-35
Q9SNA3 889 Putative receptor-like pr no no 0.824 0.492 0.271 2e-33
Q9ZQR3 868 Leucine-rich repeat recep no no 0.822 0.503 0.278 2e-33
Q9FN94 868 Receptor-like protein kin no no 0.819 0.501 0.285 2e-32
C0LGG3 885 Probable LRR receptor-lik no no 0.860 0.516 0.256 2e-31
O81069 884 Probable leucine-rich rep no no 0.741 0.445 0.269 4e-31
Q9FZB1 872 Probable LRR receptor-lik no no 0.738 0.449 0.285 7e-30
Q9SI06 892 Putative leucine-rich rep no no 0.768 0.457 0.263 3e-29
C0LGD9 871 Probable LRR receptor-lik no no 0.845 0.515 0.274 1e-28
>sp|Q9ZQQ7|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 145/485 (29%), Positives = 210/485 (43%), Gaps = 33/485 (6%)

Query: 41  PPTNTLWFKDFAYT-GGIPANATRPS---FITPPLKTLRYFPLSEGPENCYIINRVPKGH 96
           P TN  +  D  +  GG   N    S   F + P K LRYFP  EG  NCY ++      
Sbjct: 46  PLTNLTYISDVNFVRGGKTGNIKNNSDIDFTSRPYKVLRYFP--EGIRNCYSLSVKQGTK 103

Query: 97  YNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSIC 156
           Y +R  F        +  P FD+ +      S+     D  D    E +   R   + IC
Sbjct: 104 YLIRTLFFYGNYDGLNTSPRFDLFLGPNIWTSVDVQKVDGGDGVIEEIIHVTRCNILDIC 163

Query: 157 FHSTGHGDPAILSLEILQVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHW 216
              TG   P I ++E+  +    Y    G  + ++    T     +GK   +V Y  D +
Sbjct: 164 LVKTGTTTPMISAIELRPLRYDTYTARTGSLKKILHFYFT----NSGK---EVRYPEDVY 216

Query: 217 GGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQYT-MD 275
             DR W P     Q    + +T  ++   S   N  P+ + +TA + T+    L +T M 
Sbjct: 217 --DRVWIP---HSQPEWTQINTTRNVSGFSDGYN-PPQDVIKTASIPTNVSEPLTFTWMS 270

Query: 276 VDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTV 335
              +     +L+FAEI   +     R F IL+NG      V  +     ++ A  L T  
Sbjct: 271 ESSDDETYAYLYFAEIQQ-LKANETRQFKILVNG------VYYIDYIPRKFEAETLITPA 323

Query: 336 AVN--GRTLTVTLH--PKGGSHAIINAIEVFEIIAV-ESKTLPEEVRALQVLKNSLDLPH 390
           A+   G    V L   PK      +NAIE+F +I   +S T  +EV A++ ++++  +  
Sbjct: 324 ALKCGGGVCRVQLSKTPKSTLPPQMNAIEIFSVIQFPQSDTNTDEVIAIKNIQSTYKV-S 382

Query: 391 RFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSIN 450
           R  W GDPCVP Q  W G  C     S    I  L L + GL G +   I  L  L+ ++
Sbjct: 383 RISWQGDPCVPIQFSWMGVSCNVIDISTPPRIISLDLSSSGLTGVITPSIQNLTMLRELD 442

Query: 451 LSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPA 510
           LS N++ G IP SL  +  L  LDLS N   G +PE L  +  L  ++L GN L G VP 
Sbjct: 443 LSNNNLTGVIPPSLQNLTMLRELDLSNNNLTGEVPEFLATIKPLLVIHLRGNNLRGSVPQ 502

Query: 511 ALGGR 515
           AL  R
Sbjct: 503 ALQDR 507





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 Back     alignment and function description
>sp|Q9SNA3|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZQR3|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 OS=Arabidopsis thaliana GN=At2g14510 PE=2 SV=1 Back     alignment and function description
>sp|Q9FN94|RLK7_ARATH Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 Back     alignment and function description
>sp|O81069|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 Back     alignment and function description
>sp|C0LGD9|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
449457751621 PREDICTED: putative leucine-rich repeat 0.988 0.845 0.763 0.0
359483663624 PREDICTED: putative leucine-rich repeat 0.947 0.806 0.789 0.0
224079175596 predicted protein [Populus trichocarpa] 0.937 0.835 0.795 0.0
255536757629 serine-threonine protein kinase, plant-t 0.988 0.834 0.757 0.0
449511662621 PREDICTED: putative leucine-rich repeat 0.988 0.845 0.76 0.0
449457749625 PREDICTED: putative leucine-rich repeat 0.945 0.803 0.776 0.0
449511656625 PREDICTED: putative leucine-rich repeat 0.945 0.803 0.774 0.0
6560758 697 F3M18.23 [Arabidopsis thaliana] 0.988 0.753 0.735 0.0
15217901626 receptor like protein 4 [Arabidopsis tha 0.988 0.838 0.735 0.0
356549305625 PREDICTED: putative leucine-rich repeat 0.986 0.838 0.719 0.0
>gi|449457751|ref|XP_004146611.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 455/525 (86%)

Query: 1   MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPAN 60
           MLRF  L LL+     + SSAR  PFA+RISCGAR ++H+PPTNT WFKDFAYTGGIPAN
Sbjct: 1   MLRFILLCLLIHGFLFSLSSARPLPFALRISCGARNDVHTPPTNTPWFKDFAYTGGIPAN 60

Query: 61  ATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDIS 120
           ATRPSFI+PPLKTLRYFPL  GPENCYIINRVP+GHY+VRIFFGLV   +FD EPLFD+S
Sbjct: 61  ATRPSFISPPLKTLRYFPLYTGPENCYIINRVPRGHYSVRIFFGLVNQNNFDTEPLFDVS 120

Query: 121 VEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAY 180
           VEGTQ  SLKSGWS++D++ FAEALVFL DG+ SICFHSTGHGDPAIL++EILQ+D+KAY
Sbjct: 121 VEGTQFCSLKSGWSNNDEQTFAEALVFLTDGSASICFHSTGHGDPAILAIEILQIDEKAY 180

Query: 181 YFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTES 240
            FG  WGEG+ILRTATRLSCG+GKPKFD D  G+HWGGDRFW  I +FGQ +D+  S E+
Sbjct: 181 DFGPNWGEGVILRTATRLSCGDGKPKFDADSHGNHWGGDRFWTAIKTFGQQSDRIISVEN 240

Query: 241 SIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQ 300
           SIKQAS +PNFYPEALY++ALVSTDSQP+L Y MDVDPNRNYSIWLHFAEID +I  VGQ
Sbjct: 241 SIKQASISPNFYPEALYRSALVSTDSQPELTYVMDVDPNRNYSIWLHFAEIDGSIRNVGQ 300

Query: 301 RVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIE 360
           R+FDILINGD+AF  VD++K++G  YTALVLN+TVAVNGRTLT+TL PK GS+AIINAIE
Sbjct: 301 RIFDILINGDVAFPNVDILKLTGGHYTALVLNSTVAVNGRTLTITLQPKEGSYAIINAIE 360

Query: 361 VFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKW 420
           VFE+++ E KT P EVRAL+ LK +L LP R GWNGDPCVPQQHPWSGADCQ+D+  +KW
Sbjct: 361 VFEVVSAEVKTSPNEVRALRSLKKALALPVRLGWNGDPCVPQQHPWSGADCQYDKVGNKW 420

Query: 421 VIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFF 480
           VIDGLGLDNQGL GFLPN  S+LRHLQSINLSGNSI G IP+SLGTIA LEVLDLSYNFF
Sbjct: 421 VIDGLGLDNQGLTGFLPNETSQLRHLQSINLSGNSIHGPIPASLGTIAKLEVLDLSYNFF 480

Query: 481 NGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYV 525
           NGSIPESLGQLT+LR LNLNGN+LSGRVPAALG RLLHRASF + 
Sbjct: 481 NGSIPESLGQLTSLRTLNLNGNSLSGRVPAALGARLLHRASFNFT 525




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483663|ref|XP_002279791.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Vitis vinifera] gi|297740416|emb|CBI30598.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224079175|ref|XP_002305781.1| predicted protein [Populus trichocarpa] gi|222848745|gb|EEE86292.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255536757|ref|XP_002509445.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549344|gb|EEF50832.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449511662|ref|XP_004164020.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449457749|ref|XP_004146610.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511656|ref|XP_004164019.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|6560758|gb|AAF16758.1|AC010155_11 F3M18.23 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15217901|ref|NP_174156.1| receptor like protein 4 [Arabidopsis thaliana] gi|332192839|gb|AEE30960.1| receptor like protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356549305|ref|XP_003543034.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query531
TAIR|locus:2032221626 RLP4 "receptor like protein 4" 0.986 0.837 0.736 2.8e-217
TAIR|locus:2031175628 AT1G25570 [Arabidopsis thalian 0.924 0.781 0.382 7.6e-80
TAIR|locus:2083023517 AT3G05990 [Arabidopsis thalian 0.516 0.529 0.354 1.5e-35
TAIR|locus:2094103519 AT3G19230 [Arabidopsis thalian 0.794 0.813 0.274 6e-34
TAIR|locus:2055160 886 AT2G14440 [Arabidopsis thalian 0.870 0.521 0.288 4.8e-33
TAIR|locus:2028446 888 AT1G49100 [Arabidopsis thalian 0.772 0.461 0.272 1.3e-32
TAIR|locus:2017572 882 AT1G51790 [Arabidopsis thalian 0.854 0.514 0.281 2e-30
TAIR|locus:2195850 890 AT1G51860 [Arabidopsis thalian 0.896 0.534 0.254 2e-30
TAIR|locus:2078186 889 AT3G46340 [Arabidopsis thalian 0.602 0.359 0.298 6.2e-30
TAIR|locus:2059804 892 AT2G04300 [Arabidopsis thalian 0.770 0.458 0.270 1.1e-29
TAIR|locus:2032221 RLP4 "receptor like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2099 (743.9 bits), Expect = 2.8e-217, P = 2.8e-217
 Identities = 386/524 (73%), Positives = 446/524 (85%)

Query:     1 MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPAN 60
             MLRF    LL+   +L SS AR AP+A+RISCGAR+N+ +PPT  LWFKD AYTGG+PAN
Sbjct:     2 MLRFILASLLLSSFSLYSSLARPAPYALRISCGARKNVRTPPTYALWFKDIAYTGGVPAN 61

Query:    61 ATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDIS 120
             AT P++ITPPLKTLRYFP+SEGP NCY I RVPKGHY+VRIFFGLV   SFD EPLFDIS
Sbjct:    62 ATTPTYITPPLKTLRYFPISEGPNNCYNIVRVPKGHYSVRIFFGLVDQPSFDKEPLFDIS 121

Query:   121 VEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAY 180
             +EGTQI SLKSGWS  DD+ FAEAL+FL  GT +ICFHSTGHGDPAILS+EILQVDDKAY
Sbjct:   122 IEGTQISSLKSGWSSQDDQVFAEALIFLLGGTATICFHSTGHGDPAILSIEILQVDDKAY 181

Query:   181 YFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTES 240
              FG+GWG+G+ILRTATRL+CG GK +FD DY GDHWGGDRFWN + SFG++AD  RSTE 
Sbjct:   182 SFGEGWGQGVILRTATRLTCGTGKSRFDEDYRGDHWGGDRFWNRMRSFGKSADSPRSTEE 241

Query:   241 SIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQ 300
             +IK+AS +PNFYPE LYQ+ALVSTD QPDL Y++DV+PNRNYS+WLHFAEIDNTIT  G+
Sbjct:   242 TIKKASVSPNFYPEGLYQSALVSTDDQPDLTYSLDVEPNRNYSVWLHFAEIDNTITAEGK 301

Query:   301 RVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIE 360
             RVFD++INGD  F+ VD++KMSG RY ALVLN TV V+GRTLTV L PK G HAIINAIE
Sbjct:   302 RVFDVVINGDTFFEDVDIIKMSGGRYAALVLNATVTVSGRTLTVVLQPKAGGHAIINAIE 361

Query:   361 VFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKW 420
             VFEII  E KTL +EV ALQ +K +L LP RFGWNGDPCVP QHPWSGA+CQ D+ + +W
Sbjct:   362 VFEIITAEFKTLRDEVSALQKMKKALGLPSRFGWNGDPCVPPQHPWSGANCQLDKNTSRW 421

Query:   421 VIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFF 480
              IDGL LDNQGL+GFLPN ISKL+HLQSINLS N+IRG IP+SLG++ SLEVLDLSYN F
Sbjct:   422 FIDGLDLDNQGLKGFLPNDISKLKHLQSINLSENNIRGGIPASLGSVTSLEVLDLSYNSF 481

Query:   481 NGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY 524
             NGSIPE+LG+LT+LR LNLNGN+LSG+VPAA+GGRLLHRASF +
Sbjct:   482 NGSIPETLGELTSLRILNLNGNSLSGKVPAAVGGRLLHRASFNF 525




GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
GO:0005768 "endosome" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2031175 AT1G25570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083023 AT3G05990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094103 AT3G19230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055160 AT2G14440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028446 AT1G49100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017572 AT1G51790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195850 AT1G51860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078186 AT3G46340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059804 AT2G04300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00040482
hypothetical protein (596 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.0
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 6e-71
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score =  972 bits (2514), Expect = 0.0
 Identities = 412/520 (79%), Positives = 453/520 (87%), Gaps = 2/520 (0%)

Query: 7   LWLLVFCS--ALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRP 64
           LWLL   +  A+ +S A   PF MRISCGAR N+ + PTNTLW+KDFAYTGGIPANATRP
Sbjct: 3   LWLLAASALLAVLASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRP 62

Query: 65  SFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGT 124
           SFI PPLKTLRYFPLS+GPENCY INRVPKGHY+VR+FFGLV   +FD EPLFD+SVEGT
Sbjct: 63  SFIAPPLKTLRYFPLSDGPENCYNINRVPKGHYSVRVFFGLVAEPNFDSEPLFDVSVEGT 122

Query: 125 QIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQ 184
           QI SLKSGWS HD++ FAEALVFL DG+ SICFHSTGHGDPAILS+EILQVDDKAY FG 
Sbjct: 123 QISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEILQVDDKAYNFGP 182

Query: 185 GWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQ 244
            WG+G+ILRTA RLSCG GK KFD DYSGDHWGGDRFWN + +FG  +DQ  STE+ IK+
Sbjct: 183 SWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKK 242

Query: 245 ASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFD 304
           AS APNFYPE+LYQ+ALVSTD+QPDL YTMDVDPNRNYS+WLHFAEIDN+IT  G+RVFD
Sbjct: 243 ASNAPNFYPESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFD 302

Query: 305 ILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEI 364
           +LINGD AF+ VD+VKMSG+RYTALVLN TVAV+GRTLT+ L PK G+HAIINAIEVFEI
Sbjct: 303 VLINGDTAFKDVDIVKMSGERYTALVLNKTVAVSGRTLTIVLQPKKGTHAIINAIEVFEI 362

Query: 365 IAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDG 424
           I  ESKTL EEV ALQ LK+SL LP RFGWNGDPCVPQQHPWSGADCQFD T  KW IDG
Sbjct: 363 ITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADCQFDSTKGKWFIDG 422

Query: 425 LGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSI 484
           LGLDNQGLRGF+PN ISKLRHLQSINLSGNSIRG IP SLG+I SLEVLDLSYN FNGSI
Sbjct: 423 LGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSI 482

Query: 485 PESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY 524
           PESLGQLT+LR LNLNGN+LSGRVPAALGGRLLHRASF +
Sbjct: 483 PESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRASFNF 522


Length = 623

>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 531
PLN03150623 hypothetical protein; Provisional 100.0
PF12819347 Malectin_like: Carbohydrate-binding protein of the 100.0
PLN03150623 hypothetical protein; Provisional 99.85
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.81
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.6
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.08
PF12819347 Malectin_like: Carbohydrate-binding protein of the 98.91
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.61
KOG0617264 consensus Ras suppressor protein (contains leucine 98.6
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.54
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.39
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.33
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.33
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.29
KOG3593355 consensus Predicted receptor-like serine/threonine 98.25
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.23
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.12
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.09
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.97
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.91
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.85
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.85
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.62
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.53
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.46
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.37
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.09
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.02
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.8
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.79
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.3
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.03
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.8
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 95.78
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.42
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 95.07
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 94.95
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.56
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.93
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.7
PRK15386 426 type III secretion protein GogB; Provisional 92.47
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 92.31
PRK15386 426 type III secretion protein GogB; Provisional 92.26
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.94
KOG2982 418 consensus Uncharacterized conserved protein [Funct 91.47
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.35
smart0037026 LRR Leucine-rich repeats, outliers. 91.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 91.14
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.68
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.81
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.78
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 88.77
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 87.37
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.77
KOG3593355 consensus Predicted receptor-like serine/threonine 85.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.4
smart0037026 LRR Leucine-rich repeats, outliers. 84.4
KOG2123 388 consensus Uncharacterized conserved protein [Funct 83.5
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-99  Score=831.46  Aligned_cols=512  Identities=80%  Similarity=1.308  Sum_probs=448.8

Q ss_pred             HhhccccccCCCCcEEEccCCCCCCcCCCCCceeeccCcccCCcccccCCCCCCCCCcceeeccCCCCCCcceEEeeecC
Q 009603           14 SALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVP   93 (531)
Q Consensus        14 ~~~~~~~~~~~~~~i~IdCG~~~~~~~~~~g~~w~~D~~~~~~~~~~~~~~~~~~~~y~t~R~F~~~~g~~~cY~~~~~~   93 (531)
                      +++.++++++++++|+||||++.+.++|.+||+|++|..|++|.......+....++|+|+|+||..+|+++||+||+++
T Consensus        12 ~~~~~~~~~~~~~~~~I~CGs~~~~~~d~~~~~w~~D~~~~~~~~~~~~~~~~~~~~~~t~R~F~~~~g~~~cY~~~~~~   91 (623)
T PLN03150         12 LAVLASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRPSFIAPPLKTLRYFPLSDGPENCYNINRVP   91 (623)
T ss_pred             HHhhcccccCCCccEEEeCCCCCCcccCCCCCEEcCCcccccCccccccCcccccchhhccccCCcccccccceEeeecC
Confidence            34445566678899999999998754556899999998877655444444444567899999999767889999999999


Q ss_pred             CceeEEEEEEecccCCCCCCCCcEEEEEcCeeEEEeecCCCCCccceEEEEEEEecCCeEEEEEeecCCCCCcEEeEEEE
Q 009603           94 KGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEIL  173 (531)
Q Consensus        94 ~g~ylvRl~F~~~~y~~~~~~~~F~v~~~~~~w~~v~~~~~~~~~~~~~E~~~~~~~~~l~v~f~~~~~~~pfIsaiEl~  173 (531)
                      +|+|+|||||+||+||+.++.|.|||++|++.|.+|+.+|+..+..++||++++++++.++|||+|++.++||||+||||
T Consensus        92 ~g~ylVRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~~~~v~~E~i~~~~~~~l~vcf~~~~~~~pFIs~iEv~  171 (623)
T PLN03150         92 KGHYSVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEIL  171 (623)
T ss_pred             CCcEEEEEEeecCCcCCCCCCCceEEEECcEEEEEEecCcccCCCcEEEEEEEEecCCcEEEEEecCCCCCCceeEEEEE
Confidence            99999999999999999889999999999999999999887667789999999999999999999998999999999999


Q ss_pred             EcCCCccccCCCCccceeEEEEeeecCCCCCCCCcCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCCh
Q 009603          174 QVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYP  253 (531)
Q Consensus       174 ~l~~~~y~~~~~~~~~~~l~~~~Rin~G~~~~~~~~~~~~d~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P  253 (531)
                      |+|+++|..+.+...+.+|+++||+||||....+.+||++|+|++||+|.+|..+....+..+++...|.++...++.+|
T Consensus       172 ~l~~~~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~~~~~~st~~~I~~~~~~~~~~P  251 (623)
T PLN03150        172 QVDDKAYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASNAPNFYP  251 (623)
T ss_pred             EcCcccccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCCcccccccccccccccCCCccCh
Confidence            99999997543223467899999999999877777999999999999999987655455666777777776556677899


Q ss_pred             HHHHHHhhccCCCCCCeEEEEecCCCCcEEEEEEeeeccCCCCCCceEEEEEEECCeeeccCCceeeecCCceeeEEEEE
Q 009603          254 EALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNT  333 (531)
Q Consensus       254 ~~Vy~TAr~~~~~~~~l~~~~~v~~~~~y~v~LhFaei~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~  333 (531)
                      +.||||||++.+...+++|.|++++++.|+|||||||++......++|+|||+|||+.+++++|+...+++.+.++++++
T Consensus       252 ~~VyqTA~~~~~~~~~lty~~~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~g~~~~~~~~~~  331 (623)
T PLN03150        252 ESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSGERYTALVLNK  331 (623)
T ss_pred             HHHhhhhccccCCCCceEEEeecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeecccChhhhcCCcccceEEEe
Confidence            99999999987655689999999999999999999999754456789999999999999999999887777778899998


Q ss_pred             EeeecCceEEEEEccCCCchhhhhhHhhhhhhhhccCCchHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCcccccc
Q 009603          334 TVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQF  413 (531)
Q Consensus       334 ~v~~~~~~l~i~~~p~~~~~p~lnalei~~~~~~~~~~~~~~~~aL~~~k~~~~~~~~~~W~~~~C~~~~~~w~gv~C~~  413 (531)
                      .+.++++.++|+|+|..+++|+||||||+++...+..+.+.|+.||+.+|+.+..+...+|+++||.|..++|.||.|..
T Consensus       332 ~v~~~~g~l~isl~p~~~s~pilNaiEI~~~~~~~~~t~~~~~~aL~~~k~~~~~~~~~~W~g~~C~p~~~~w~Gv~C~~  411 (623)
T PLN03150        332 TVAVSGRTLTIVLQPKKGTHAIINAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADCQF  411 (623)
T ss_pred             EEeecCCeEEEEEeeCCCCcceeeeeeeeeccccccccCchHHHHHHHHHHhcCCcccCCCCCCCCCCcccccccceeec
Confidence            88887888999999998888999999999999988888999999999999998766445899999998888999999975


Q ss_pred             CCCCcceEEEEEEccCCCCcccCcccccCCCCCCEEEccCCccCccCCccccCCCCCCEEecCCCcCCCCCcccccCCCC
Q 009603          414 DRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTA  493 (531)
Q Consensus       414 ~~~~~~~~l~~L~L~~n~l~g~~p~~l~~L~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~  493 (531)
                      +.......++.|+|++|++.|.+|..+++|++|+.|+|++|.+.|.+|..++.|++|+.|+|++|+|+|.+|+.+++|++
T Consensus       412 ~~~~~~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~  491 (623)
T PLN03150        412 DSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTS  491 (623)
T ss_pred             cCCCCceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCC
Confidence            44333356999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEeccCCCCCCCCChhhhhhccccceeeec
Q 009603          494 LRRLNLNGNTLSGRVPAALGGRLLHRASFKYV  525 (531)
Q Consensus       494 L~~L~L~~N~l~g~iP~~~~~~~~~l~~l~l~  525 (531)
                      |+.|+|++|+|+|.+|..++....++..+++.
T Consensus       492 L~~L~Ls~N~l~g~iP~~l~~~~~~~~~l~~~  523 (623)
T PLN03150        492 LRILNLNGNSLSGRVPAALGGRLLHRASFNFT  523 (623)
T ss_pred             CCEEECcCCcccccCChHHhhccccCceEEec
Confidence            99999999999999999998876666666655



>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-10
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-10
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-08
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 37/92 (40%), Positives = 56/92 (60%) Query: 421 VIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFF 480 ++ L LD L G +P+G+S +L I+LS N + G IP +G + +L +L LS N F Sbjct: 464 TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF 523 Query: 481 NGSIPESLGQLTALRRLNLNGNTLSGRVPAAL 512 +G+IP LG +L L+LN N +G +PAA+ Sbjct: 524 SGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 555
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query531
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-21
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 2e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A 167 C-type lectin domain family 4 member M; DC-signr, 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-08
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  113 bits (285), Expect = 4e-28
 Identities = 45/171 (26%), Positives = 70/171 (40%), Gaps = 35/171 (20%)

Query: 373 PEEVRALQVLKNSLDLPHRF-GWNG--DPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDN 429
           P++ +AL  +K  L  P     W    D C      W G  C  D  +  + ++ L L  
Sbjct: 5   PQDKQALLQIKKDLGNPTTLSSWLPTTDCC---NRTWLGVLC--DTDTQTYRVNNLDLSG 59

Query: 430 QGLRG------------FL---------------PNGISKLRHLQSINLSGNSIRGAIPS 462
             L              +L               P  I+KL  L  + ++  ++ GAIP 
Sbjct: 60  LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD 119

Query: 463 SLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALG 513
            L  I +L  LD SYN  +G++P S+  L  L  +  +GN +SG +P + G
Sbjct: 120 FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYG 170


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.93
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.87
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.69
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.54
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.33
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.24
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.19
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.18
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.16
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.14
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.1
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.1
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.1
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.1
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.09
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.03
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.03
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.03
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.03
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.03
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.03
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.02
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.02
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.02
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.01
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.01
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.0
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.0
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.99
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.98
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.96
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.93
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.92
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.91
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.89
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.87
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.83
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.81
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.77
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.68
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.64
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.63
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.63
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.61
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.6
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.6
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.58
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.56
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.56
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.54
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.51
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.5
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.5
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.48
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.42
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.4
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.28
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.22
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.04
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.9
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.67
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.66
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.6
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.56
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.38
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.39
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.32
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.69
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.66
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 89.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 87.14
2w3j_A145 Carbohydrate binding module; sugar-binding protein 86.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 86.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 86.34
2vzp_A127 Aocbm35, EXO-beta-D-glucosaminidase; family 35, CS 83.64
2w47_A144 Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1. 82.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 81.93
2wz8_A156 Cellulosome protein dockerin type I; sugar binding 81.1
2w3j_A145 Carbohydrate binding module; sugar-binding protein 80.16
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
Probab=99.93  E-value=3.1e-27  Score=217.64  Aligned_cols=154  Identities=19%  Similarity=0.214  Sum_probs=113.8

Q ss_pred             EEEeeecCCCCCCCCcCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCChHHHHHHhhccCCCCCCeEE
Q 009603          193 RTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQY  272 (531)
Q Consensus       193 ~~~~Rin~G~~~~~~~~~~~~d~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P~~Vy~TAr~~~~~~~~l~~  272 (531)
                      +++|||||||+..   .|    ..  +|.|.+|..+...+... .....+..  ...+.+|..||||||.+..   +++|
T Consensus         5 ~~~~~INcGg~~~---~d----~~--gr~w~~D~~~~~~g~~~-~~~~~~~~--~~~~~~~~~lY~TaR~~~~---~~tY   69 (174)
T 2jwp_A            5 KVIWAVNAGGESH---VD----VH--GIHYRKDPLEGRVGRAS-DYGMKLPI--LRSNPEDQVLYQTERYNED---SFGY   69 (174)
T ss_dssp             HEEEEEEETSSSE---EE----TT--TEEECSSCSSTTCCCCC-CCCTTSCC--SSSCHHHHHTTTCCCCCCS---CEEE
T ss_pred             cEEEEEECCCCCc---cC----CC--CCEEcCCcCcccCCccc-ccccceEe--cccCCCCchhhhhhccCCC---CeEE
Confidence            5789999999753   22    22  68888776432111100 00011111  1123468899999999765   4999


Q ss_pred             EEecCCCCcEEEEEEeeeccCCCCCCceEEEEEEECCeeeccCCceeeecCCceeeEEEEEEee-------------ecC
Q 009603          273 TMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVA-------------VNG  339 (531)
Q Consensus       273 ~~~v~~~~~y~v~LhFaei~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~~v~-------------~~~  339 (531)
                      .|+++++|+|+|||||||+..  .+.++|+|||+|||++++++||+.+++|+ ..++++++.+.             +.+
T Consensus        70 ~f~v~~~G~Y~VrLhF~ei~~--~~~~~rvFdV~ing~~~l~~fdi~~~ag~-~~~~~~~~~~~v~~~~l~i~~~~~~~~  146 (174)
T 2jwp_A           70 DIPIKEEGEYVLVLKFAEVYF--AQSQQKVFDVRVNGHTVVKDLDIFDRVGH-STAHDEIIPISIKKGKLSVQGEVSTFT  146 (174)
T ss_dssp             EEECCSCEEEEEEEEEECCSC--CCSSSSCEEEEETTEEEEEEECHHHHHSS-SSCEEEEEEEEEETTEEEETTEEEECC
T ss_pred             EEEeCCCeEEEEEEEEecccc--CCCCCeEeEEEECCEEeecCcCHHHhhCC-CeeEEEEEEEEEecCceeeeeeecccC
Confidence            999998899999999999975  45889999999999999999999988876 46777777665             356


Q ss_pred             ceEEEEEccCCCchhhhhhHhhhhh
Q 009603          340 RTLTVTLHPKGGSHAIINAIEVFEI  364 (531)
Q Consensus       340 ~~l~i~~~p~~~~~p~lnalei~~~  364 (531)
                      ++|+|+|.|.....|+||||||++.
T Consensus       147 g~L~I~f~p~~~~~a~inaIEI~~~  171 (174)
T 2jwp_A          147 GKLSVEFVKGYYDNPKVCALFIMKG  171 (174)
T ss_dssp             SEEEEEEECSSSCSSSEEEEEEESS
T ss_pred             CeEEEEEeccCCCCcEEEEEEEEeC
Confidence            7899999987666799999999864



>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2vzp_A Aocbm35, EXO-beta-D-glucosaminidase; family 35, CSXA, glucuronic acid, hydrolase; 1.05A {Amycolatopsis orientalis} PDB: 2vzq_A* 2vzr_A* Back     alignment and structure
>2w47_A Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1.40A {Clostridium thermocellum} PDB: 2w1w_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2wz8_A Cellulosome protein dockerin type I; sugar binding protein; 1.50A {Clostridium thermocellum} Back     alignment and structure
>2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 531
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 70.8 bits (172), Expect = 8e-14
 Identities = 25/125 (20%), Positives = 42/125 (33%), Gaps = 7/125 (5%)

Query: 379 LQVLKNS-LDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLP 437
           L  LK     + +     G   +                S+   +  L L    +    P
Sbjct: 265 LTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP 324

Query: 438 NGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRL 497
             +S L  LQ +  + N +     SSL  + ++  L   +N  +   P  L  LT + +L
Sbjct: 325 --VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQL 378

Query: 498 NLNGN 502
            LN  
Sbjct: 379 GLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query531
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.15
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.01
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.97
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 98.83
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.7
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.36
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.36
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.34
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.31
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.31
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.29
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.26
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.01
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.92
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 97.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.52
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.33
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.02
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.99
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 96.95
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.34
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 87.85
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.78  E-value=1.5e-19  Score=179.55  Aligned_cols=149  Identities=26%  Similarity=0.505  Sum_probs=120.2

Q ss_pred             CchHHHHHHHHHHhhcCCCCC-CCCC--CCCCCCCCCCCCccccccCCCCcceEEEEEEccCCCCcc--cCcccccCCCC
Q 009603          371 TLPEEVRALQVLKNSLDLPHR-FGWN--GDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRG--FLPNGISKLRH  445 (531)
Q Consensus       371 ~~~~~~~aL~~~k~~~~~~~~-~~W~--~~~C~~~~~~w~gv~C~~~~~~~~~~l~~L~L~~n~l~g--~~p~~l~~L~~  445 (531)
                      |.++|++||++||+.+.++.. .+|.  +|+|.   +.|.||.|+...  ...+|+.|+|+++++.|  .+|+.+++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~---~~w~gv~C~~~~--~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~   77 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN---RTWLGVLCDTDT--QTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT---TCSTTEEECCSS--SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC---CcCCCeEEeCCC--CcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence            678999999999999987643 4785  46663   469999997533  23479999999999998  58899999999


Q ss_pred             CCEEEccC-CccCccCCccccCCCCCCEEecCCCcCCCCCcccccCCCCCCEEeccCCCCCCCCChhhhhhccccceeee
Q 009603          446 LQSINLSG-NSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY  524 (531)
Q Consensus       446 L~~L~Ls~-N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~L~~L~L~~N~l~g~iP~~~~~~~~~l~~l~l  524 (531)
                      |++|+|++ |+++|.+|.+|++|++|++|+|++|++.+..|..+..+.+|+.++++.|.+.+.+|..+..+ .++..+++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l-~~L~~l~l  156 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSL-PNLVGITF  156 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC-TTCCEEEC
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccC-cccceeec
Confidence            99999986 89999999999999999999999999988777777777777777777777777777666543 34555555


Q ss_pred             c
Q 009603          525 V  525 (531)
Q Consensus       525 ~  525 (531)
                      .
T Consensus       157 ~  157 (313)
T d1ogqa_         157 D  157 (313)
T ss_dssp             C
T ss_pred             c
Confidence            4



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure