Citrus Sinensis ID: 009603
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 531 | ||||||
| 449457751 | 621 | PREDICTED: putative leucine-rich repeat | 0.988 | 0.845 | 0.763 | 0.0 | |
| 359483663 | 624 | PREDICTED: putative leucine-rich repeat | 0.947 | 0.806 | 0.789 | 0.0 | |
| 224079175 | 596 | predicted protein [Populus trichocarpa] | 0.937 | 0.835 | 0.795 | 0.0 | |
| 255536757 | 629 | serine-threonine protein kinase, plant-t | 0.988 | 0.834 | 0.757 | 0.0 | |
| 449511662 | 621 | PREDICTED: putative leucine-rich repeat | 0.988 | 0.845 | 0.76 | 0.0 | |
| 449457749 | 625 | PREDICTED: putative leucine-rich repeat | 0.945 | 0.803 | 0.776 | 0.0 | |
| 449511656 | 625 | PREDICTED: putative leucine-rich repeat | 0.945 | 0.803 | 0.774 | 0.0 | |
| 6560758 | 697 | F3M18.23 [Arabidopsis thaliana] | 0.988 | 0.753 | 0.735 | 0.0 | |
| 15217901 | 626 | receptor like protein 4 [Arabidopsis tha | 0.988 | 0.838 | 0.735 | 0.0 | |
| 356549305 | 625 | PREDICTED: putative leucine-rich repeat | 0.986 | 0.838 | 0.719 | 0.0 |
| >gi|449457751|ref|XP_004146611.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 843 bits (2178), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 401/525 (76%), Positives = 455/525 (86%)
Query: 1 MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPAN 60
MLRF L LL+ + SSAR PFA+RISCGAR ++H+PPTNT WFKDFAYTGGIPAN
Sbjct: 1 MLRFILLCLLIHGFLFSLSSARPLPFALRISCGARNDVHTPPTNTPWFKDFAYTGGIPAN 60
Query: 61 ATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDIS 120
ATRPSFI+PPLKTLRYFPL GPENCYIINRVP+GHY+VRIFFGLV +FD EPLFD+S
Sbjct: 61 ATRPSFISPPLKTLRYFPLYTGPENCYIINRVPRGHYSVRIFFGLVNQNNFDTEPLFDVS 120
Query: 121 VEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAY 180
VEGTQ SLKSGWS++D++ FAEALVFL DG+ SICFHSTGHGDPAIL++EILQ+D+KAY
Sbjct: 121 VEGTQFCSLKSGWSNNDEQTFAEALVFLTDGSASICFHSTGHGDPAILAIEILQIDEKAY 180
Query: 181 YFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTES 240
FG WGEG+ILRTATRLSCG+GKPKFD D G+HWGGDRFW I +FGQ +D+ S E+
Sbjct: 181 DFGPNWGEGVILRTATRLSCGDGKPKFDADSHGNHWGGDRFWTAIKTFGQQSDRIISVEN 240
Query: 241 SIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQ 300
SIKQAS +PNFYPEALY++ALVSTDSQP+L Y MDVDPNRNYSIWLHFAEID +I VGQ
Sbjct: 241 SIKQASISPNFYPEALYRSALVSTDSQPELTYVMDVDPNRNYSIWLHFAEIDGSIRNVGQ 300
Query: 301 RVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIE 360
R+FDILINGD+AF VD++K++G YTALVLN+TVAVNGRTLT+TL PK GS+AIINAIE
Sbjct: 301 RIFDILINGDVAFPNVDILKLTGGHYTALVLNSTVAVNGRTLTITLQPKEGSYAIINAIE 360
Query: 361 VFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKW 420
VFE+++ E KT P EVRAL+ LK +L LP R GWNGDPCVPQQHPWSGADCQ+D+ +KW
Sbjct: 361 VFEVVSAEVKTSPNEVRALRSLKKALALPVRLGWNGDPCVPQQHPWSGADCQYDKVGNKW 420
Query: 421 VIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFF 480
VIDGLGLDNQGL GFLPN S+LRHLQSINLSGNSI G IP+SLGTIA LEVLDLSYNFF
Sbjct: 421 VIDGLGLDNQGLTGFLPNETSQLRHLQSINLSGNSIHGPIPASLGTIAKLEVLDLSYNFF 480
Query: 481 NGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKYV 525
NGSIPESLGQLT+LR LNLNGN+LSGRVPAALG RLLHRASF +
Sbjct: 481 NGSIPESLGQLTSLRTLNLNGNSLSGRVPAALGARLLHRASFNFT 525
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359483663|ref|XP_002279791.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Vitis vinifera] gi|297740416|emb|CBI30598.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224079175|ref|XP_002305781.1| predicted protein [Populus trichocarpa] gi|222848745|gb|EEE86292.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255536757|ref|XP_002509445.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549344|gb|EEF50832.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449511662|ref|XP_004164020.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449457749|ref|XP_004146610.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449511656|ref|XP_004164019.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|6560758|gb|AAF16758.1|AC010155_11 F3M18.23 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15217901|ref|NP_174156.1| receptor like protein 4 [Arabidopsis thaliana] gi|332192839|gb|AEE30960.1| receptor like protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356549305|ref|XP_003543034.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 531 | ||||||
| TAIR|locus:2032221 | 626 | RLP4 "receptor like protein 4" | 0.986 | 0.837 | 0.736 | 2.8e-217 | |
| TAIR|locus:2031175 | 628 | AT1G25570 [Arabidopsis thalian | 0.924 | 0.781 | 0.382 | 7.6e-80 | |
| TAIR|locus:2083023 | 517 | AT3G05990 [Arabidopsis thalian | 0.516 | 0.529 | 0.354 | 1.5e-35 | |
| TAIR|locus:2094103 | 519 | AT3G19230 [Arabidopsis thalian | 0.794 | 0.813 | 0.274 | 6e-34 | |
| TAIR|locus:2055160 | 886 | AT2G14440 [Arabidopsis thalian | 0.870 | 0.521 | 0.288 | 4.8e-33 | |
| TAIR|locus:2028446 | 888 | AT1G49100 [Arabidopsis thalian | 0.772 | 0.461 | 0.272 | 1.3e-32 | |
| TAIR|locus:2017572 | 882 | AT1G51790 [Arabidopsis thalian | 0.854 | 0.514 | 0.281 | 2e-30 | |
| TAIR|locus:2195850 | 890 | AT1G51860 [Arabidopsis thalian | 0.896 | 0.534 | 0.254 | 2e-30 | |
| TAIR|locus:2078186 | 889 | AT3G46340 [Arabidopsis thalian | 0.602 | 0.359 | 0.298 | 6.2e-30 | |
| TAIR|locus:2059804 | 892 | AT2G04300 [Arabidopsis thalian | 0.770 | 0.458 | 0.270 | 1.1e-29 |
| TAIR|locus:2032221 RLP4 "receptor like protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2099 (743.9 bits), Expect = 2.8e-217, P = 2.8e-217
Identities = 386/524 (73%), Positives = 446/524 (85%)
Query: 1 MLRFHFLWLLVFCSALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPAN 60
MLRF LL+ +L SS AR AP+A+RISCGAR+N+ +PPT LWFKD AYTGG+PAN
Sbjct: 2 MLRFILASLLLSSFSLYSSLARPAPYALRISCGARKNVRTPPTYALWFKDIAYTGGVPAN 61
Query: 61 ATRPSFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDIS 120
AT P++ITPPLKTLRYFP+SEGP NCY I RVPKGHY+VRIFFGLV SFD EPLFDIS
Sbjct: 62 ATTPTYITPPLKTLRYFPISEGPNNCYNIVRVPKGHYSVRIFFGLVDQPSFDKEPLFDIS 121
Query: 121 VEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAY 180
+EGTQI SLKSGWS DD+ FAEAL+FL GT +ICFHSTGHGDPAILS+EILQVDDKAY
Sbjct: 122 IEGTQISSLKSGWSSQDDQVFAEALIFLLGGTATICFHSTGHGDPAILSIEILQVDDKAY 181
Query: 181 YFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTES 240
FG+GWG+G+ILRTATRL+CG GK +FD DY GDHWGGDRFWN + SFG++AD RSTE
Sbjct: 182 SFGEGWGQGVILRTATRLTCGTGKSRFDEDYRGDHWGGDRFWNRMRSFGKSADSPRSTEE 241
Query: 241 SIKQASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQ 300
+IK+AS +PNFYPE LYQ+ALVSTD QPDL Y++DV+PNRNYS+WLHFAEIDNTIT G+
Sbjct: 242 TIKKASVSPNFYPEGLYQSALVSTDDQPDLTYSLDVEPNRNYSVWLHFAEIDNTITAEGK 301
Query: 301 RVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIE 360
RVFD++INGD F+ VD++KMSG RY ALVLN TV V+GRTLTV L PK G HAIINAIE
Sbjct: 302 RVFDVVINGDTFFEDVDIIKMSGGRYAALVLNATVTVSGRTLTVVLQPKAGGHAIINAIE 361
Query: 361 VFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKW 420
VFEII E KTL +EV ALQ +K +L LP RFGWNGDPCVP QHPWSGA+CQ D+ + +W
Sbjct: 362 VFEIITAEFKTLRDEVSALQKMKKALGLPSRFGWNGDPCVPPQHPWSGANCQLDKNTSRW 421
Query: 421 VIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFF 480
IDGL LDNQGL+GFLPN ISKL+HLQSINLS N+IRG IP+SLG++ SLEVLDLSYN F
Sbjct: 422 FIDGLDLDNQGLKGFLPNDISKLKHLQSINLSENNIRGGIPASLGSVTSLEVLDLSYNSF 481
Query: 481 NGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY 524
NGSIPE+LG+LT+LR LNLNGN+LSG+VPAA+GGRLLHRASF +
Sbjct: 482 NGSIPETLGELTSLRILNLNGNSLSGKVPAAVGGRLLHRASFNF 525
|
|
| TAIR|locus:2031175 AT1G25570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083023 AT3G05990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094103 AT3G19230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055160 AT2G14440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028446 AT1G49100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2017572 AT1G51790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195850 AT1G51860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078186 AT3G46340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059804 AT2G04300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00040482 | hypothetical protein (596 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 531 | |||
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.0 | |
| pfam12819 | 335 | pfam12819, Malectin_like, Carbohydrate-binding pro | 6e-71 | |
| pfam11721 | 164 | pfam11721, Malectin, Di-glucose binding within end | 1e-16 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-13 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-13 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-13 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-12 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 8e-12 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-11 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-11 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-11 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-10 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-10 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 7e-10 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-08 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 7e-08 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-07 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 1e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.001 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 0.002 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 0.004 |
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 972 bits (2514), Expect = 0.0
Identities = 412/520 (79%), Positives = 453/520 (87%), Gaps = 2/520 (0%)
Query: 7 LWLLVFCS--ALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRP 64
LWLL + A+ +S A PF MRISCGAR N+ + PTNTLW+KDFAYTGGIPANATRP
Sbjct: 3 LWLLAASALLAVLASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRP 62
Query: 65 SFITPPLKTLRYFPLSEGPENCYIINRVPKGHYNVRIFFGLVTLTSFDHEPLFDISVEGT 124
SFI PPLKTLRYFPLS+GPENCY INRVPKGHY+VR+FFGLV +FD EPLFD+SVEGT
Sbjct: 63 SFIAPPLKTLRYFPLSDGPENCYNINRVPKGHYSVRVFFGLVAEPNFDSEPLFDVSVEGT 122
Query: 125 QIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEILQVDDKAYYFGQ 184
QI SLKSGWS HD++ FAEALVFL DG+ SICFHSTGHGDPAILS+EILQVDDKAY FG
Sbjct: 123 QISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEILQVDDKAYNFGP 182
Query: 185 GWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQ 244
WG+G+ILRTA RLSCG GK KFD DYSGDHWGGDRFWN + +FG +DQ STE+ IK+
Sbjct: 183 SWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKK 242
Query: 245 ASKAPNFYPEALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFD 304
AS APNFYPE+LYQ+ALVSTD+QPDL YTMDVDPNRNYS+WLHFAEIDN+IT G+RVFD
Sbjct: 243 ASNAPNFYPESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFD 302
Query: 305 ILINGDIAFQGVDVVKMSGDRYTALVLNTTVAVNGRTLTVTLHPKGGSHAIINAIEVFEI 364
+LINGD AF+ VD+VKMSG+RYTALVLN TVAV+GRTLT+ L PK G+HAIINAIEVFEI
Sbjct: 303 VLINGDTAFKDVDIVKMSGERYTALVLNKTVAVSGRTLTIVLQPKKGTHAIINAIEVFEI 362
Query: 365 IAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDG 424
I ESKTL EEV ALQ LK+SL LP RFGWNGDPCVPQQHPWSGADCQFD T KW IDG
Sbjct: 363 ITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADCQFDSTKGKWFIDG 422
Query: 425 LGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSI 484
LGLDNQGLRGF+PN ISKLRHLQSINLSGNSIRG IP SLG+I SLEVLDLSYN FNGSI
Sbjct: 423 LGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSI 482
Query: 485 PESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY 524
PESLGQLT+LR LNLNGN+LSGRVPAALGGRLLHRASF +
Sbjct: 483 PESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRASFNF 522
|
Length = 623 |
| >gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER | Back alignment and domain information |
|---|
| >gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| PLN03150 | 623 | hypothetical protein; Provisional | 100.0 | |
| PF12819 | 347 | Malectin_like: Carbohydrate-binding protein of the | 100.0 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.85 | |
| PF11721 | 174 | Malectin: Di-glucose binding within endoplasmic re | 99.81 | |
| PF11721 | 174 | Malectin: Di-glucose binding within endoplasmic re | 99.6 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.46 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.08 | |
| PF12819 | 347 | Malectin_like: Carbohydrate-binding protein of the | 98.91 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.79 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.61 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.6 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.54 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.4 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.39 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.33 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.33 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.29 | |
| KOG3593 | 355 | consensus Predicted receptor-like serine/threonine | 98.25 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.23 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.22 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.12 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.09 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.97 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.93 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.93 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.92 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.91 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.85 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.85 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.85 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.82 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.81 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.77 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.74 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.67 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.65 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.63 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.62 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.53 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.5 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.46 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.37 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.09 | |
| PF08263 | 43 | LRRNT_2: Leucine rich repeat N-terminal domain; In | 97.02 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.92 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.8 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.79 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.43 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.3 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 96.03 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.8 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.78 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 95.73 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.42 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.07 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.95 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.61 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.56 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 92.93 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 92.7 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 92.47 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 92.31 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 92.26 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 91.94 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 91.47 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.35 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 91.23 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 91.23 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 91.14 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 89.68 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 88.81 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 88.78 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 88.77 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 87.37 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 87.1 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 85.77 | |
| KOG3593 | 355 | consensus Predicted receptor-like serine/threonine | 85.5 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 84.4 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 84.4 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 83.5 |
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-99 Score=831.46 Aligned_cols=512 Identities=80% Similarity=1.308 Sum_probs=448.8
Q ss_pred HhhccccccCCCCcEEEccCCCCCCcCCCCCceeeccCcccCCcccccCCCCCCCCCcceeeccCCCCCCcceEEeeecC
Q 009603 14 SALNSSSARHAPFAMRISCGARQNIHSPPTNTLWFKDFAYTGGIPANATRPSFITPPLKTLRYFPLSEGPENCYIINRVP 93 (531)
Q Consensus 14 ~~~~~~~~~~~~~~i~IdCG~~~~~~~~~~g~~w~~D~~~~~~~~~~~~~~~~~~~~y~t~R~F~~~~g~~~cY~~~~~~ 93 (531)
+++.++++++++++|+||||++.+.++|.+||+|++|..|++|.......+....++|+|+|+||..+|+++||+||+++
T Consensus 12 ~~~~~~~~~~~~~~~~I~CGs~~~~~~d~~~~~w~~D~~~~~~~~~~~~~~~~~~~~~~t~R~F~~~~g~~~cY~~~~~~ 91 (623)
T PLN03150 12 LAVLASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRPSFIAPPLKTLRYFPLSDGPENCYNINRVP 91 (623)
T ss_pred HHhhcccccCCCccEEEeCCCCCCcccCCCCCEEcCCcccccCccccccCcccccchhhccccCCcccccccceEeeecC
Confidence 34445566678899999999998754556899999998877655444444444567899999999767889999999999
Q ss_pred CceeEEEEEEecccCCCCCCCCcEEEEEcCeeEEEeecCCCCCccceEEEEEEEecCCeEEEEEeecCCCCCcEEeEEEE
Q 009603 94 KGHYNVRIFFGLVTLTSFDHEPLFDISVEGTQIYSLKSGWSDHDDRAFAEALVFLRDGTVSICFHSTGHGDPAILSLEIL 173 (531)
Q Consensus 94 ~g~ylvRl~F~~~~y~~~~~~~~F~v~~~~~~w~~v~~~~~~~~~~~~~E~~~~~~~~~l~v~f~~~~~~~pfIsaiEl~ 173 (531)
+|+|+|||||+||+||+.++.|.|||++|++.|.+|+.+|+..+..++||++++++++.++|||+|++.++||||+||||
T Consensus 92 ~g~ylVRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~~~~v~~E~i~~~~~~~l~vcf~~~~~~~pFIs~iEv~ 171 (623)
T PLN03150 92 KGHYSVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSHDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEIL 171 (623)
T ss_pred CCcEEEEEEeecCCcCCCCCCCceEEEECcEEEEEEecCcccCCCcEEEEEEEEecCCcEEEEEecCCCCCCceeEEEEE
Confidence 99999999999999999889999999999999999999887667789999999999999999999998999999999999
Q ss_pred EcCCCccccCCCCccceeEEEEeeecCCCCCCCCcCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCCh
Q 009603 174 QVDDKAYYFGQGWGEGLILRTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYP 253 (531)
Q Consensus 174 ~l~~~~y~~~~~~~~~~~l~~~~Rin~G~~~~~~~~~~~~d~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P 253 (531)
|+|+++|..+.+...+.+|+++||+||||....+.+||++|+|++||+|.+|..+....+..+++...|.++...++.+|
T Consensus 172 ~l~~~~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~~~~~~st~~~I~~~~~~~~~~P 251 (623)
T PLN03150 172 QVDDKAYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASNAPNFYP 251 (623)
T ss_pred EcCcccccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCCcccccccccccccccCCCccCh
Confidence 99999997543223467899999999999877777999999999999999987655455666777777776556677899
Q ss_pred HHHHHHhhccCCCCCCeEEEEecCCCCcEEEEEEeeeccCCCCCCceEEEEEEECCeeeccCCceeeecCCceeeEEEEE
Q 009603 254 EALYQTALVSTDSQPDLQYTMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNT 333 (531)
Q Consensus 254 ~~Vy~TAr~~~~~~~~l~~~~~v~~~~~y~v~LhFaei~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~ 333 (531)
+.||||||++.+...+++|.|++++++.|+|||||||++......++|+|||+|||+.+++++|+...+++.+.++++++
T Consensus 252 ~~VyqTA~~~~~~~~~lty~~~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~g~~~~~~~~~~ 331 (623)
T PLN03150 252 ESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSGERYTALVLNK 331 (623)
T ss_pred HHHhhhhccccCCCCceEEEeecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeecccChhhhcCCcccceEEEe
Confidence 99999999987655689999999999999999999999754456789999999999999999999887777778899998
Q ss_pred EeeecCceEEEEEccCCCchhhhhhHhhhhhhhhccCCchHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCcccccc
Q 009603 334 TVAVNGRTLTVTLHPKGGSHAIINAIEVFEIIAVESKTLPEEVRALQVLKNSLDLPHRFGWNGDPCVPQQHPWSGADCQF 413 (531)
Q Consensus 334 ~v~~~~~~l~i~~~p~~~~~p~lnalei~~~~~~~~~~~~~~~~aL~~~k~~~~~~~~~~W~~~~C~~~~~~w~gv~C~~ 413 (531)
.+.++++.++|+|+|..+++|+||||||+++...+..+.+.|+.||+.+|+.+..+...+|+++||.|..++|.||.|..
T Consensus 332 ~v~~~~g~l~isl~p~~~s~pilNaiEI~~~~~~~~~t~~~~~~aL~~~k~~~~~~~~~~W~g~~C~p~~~~w~Gv~C~~ 411 (623)
T PLN03150 332 TVAVSGRTLTIVLQPKKGTHAIINAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADCQF 411 (623)
T ss_pred EEeecCCeEEEEEeeCCCCcceeeeeeeeeccccccccCchHHHHHHHHHHhcCCcccCCCCCCCCCCcccccccceeec
Confidence 88887888999999998888999999999999988888999999999999998766445899999998888999999975
Q ss_pred CCCCcceEEEEEEccCCCCcccCcccccCCCCCCEEEccCCccCccCCccccCCCCCCEEecCCCcCCCCCcccccCCCC
Q 009603 414 DRTSHKWVIDGLGLDNQGLRGFLPNGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTA 493 (531)
Q Consensus 414 ~~~~~~~~l~~L~L~~n~l~g~~p~~l~~L~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~ 493 (531)
+.......++.|+|++|++.|.+|..+++|++|+.|+|++|.+.|.+|..++.|++|+.|+|++|+|+|.+|+.+++|++
T Consensus 412 ~~~~~~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~ 491 (623)
T PLN03150 412 DSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTS 491 (623)
T ss_pred cCCCCceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCC
Confidence 44333356999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCEEeccCCCCCCCCChhhhhhccccceeeec
Q 009603 494 LRRLNLNGNTLSGRVPAALGGRLLHRASFKYV 525 (531)
Q Consensus 494 L~~L~L~~N~l~g~iP~~~~~~~~~l~~l~l~ 525 (531)
|+.|+|++|+|+|.+|..++....++..+++.
T Consensus 492 L~~L~Ls~N~l~g~iP~~l~~~~~~~~~l~~~ 523 (623)
T PLN03150 492 LRILNLNGNSLSGRVPAALGGRLLHRASFNFT 523 (623)
T ss_pred CCEEECcCCcccccCChHHhhccccCceEEec
Confidence 99999999999999999998876666666655
|
|
| >PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan | Back alignment and domain information |
|---|
| >PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 531 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 1e-10 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 1e-10 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 3e-08 | ||
| 3rfs_A | 272 | Design Of A Binding Scaffold Based On Variable Lymp | 4e-04 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 531 | |||
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-28 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 3e-24 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-22 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-22 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 5e-21 | |
| 2jwp_A | 174 | Malectin, MGC80075; sugar binding, sugar binding p | 2e-27 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-24 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-24 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-22 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-22 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-20 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-19 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-18 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-16 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-16 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-13 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-12 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-19 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-17 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-17 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-14 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-13 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-12 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-09 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-18 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-18 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-15 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-11 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-17 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-16 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-13 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-12 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-12 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-16 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-16 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-14 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-14 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-15 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-12 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-12 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-09 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-14 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-14 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-14 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-13 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-12 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-11 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-11 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-10 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-12 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-11 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-10 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-11 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-11 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-10 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 6e-10 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-11 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-11 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 9e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-10 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 8e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 9e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 9e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-10 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-10 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-10 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 9e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 9e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-10 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-10 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 7e-09 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 7e-10 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 5e-09 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-09 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 7e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 9e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-09 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 7e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 9e-08 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 3e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 6e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 3e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 7e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 7e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 4e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 8e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 6e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 6e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 6e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 9e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 7e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 8e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 7e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 9e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 6e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-05 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 4e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 5e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 8e-05 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-04 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 2e-04 |
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
Score = 113 bits (285), Expect = 4e-28
Identities = 45/171 (26%), Positives = 70/171 (40%), Gaps = 35/171 (20%)
Query: 373 PEEVRALQVLKNSLDLPHRF-GWNG--DPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDN 429
P++ +AL +K L P W D C W G C D + + ++ L L
Sbjct: 5 PQDKQALLQIKKDLGNPTTLSSWLPTTDCC---NRTWLGVLC--DTDTQTYRVNNLDLSG 59
Query: 430 QGLRG------------FL---------------PNGISKLRHLQSINLSGNSIRGAIPS 462
L +L P I+KL L + ++ ++ GAIP
Sbjct: 60 LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD 119
Query: 463 SLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALG 513
L I +L LD SYN +G++P S+ L L + +GN +SG +P + G
Sbjct: 120 FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYG 170
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| 2jwp_A | 174 | Malectin, MGC80075; sugar binding, sugar binding p | 99.93 | |
| 2jwp_A | 174 | Malectin, MGC80075; sugar binding, sugar binding p | 99.87 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.73 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.69 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.64 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.54 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.49 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.44 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.42 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.42 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.41 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.39 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.37 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.33 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.29 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.28 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.27 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.26 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.24 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.24 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.21 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.21 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.2 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.2 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.19 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.19 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.18 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.18 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.18 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.17 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.16 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.16 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.15 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.15 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.14 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.14 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.13 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.13 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.13 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.12 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.11 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.1 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.1 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.1 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.1 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.1 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.09 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.09 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.07 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.03 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.03 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.03 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.03 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.03 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.03 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.03 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.02 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.02 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.02 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.01 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.01 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.0 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.0 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.0 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.99 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.98 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.97 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.97 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.96 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.96 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.94 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.93 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.93 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.92 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.91 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.91 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.91 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.9 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.9 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.89 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.89 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.89 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.88 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.87 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.87 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.87 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.87 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.86 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.85 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.85 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.85 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.84 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.84 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.83 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.82 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.81 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.77 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.73 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.72 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.71 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.68 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.67 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.66 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.66 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.65 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.64 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.63 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.63 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.61 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.61 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.6 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.6 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.58 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.57 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.56 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.56 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.54 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.51 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.5 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.5 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.48 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.43 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.42 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.41 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.41 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.4 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.28 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.22 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.08 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.9 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.8 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.67 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.66 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.56 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.38 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.35 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.2 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.08 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.88 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.39 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.32 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.08 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.69 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.66 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 95.48 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.42 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 94.68 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 90.26 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 89.59 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 87.71 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 87.14 | |
| 2w3j_A | 145 | Carbohydrate binding module; sugar-binding protein | 86.96 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 86.62 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 86.34 | |
| 2vzp_A | 127 | Aocbm35, EXO-beta-D-glucosaminidase; family 35, CS | 83.64 | |
| 2w47_A | 144 | Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1. | 82.1 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 81.93 | |
| 2wz8_A | 156 | Cellulosome protein dockerin type I; sugar binding | 81.1 | |
| 2w3j_A | 145 | Carbohydrate binding module; sugar-binding protein | 80.16 |
| >2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=3.1e-27 Score=217.64 Aligned_cols=154 Identities=19% Similarity=0.214 Sum_probs=113.8
Q ss_pred EEEeeecCCCCCCCCcCCCCCCCCCCCCcccCCCCCCCCCccccccccceecCCCCCCCChHHHHHHhhccCCCCCCeEE
Q 009603 193 RTATRLSCGNGKPKFDVDYSGDHWGGDRFWNPILSFGQNADQRRSTESSIKQASKAPNFYPEALYQTALVSTDSQPDLQY 272 (531)
Q Consensus 193 ~~~~Rin~G~~~~~~~~~~~~d~~~~DR~W~~~~~~~~~~~~~~~t~~~i~~~~~~~~~~P~~Vy~TAr~~~~~~~~l~~ 272 (531)
+++|||||||+.. .| .. +|.|.+|..+...+... .....+.. ...+.+|..||||||.+.. +++|
T Consensus 5 ~~~~~INcGg~~~---~d----~~--gr~w~~D~~~~~~g~~~-~~~~~~~~--~~~~~~~~~lY~TaR~~~~---~~tY 69 (174)
T 2jwp_A 5 KVIWAVNAGGESH---VD----VH--GIHYRKDPLEGRVGRAS-DYGMKLPI--LRSNPEDQVLYQTERYNED---SFGY 69 (174)
T ss_dssp HEEEEEEETSSSE---EE----TT--TEEECSSCSSTTCCCCC-CCCTTSCC--SSSCHHHHHTTTCCCCCCS---CEEE
T ss_pred cEEEEEECCCCCc---cC----CC--CCEEcCCcCcccCCccc-ccccceEe--cccCCCCchhhhhhccCCC---CeEE
Confidence 5789999999753 22 22 68888776432111100 00011111 1123468899999999765 4999
Q ss_pred EEecCCCCcEEEEEEeeeccCCCCCCceEEEEEEECCeeeccCCceeeecCCceeeEEEEEEee-------------ecC
Q 009603 273 TMDVDPNRNYSIWLHFAEIDNTITGVGQRVFDILINGDIAFQGVDVVKMSGDRYTALVLNTTVA-------------VNG 339 (531)
Q Consensus 273 ~~~v~~~~~y~v~LhFaei~~~~~~~~~R~F~V~ing~~~~~~~di~~~~~~~~~~~~~~~~v~-------------~~~ 339 (531)
.|+++++|+|+|||||||+.. .+.++|+|||+|||++++++||+.+++|+ ..++++++.+. +.+
T Consensus 70 ~f~v~~~G~Y~VrLhF~ei~~--~~~~~rvFdV~ing~~~l~~fdi~~~ag~-~~~~~~~~~~~v~~~~l~i~~~~~~~~ 146 (174)
T 2jwp_A 70 DIPIKEEGEYVLVLKFAEVYF--AQSQQKVFDVRVNGHTVVKDLDIFDRVGH-STAHDEIIPISIKKGKLSVQGEVSTFT 146 (174)
T ss_dssp EEECCSCEEEEEEEEEECCSC--CCSSSSCEEEEETTEEEEEEECHHHHHSS-SSCEEEEEEEEEETTEEEETTEEEECC
T ss_pred EEEeCCCeEEEEEEEEecccc--CCCCCeEeEEEECCEEeecCcCHHHhhCC-CeeEEEEEEEEEecCceeeeeeecccC
Confidence 999998899999999999975 45889999999999999999999988876 46777777665 356
Q ss_pred ceEEEEEccCCCchhhhhhHhhhhh
Q 009603 340 RTLTVTLHPKGGSHAIINAIEVFEI 364 (531)
Q Consensus 340 ~~l~i~~~p~~~~~p~lnalei~~~ 364 (531)
++|+|+|.|.....|+||||||++.
T Consensus 147 g~L~I~f~p~~~~~a~inaIEI~~~ 171 (174)
T 2jwp_A 147 GKLSVEFVKGYYDNPKVCALFIMKG 171 (174)
T ss_dssp SEEEEEEECSSSCSSSEEEEEEESS
T ss_pred CeEEEEEeccCCCCcEEEEEEEEeC
Confidence 7899999987666799999999864
|
| >2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2vzp_A Aocbm35, EXO-beta-D-glucosaminidase; family 35, CSXA, glucuronic acid, hydrolase; 1.05A {Amycolatopsis orientalis} PDB: 2vzq_A* 2vzr_A* | Back alignment and structure |
|---|
| >2w47_A Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1.40A {Clostridium thermocellum} PDB: 2w1w_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2wz8_A Cellulosome protein dockerin type I; sugar binding protein; 1.50A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 531 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 8e-14 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 7e-13 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 5e-09 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-08 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-07 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 8e-10 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-06 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-06 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-09 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-08 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-08 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-08 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-07 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 3e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 4e-06 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 4e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 1e-04 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 3e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 3e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-04 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 6e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.004 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 70.8 bits (172), Expect = 8e-14
Identities = 25/125 (20%), Positives = 42/125 (33%), Gaps = 7/125 (5%)
Query: 379 LQVLKNS-LDLPHRFGWNGDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRGFLP 437
L LK + + G + S+ + L L + P
Sbjct: 265 LTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP 324
Query: 438 NGISKLRHLQSINLSGNSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRL 497
+S L LQ + + N + SSL + ++ L +N + P L LT + +L
Sbjct: 325 --VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQL 378
Query: 498 NLNGN 502
LN
Sbjct: 379 GLNDQ 383
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.78 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.37 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.15 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.14 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.01 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.98 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.97 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.97 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.92 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.87 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.83 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.82 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.8 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.79 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.7 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.66 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.36 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.36 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.35 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.34 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.31 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.31 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.29 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.29 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.26 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.1 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.01 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.92 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.78 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.71 | |
| d2o14a1 | 146 | Hypothetical protein YxiM {Bacillus subtilis [TaxI | 97.64 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.52 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.46 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.4 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.33 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.25 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.02 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.99 | |
| d2o14a1 | 146 | Hypothetical protein YxiM {Bacillus subtilis [TaxI | 96.95 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.91 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.95 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.99 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.34 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 87.85 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.78 E-value=1.5e-19 Score=179.55 Aligned_cols=149 Identities=26% Similarity=0.505 Sum_probs=120.2
Q ss_pred CchHHHHHHHHHHhhcCCCCC-CCCC--CCCCCCCCCCCCccccccCCCCcceEEEEEEccCCCCcc--cCcccccCCCC
Q 009603 371 TLPEEVRALQVLKNSLDLPHR-FGWN--GDPCVPQQHPWSGADCQFDRTSHKWVIDGLGLDNQGLRG--FLPNGISKLRH 445 (531)
Q Consensus 371 ~~~~~~~aL~~~k~~~~~~~~-~~W~--~~~C~~~~~~w~gv~C~~~~~~~~~~l~~L~L~~n~l~g--~~p~~l~~L~~ 445 (531)
|.++|++||++||+.+.++.. .+|. +|+|. +.|.||.|+... ...+|+.|+|+++++.| .+|+.+++|++
T Consensus 3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~---~~w~gv~C~~~~--~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~ 77 (313)
T d1ogqa_ 3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN---RTWLGVLCDTDT--QTYRVNNLDLSGLNLPKPYPIPSSLANLPY 77 (313)
T ss_dssp SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT---TCSTTEEECCSS--SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC---CcCCCeEEeCCC--CcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence 678999999999999987643 4785 46663 469999997533 23479999999999998 58899999999
Q ss_pred CCEEEccC-CccCccCCccccCCCCCCEEecCCCcCCCCCcccccCCCCCCEEeccCCCCCCCCChhhhhhccccceeee
Q 009603 446 LQSINLSG-NSIRGAIPSSLGTIASLEVLDLSYNFFNGSIPESLGQLTALRRLNLNGNTLSGRVPAALGGRLLHRASFKY 524 (531)
Q Consensus 446 L~~L~Ls~-N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~L~~L~L~~N~l~g~iP~~~~~~~~~l~~l~l 524 (531)
|++|+|++ |+++|.+|.+|++|++|++|+|++|++.+..|..+..+.+|+.++++.|.+.+.+|..+..+ .++..+++
T Consensus 78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l-~~L~~l~l 156 (313)
T d1ogqa_ 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSL-PNLVGITF 156 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC-TTCCEEEC
T ss_pred ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccC-cccceeec
Confidence 99999986 89999999999999999999999999988777777777777777777777777777666543 34555555
Q ss_pred c
Q 009603 525 V 525 (531)
Q Consensus 525 ~ 525 (531)
.
T Consensus 157 ~ 157 (313)
T d1ogqa_ 157 D 157 (313)
T ss_dssp C
T ss_pred c
Confidence 4
|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|