Citrus Sinensis ID: 009692

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
MSFGGFLENNISTSSGGGGARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEHESRSGSDNMDGASGDDLDAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEHHHHHHccccccccccccccEEEEEcEEEEEEEHHHHHHHHccHHHHHHcccccccccEEEEEEcccccccccccEEHHHHHHHcccccccccEEEEEEEEEEEccccEEEEEEEcccccccccccccccEEEcccccEEEEccccccEEEcc
ccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccEEEEcHHHHHHHccccccccccccEEEEccccEEEEEcHHHHHHHHccHHHHHHHcHHHHHHHcHHHHHccccccccccHEHEEHEEEEccccccccHHEEEEEEEEccccccEEEEEEEccccccccccccccccccccccEEEEEcccccEEEEEc
msfggflennistssggggarIVADISytnndnnnnnnmpttttlahprllsstpqplsksmfnspglslalqqpnidnqgggdlqlQRMGESFegiigrrsredllehesrsgsdnmdgasgddldaadnpprkkryhrhtpQQIQELESLfkecphpdekQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRdamrnpictncggpaiigdisLEEQHLRIENARLKDELDRVCALAGkflgrpvssmgpppmpnsslelgvgtingfgglsstvtttlpadfgtgisnalpvvmppnrsgpgvtgldrsIERSMFLELALAAMDELVKMaqtdeplwirsfegsgrqvlnheeylrtftpciglkpngfvteaSRETGMVIINSLALVEtlmdpnrwaemfpcmiartattdvissgmggtrnGALQLMHAELQVlsplvpvrevNFLRFCKQHAEGVWAVVDVSIDTiretsgapafvncrrlpsgcvvqdmpngyskviyy
MSFGGFLEnnistssggggARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEhesrsgsdnmdgasgddlDAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLEtrqvkfwfqnrrtqmktqlerhensllrqendkLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTftpciglkpnGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETsgapafvncrrlpsgcvvqdmpngyskviyy
MSFGGFLENNISTSSGGGGARIVADISYtnndnnnnnnmpttttLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEHESRSGSDNMdgasgddldaadNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRpvssmgpppmpnssLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY
************************************************************************************************************************************************************************KRLCLETRQVKFWFQN**********************************MRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLG*****************LGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVM**********GLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIY*
**********************************************************************************************************************************************PQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQL*****************************************************************************************************************************************************LALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTP*********VTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIR****AP**VNCRRLPSGCVVQDMPNGYSKVIYY
MSFGGFLENNISTSSGGGGARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEHESRSGSDNMDGASGDDLDAADNPP*********PQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY
*******************ARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPN*************************************************************YHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFGGFLENNISTSSGGGGARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSKSMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEHESRSGSDNMDGASGDDLDAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMRNPICTNCGGPAIIGDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFGGLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query528 2.2.26 [Sep-21-2011]
Q0WV12 802 Homeobox-leucine zipper p yes no 0.939 0.618 0.634 0.0
Q9M2E8 808 Homeobox-leucine zipper p no no 0.920 0.601 0.593 1e-164
Q6EPF0 804 Homeobox-leucine zipper p yes no 0.880 0.578 0.587 1e-151
Q7Y0V9 813 Homeobox-leucine zipper p no no 0.871 0.565 0.573 1e-147
Q7Y0V7 872 Homeobox-leucine zipper p no no 0.958 0.580 0.550 1e-143
Q93V99 743 Homeobox-leucine zipper p no no 0.763 0.542 0.503 1e-117
Q8RWU4 762 Homeobox-leucine zipper p no no 0.768 0.532 0.495 1e-115
A2YR02 749 Homeobox-leucine zipper p N/A no 0.738 0.520 0.5 1e-114
Q0J9X2 784 Homeobox-leucine zipper p no no 0.784 0.528 0.484 1e-113
A3BPF2 749 Homeobox-leucine zipper p no no 0.738 0.520 0.497 1e-113
>sp|Q0WV12|ANL2_ARATH Homeobox-leucine zipper protein ANTHOCYANINLESS 2 OS=Arabidopsis thaliana GN=ANL2 PE=2 SV=1 Back     alignment and function desciption
 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/534 (63%), Positives = 393/534 (73%), Gaps = 38/534 (7%)

Query: 1   MSFGGFLENNISTSSGGG--GARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPL 58
           M+FG   +N    + GGG  GAR+++ +SY N+     N +P           S    PL
Sbjct: 1   MNFGSLFDN----TPGGGSTGARLLSGLSYGNH-TAATNVLPGGAMAQAAAAASLFSPPL 55

Query: 59  SKSMFNSPGLSLALQQPNI-DNQGGGDLQLQRMG----ESFEGIIGRRSREDLLEHESRS 113
           +KS++ S GLSLAL+QP    N+G   ++         ++F+G + RRSRE+  EHESRS
Sbjct: 56  TKSVYASSGLSLALEQPERGTNRGEASMRNNNNVGGGGDTFDGSVNRRSREE--EHESRS 113

Query: 114 GSDNMDGASGDDLDAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCL 173
           GSDN++G SG+D DAAD PPRKKRYHRHTPQQIQELES+FKECPHPDEKQRLELSKRLCL
Sbjct: 114 GSDNVEGISGEDQDAADKPPRKKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCL 173

Query: 174 ETRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAII 233
           ETRQVKFWFQNRRTQMKTQLERHEN+LLRQENDKLRAENMSIR+AMRNPICTNCGGPA++
Sbjct: 174 ETRQVKFWFQNRRTQMKTQLERHENALLRQENDKLRAENMSIREAMRNPICTNCGGPAML 233

Query: 234 GDISLEEQHLRIENARLKDELDRVCALAGKFLGRPVSSMGPPPMPNSSLELGVGTINGFG 293
           GD+SLEE HLRIENARLKDELDRVC L GKFLG   +        NSSLEL VGT N  G
Sbjct: 234 GDVSLEEHHLRIENARLKDELDRVCNLTGKFLGHHHNHHY-----NSSLELAVGTNNNGG 288

Query: 294 GLSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVK 353
             +       P DF  G    LP   P  +    + G+D   ++S+ LELAL AMDELVK
Sbjct: 289 HFA------FPPDF-GGGGGCLP---PQQQQSTVINGID---QKSVLLELALTAMDELVK 335

Query: 354 MAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALV 413
           +AQ++EPLW++S +G  R  LN +EY+RTF+     KP G  TEASR +GMVIINSLALV
Sbjct: 336 LAQSEEPLWVKSLDGE-RDELNQDEYMRTFS---STKPTGLATEASRTSGMVIINSLALV 391

Query: 414 ETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFL 473
           ETLMD NRW EMFPC +AR  TTDVIS GM GT NGALQLM+AELQVLSPLVPVR VNFL
Sbjct: 392 ETLMDSNRWTEMFPCNVARATTTDVISGGMAGTINGALQLMNAELQVLSPLVPVRNVNFL 451

Query: 474 RFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQDMPNGYSKVIY 527
           RFCKQHAEGVWAVVDVSID +RE SG    +  RRLPSGCVVQD+ NGYSKV +
Sbjct: 452 RFCKQHAEGVWAVVDVSIDPVRENSGGAPVI--RRLPSGCVVQDVSNGYSKVTW 503
Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M2E8|HDG1_ARATH Homeobox-leucine zipper protein HDG1 OS=Arabidopsis thaliana GN=HDG1 PE=2 SV=1 Back     alignment and function description
>sp|Q6EPF0|ROC5_ORYSJ Homeobox-leucine zipper protein ROC5 OS=Oryza sativa subsp. japonica GN=ROC5 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y0V9|ROC4_ORYSJ Homeobox-leucine zipper protein ROC4 OS=Oryza sativa subsp. japonica GN=ROC4 PE=2 SV=2 Back     alignment and function description
>sp|Q7Y0V7|ROC6_ORYSJ Homeobox-leucine zipper protein ROC6 OS=Oryza sativa subsp. japonica GN=ROC6 PE=2 SV=2 Back     alignment and function description
>sp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 OS=Arabidopsis thaliana GN=PDF2 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWU4|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L1 OS=Arabidopsis thaliana GN=ATML1 PE=2 SV=1 Back     alignment and function description
>sp|A2YR02|ROC7_ORYSI Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. indica GN=ROC7 PE=3 SV=1 Back     alignment and function description
>sp|Q0J9X2|ROC2_ORYSJ Homeobox-leucine zipper protein ROC2 OS=Oryza sativa subsp. japonica GN=ROC2 PE=2 SV=1 Back     alignment and function description
>sp|A3BPF2|ROC7_ORYSJ Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. japonica GN=ROC7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query528
224130112 823 predicted protein [Populus trichocarpa] 0.956 0.613 0.821 0.0
255541474 825 homeobox protein, putative [Ricinus comm 0.967 0.619 0.828 0.0
359489358 811 PREDICTED: homeobox-leucine zipper prote 0.946 0.616 0.812 0.0
302398853 824 HD domain class transcription factor [Ma 0.954 0.611 0.780 0.0
350539483 821 cutin deficient 2 [Solanum lycopersicum] 0.958 0.616 0.775 0.0
147811086 784 hypothetical protein VITISV_023503 [Viti 0.892 0.600 0.830 0.0
356532068 820 PREDICTED: homeobox-leucine zipper prote 0.960 0.618 0.770 0.0
224063979 790 predicted protein [Populus trichocarpa] 0.901 0.602 0.809 0.0
356568318 822 PREDICTED: homeobox-leucine zipper prote 0.967 0.621 0.768 0.0
296089063 771 unnamed protein product [Vitis vinifera] 0.875 0.599 0.762 0.0
>gi|224130112|ref|XP_002320755.1| predicted protein [Populus trichocarpa] gi|222861528|gb|EEE99070.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/533 (82%), Positives = 471/533 (88%), Gaps = 28/533 (5%)

Query: 1   MSFGGFLENNISTSSGGGGARIVADISYTNNDNNNNNNMPTTTTLAHPRLLSSTPQPLSK 60
           MSFGGFLEN   TS GGGGARIVADI Y      NNNNMPT   +  PRL+S +   ++K
Sbjct: 1   MSFGGFLEN---TSPGGGGARIVADIPY------NNNNMPTGA-IVQPRLVSPS---ITK 47

Query: 61  SMFNSPGLSLALQQPNIDNQGGGDLQLQRMGESFEGIIGRRSREDLLEHESRSGSDNMDG 120
           SMFNSPGLSLALQQPNID QG     + RM E+FE  +GRRSRE+  EHESRSGSDNMDG
Sbjct: 48  SMFNSPGLSLALQQPNIDGQG----DITRMSENFETSVGRRSREE--EHESRSGSDNMDG 101

Query: 121 ASGDDLDAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKF 180
           ASGDD DAADNPPRKKRYHRHTPQQIQELE+LFKECPHPDEKQRLELS+RLCLETRQVKF
Sbjct: 102 ASGDDQDAADNPPRKKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKF 161

Query: 181 WFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIGDISLEE 240
           WFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNP+C+NCGGPAIIGDISLEE
Sbjct: 162 WFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPMCSNCGGPAIIGDISLEE 221

Query: 241 QHLRIENARLKDELDRVCALAGKFLGRPVSSMGP---PPMPNSSLELGVGTINGFGGLSS 297
           QHLRIENARLKDELDRVCALAGKFLGRP+SS+     PPMPNSSLELGVG+ NGF GL S
Sbjct: 222 QHLRIENARLKDELDRVCALAGKFLGRPISSLASSLGPPMPNSSLELGVGS-NGFAGL-S 279

Query: 298 TVTTTLP--ADFGTGISNALPVVMPPNRSGPGVTGLDRSIERSMFLELALAAMDELVKMA 355
           TV TTLP   DF  GIS ALPV+     +  GVTG+ RS+ERSMFLELALAAMDELVKMA
Sbjct: 280 TVATTLPLGPDFVGGISGALPVLTQTRPATTGVTGIGRSLERSMFLELALAAMDELVKMA 339

Query: 356 QTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVET 415
           QTDEPLWIRSF+G GR++LNHEEYLRT TPCIG+KP+GFV+EASRETGMVIINSLALVET
Sbjct: 340 QTDEPLWIRSFDG-GREILNHEEYLRTITPCIGMKPSGFVSEASRETGMVIINSLALVET 398

Query: 416 LMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRF 475
           LMD NRWAEMFPC+IART+TTDVI++GMGGTRNG+LQLMHAELQVLSPLVPVREVNFLRF
Sbjct: 399 LMDSNRWAEMFPCVIARTSTTDVIANGMGGTRNGSLQLMHAELQVLSPLVPVREVNFLRF 458

Query: 476 CKQHAEGVWAVVDVSIDTIRETSGA-PAFVNCRRLPSGCVVQDMPNGYSKVIY 527
           CKQHAEGVWAVVDVS+DTIRETSGA P FVNCRRLPSGCVVQDMPNGYSKV +
Sbjct: 459 CKQHAEGVWAVVDVSVDTIRETSGASPTFVNCRRLPSGCVVQDMPNGYSKVTW 511

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541474|ref|XP_002511801.1| homeobox protein, putative [Ricinus communis] gi|223548981|gb|EEF50470.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359489358|ref|XP_002272264.2| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302398853|gb|ADL36721.1| HD domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|350539483|ref|NP_001234657.1| cutin deficient 2 [Solanum lycopersicum] gi|255529749|gb|ACU12849.1| cutin deficient 2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|147811086|emb|CAN61351.1| hypothetical protein VITISV_023503 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532068|ref|XP_003534596.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224063979|ref|XP_002301331.1| predicted protein [Populus trichocarpa] gi|222843057|gb|EEE80604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568318|ref|XP_003552359.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like [Glycine max] Back     alignment and taxonomy information
>gi|296089063|emb|CBI38766.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query528
TAIR|locus:2127008 802 ANL2 "ANTHOCYANINLESS 2" [Arab 0.590 0.389 0.563 2.2e-161
TAIR|locus:2098866 808 HDG1 "AT3G61150" [Arabidopsis 0.863 0.564 0.616 9.9e-142
TAIR|locus:2135368 743 PDF2 "AT4G04890" [Arabidopsis 0.363 0.258 0.522 3.3e-102
TAIR|locus:2119048 762 ATML1 "AT4G21750" [Arabidopsis 0.768 0.532 0.486 7.9e-101
TAIR|locus:2145116 682 HDG7 "AT5G52170" [Arabidopsis 0.342 0.265 0.547 5.5e-92
TAIR|locus:2206880 722 HDG11 "AT1G73360" [Arabidopsis 0.721 0.527 0.472 3.7e-87
TAIR|locus:2062540 725 HDG3 "AT2G32370" [Arabidopsis 0.367 0.267 0.462 4.1e-78
TAIR|locus:2030913 687 HDG12 "homeodomain GLABROUS 12 0.649 0.499 0.457 8.6e-72
TAIR|locus:2129396 709 HDG4 "AT4G17710" [Arabidopsis 0.359 0.267 0.424 1.2e-63
TAIR|locus:2131814 686 FWA "AT4G25530" [Arabidopsis t 0.382 0.294 0.390 1.1e-57
TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 877 (313.8 bits), Expect = 2.2e-161, Sum P(2) = 2.2e-161
 Identities = 191/339 (56%), Positives = 222/339 (65%)

Query:     1 MSFGGFLENNISTSSGGG-GARIVADISYXXXXXXXXXXXXXXXXLAHPRLLSSTPQPLS 59
             M+FG   +N   T  GG  GAR+++ +SY                 A       +P PL+
Sbjct:     1 MNFGSLFDN---TPGGGSTGARLLSGLSYGNHTAATNVLPGGAMAQAAAAASLFSP-PLT 56

Query:    60 KSMFNSPGLSLALQQPNID-NQGGGDLQLQRM----GESFEGIIGRRSREDLLEHESRSG 114
             KS++ S GLSLAL+QP    N+G   ++        G++F+G + RRSRE+  EHESRSG
Sbjct:    57 KSVYASSGLSLALEQPERGTNRGEASMRNNNNVGGGGDTFDGSVNRRSREE--EHESRSG 114

Query:   115 SDNMXXXXXXXXXXXXNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLE 174
             SDN+             PPRKKRYHRHTPQQIQELES+FKECPHPDEKQRLELSKRLCLE
Sbjct:   115 SDNVEGISGEDQDAADKPPRKKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLE 174

Query:   175 TRQVKFWFQNRRTQMKTQLERHENSLLRQENDKLRAENMSIRDAMRNPICTNCGGPAIIG 234
             TRQVKFWFQNRRTQMKTQLERHEN+LLRQENDKLRAENMSIR+AMRNPICTNCGGPA++G
Sbjct:   175 TRQVKFWFQNRRTQMKTQLERHENALLRQENDKLRAENMSIREAMRNPICTNCGGPAMLG 234

Query:   235 DISLEEQHLRIENARLKDELDRVCALAGKFLGRXXXXXXXXXXXXXXLELGVGTINGFGG 294
             D+SLEE HLRIENARLKDELDRVC L GKFLG               LEL VGT N  G 
Sbjct:   235 DVSLEEHHLRIENARLKDELDRVCNLTGKFLGHHHNHHYNSS-----LELAVGTNNNGGH 289

Query:   295 LSSTVTTTLPADFGTGISNALPVVMPPNRSGPGVTGLDR 333
              +       P DFG G    LP   P  +    + G+D+
Sbjct:   290 FA------FPPDFGGG-GGCLP---PQQQQSTVINGIDQ 318
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0048765 "root hair cell differentiation" evidence=IMP
GO:0006473 "protein acetylation" evidence=RCA
GO:0042335 "cuticle development" evidence=IMP
TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145116 HDG7 "AT5G52170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206880 HDG11 "AT1G73360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062540 HDG3 "AT2G32370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030913 HDG12 "homeodomain GLABROUS 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129396 HDG4 "AT4G17710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131814 FWA "AT4G25530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WV12ANL2_ARATHNo assigned EC number0.63480.93930.6184yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query528
cd08875229 cd08875, START_ArGLABRA2_like, C-terminal lipid-bi 1e-100
pfam01852205 pfam01852, START, START domain 2e-40
smart00234205 smart00234, START, in StAR and phosphatidylcholine 7e-25
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-23
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-18
smart0038957 smart00389, HOX, Homeodomain 9e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-08
>gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information 
 Score =  301 bits (774), Expect = e-100
 Identities = 111/189 (58%), Positives = 140/189 (74%), Gaps = 1/189 (0%)

Query: 337 RSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVT 396
           +S  LELA  AMDEL+K+AQ  EPLWI+S      ++LN +EY R F    G KP GF T
Sbjct: 1   KSGLLELAEEAMDELLKLAQGGEPLWIKSPGM-KPEILNPDEYERMFPRHGGSKPGGFTT 59

Query: 397 EASRETGMVIINSLALVETLMDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHA 456
           EASR  G+V++N++ LVE LMD N+W+E+FP ++++  T  VIS+G GG RNG LQLM+A
Sbjct: 60  EASRACGLVMMNAIKLVEILMDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYA 119

Query: 457 ELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPAFVNCRRLPSGCVVQ 516
           ELQV SPLVP RE  FLR+CKQ  +G+WAVVDVSID ++      +FV CRRLPSGC++Q
Sbjct: 120 ELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQTAPPPASFVRCRRLPSGCLIQ 179

Query: 517 DMPNGYSKV 525
           DMPNGYSKV
Sbjct: 180 DMPNGYSKV 188

This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. Length = 229
>gnl|CDD|216740 pfam01852, START, START domain Back     alignment and domain information
>gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 528
cd08875229 START_ArGLABRA2_like C-terminal lipid-binding STAR 100.0
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.68
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.67
KOG0488309 consensus Transcription factor BarH and related HO 99.63
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.62
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.6
KOG0494332 consensus Transcription factor CHX10 and related H 99.59
KOG0489261 consensus Transcription factor zerknullt and relat 99.59
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.58
KOG0843197 consensus Transcription factor EMX1 and related HO 99.58
PF01852206 START: START domain; InterPro: IPR002913 START (St 99.57
KOG0848317 consensus Transcription factor Caudal, contains HO 99.56
KOG0850245 consensus Transcription factor DLX and related pro 99.55
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.51
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.5
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.5
smart00234206 START in StAR and phosphatidylcholine transfer pro 99.42
KOG0493342 consensus Transcription factor Engrailed, contains 99.4
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.34
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.33
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.33
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.33
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.31
COG5576156 Homeodomain-containing transcription factor [Trans 99.31
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.26
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.23
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.2
KOG0847288 consensus Transcription factor, contains HOX domai 99.18
cd00177193 START Lipid-binding START domain of mammalian STAR 99.03
KOG0490235 consensus Transcription factor, contains HOX domai 99.03
KOG0849354 consensus Transcription factor PRD and related pro 98.76
cd08904204 START_STARD6-like Lipid-binding START domain of ma 98.72
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 98.66
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.57
cd08871222 START_STARD10-like Lipid-binding START domain of m 98.55
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 98.46
KOG0775304 consensus Transcription factor SIX and related HOX 98.41
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.34
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.24
cd08909205 START_STARD13-like C-terminal lipid-binding START 98.18
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.07
KOG0774334 consensus Transcription factor PBX and related HOX 98.01
cd08905209 START_STARD1-like Cholesterol-binding START domain 97.94
cd08902202 START_STARD4-like Lipid-binding START domain of ma 97.82
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.78
cd08906209 START_STARD3-like Cholesterol-binding START domain 97.77
KOG2252558 consensus CCAAT displacement protein and related h 97.74
KOG0490235 consensus Transcription factor, contains HOX domai 97.62
cd08908204 START_STARD12-like C-terminal lipid-binding START 97.6
cd08910207 START_STARD2-like Lipid-binding START domain of ma 97.51
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 97.39
cd08907205 START_STARD8-like C-terminal lipid-binding START d 97.25
cd08874205 START_STARD9-like C-terminal START domain of mamma 97.24
KOG1146 1406 consensus Homeobox protein [General function predi 96.94
cd08872235 START_STARD11-like Ceramide-binding START domain o 96.68
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 96.66
cd08870209 START_STARD2_7-like Lipid-binding START domain of 96.26
KOG0773342 consensus Transcription factor MEIS1 and related H 95.74
cd08911207 START_STARD7-like Lipid-binding START domain of ma 95.66
cd08873235 START_STARD14_15-like Lipid-binding START domain o 95.08
cd08913240 START_STARD14-like Lipid-binding START domain of m 94.58
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.21
PRK09413121 IS2 repressor TnpA; Reviewed 93.36
cd08914236 START_STARD15-like Lipid-binding START domain of m 91.67
KOG4196135 consensus bZIP transcription factor MafK [Transcri 90.55
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 87.69
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 85.5
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 84.96
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 84.59
PRK1542279 septal ring assembly protein ZapB; Provisional 84.4
cd08864208 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- 83.26
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 82.7
COG307479 Uncharacterized protein conserved in bacteria [Fun 80.63
>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information 
Probab=100.00  E-value=2.3e-78  Score=593.85  Aligned_cols=191  Identities=58%  Similarity=0.977  Sum_probs=183.2

Q ss_pred             hHHHHHHHHHHHHHHHHhhcCCCCCceeccCCCcccccChhhhhhhcCCCCCCCCCCCceeeeecceeEEechhHHHHHh
Q 009692          337 RSMFLELALAAMDELVKMAQTDEPLWIRSFEGSGRQVLNHEEYLRTFTPCIGLKPNGFVTEASRETGMVIINSLALVETL  416 (528)
Q Consensus       337 k~~~~elA~~Am~El~~~a~~~eplWi~~~~~g~~e~Ln~~eY~~~F~~~~g~~~~g~~~EASR~sgvV~m~~~~LVe~l  416 (528)
                      |++|+|||++||+||++|||+++|||+++.+++ +|+||+|||.++|++..+.++.||++|||||||+|+||+.+|||+|
T Consensus         1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~-~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~l   79 (229)
T cd08875           1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMK-PEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEIL   79 (229)
T ss_pred             ChHHHHHHHHHHHHHHHHhccCCCCceecCCCC-ccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHH
Confidence            578999999999999999999999999998887 6999999999999999999999999999999999999999999999


Q ss_pred             cChhhHhhhcccccccceEeEEeeCCCCCCCCcceehhhhhhhcccccccCceeeEEeeeeeecCCeEEEEEeeccCccC
Q 009692          417 MDPNRWAEMFPCMIARTATTDVISSGMGGTRNGALQLMHAELQVLSPLVPVREVNFLRFCKQHAEGVWAVVDVSIDTIRE  496 (528)
Q Consensus       417 mD~~~W~~~Fp~iVs~a~T~~Vis~G~~g~~~GalqlM~aElqvlSPLVP~Re~~FLRyckq~~~G~WaVvDVSld~~~~  496 (528)
                      ||+++|.+|||+||++|+|++||++|++|+|||+|||||+|||+||||||+|||||||||||++||+|||||||||..+.
T Consensus        80 mD~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~  159 (229)
T cd08875          80 MDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQT  159 (229)
T ss_pred             hChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeeccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998853


Q ss_pred             CCCCCCcccccccCCcceeeecCCCccEEEEC
Q 009692          497 TSGAPAFVNCRRLPSGCVVQDMPNGYSKVIYY  528 (528)
Q Consensus       497 ~~~~~~~~~crr~PSGclIqdm~nGysKVtwv  528 (528)
                      .+..+.++||||+|||||||||+|||||||||
T Consensus       160 ~p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwV  191 (229)
T cd08875         160 APPPASFVRCRRLPSGCLIQDMPNGYSKVTWV  191 (229)
T ss_pred             CCCCCCccEEEEecCcEEEEECCCCceEEEEE
Confidence            33344589999999999999999999999997

This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells.
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query528
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 7e-06
1hom_A68 Determination Of The Three-Dimensional Structure Of 9e-06
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-05
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 4e-05
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 5e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 7e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 7e-05
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-04
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-04
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 1e-04
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 1e-04
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 2e-04
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 2e-04
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-04
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 2e-04
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 3e-04
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 3e-04
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-04
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 4e-04
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 4e-04
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 7e-04
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 8e-04
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
Query: 132 PPRKKRYHR--HTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQM 189
           P RK+R +R   T  Q++ELE  F    +PD   R EL+ ++ L   +++ WFQNRR + 
Sbjct: 2   PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKW 61
Query: 190 KTQ 192
           + Q
Sbjct: 62  RKQ 64
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query528
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 8e-21
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-20
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-19
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 1e-17
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-17
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-17
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-17
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-16
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-16
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 5e-16
2xsd_C164 POU domain, class 3, transcription factor 1; trans 8e-16
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-15
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 9e-15
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-14
3a01_A93 Homeodomain-containing protein; homeodomain, prote 5e-14
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-13
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-13
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-13
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 3e-13
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-12
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-12
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-12
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-12
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-12
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-12
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-12
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-12
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 6e-12
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 6e-12
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 7e-12
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 8e-12
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-11
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-11
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-11
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-11
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-11
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-11
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-11
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-11
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-11
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 6e-11
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-10
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-10
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-10
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-10
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 6e-10
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 6e-10
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-10
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1uhs_A72 HOP, homeodomain only protein; structural genomics 7e-09
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-08
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 7e-08
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-07
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 4e-06
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 1e-05
2e19_A64 Transcription factor 8; homeobox domain, structura 5e-04
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 85.3 bits (211), Expect = 8e-21
 Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 127 DAADNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRR 186
            +  + P   +Y    P+Q++ LES F + P P +++   L     +  R++  WF  RR
Sbjct: 2   SSGSSGP--TKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERR 59

Query: 187 TQMKTQLERHENS 199
            ++  +  +    
Sbjct: 60  KKVNAEETKKSGP 72
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query528
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.73
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.73
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.72
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.71
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.7
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.7
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.7
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.69
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.68
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.68
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.68
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.68
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.68
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.68
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 99.68
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.68
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.68
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.68
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.67
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.67
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.67
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.67
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.66
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.66
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.66
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.65
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.65
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.65
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.65
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.65
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.65
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.65
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.64
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.64
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.64
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.63
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.63
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.63
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.63
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.63
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.63
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.62
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.62
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.62
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.62
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.61
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.6
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.6
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.59
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.59
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.59
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.59
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.58
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.58
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.58
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.57
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.57
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.57
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.57
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.57
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.56
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.55
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.54
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.54
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.53
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.52
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.52
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.51
2e19_A64 Transcription factor 8; homeobox domain, structura 99.5
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.49
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.47
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.43
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.32
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.23
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.17
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.12
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.06
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 98.93
2pso_A237 STAR-related lipid transfer protein 13; alpha and 98.91
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 98.75
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.54
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.5
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 98.45
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 98.44
3qsz_A189 STAR-related lipid transfer protein; structural ge 97.95
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 97.71
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 91.85
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 87.9
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 84.66
2j5u_A255 MREC protein; bacterial cell shape determining pro 80.42
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
Probab=99.73  E-value=9.8e-19  Score=149.22  Aligned_cols=77  Identities=32%  Similarity=0.428  Sum_probs=62.8

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHhhcCCCCCHHHHHHHHhhhCcccceEEEeecchhhHHHHHHHHHhhHHHHHhhH
Q 009692          130 DNPPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENSLLRQEND  206 (528)
Q Consensus       130 ~~~k~kr~R~rfT~eQl~~LE~~F~~~~~Ps~~~r~eLA~~LgLs~rQVkvWFQNRRak~Kr~~~r~e~~~l~~en~  206 (528)
                      ..+++||+|++||.+|+.+||..|..++||+..+|.+||.++||+++||++||||||+|+|++..+.+...+++.+.
T Consensus        13 ~~~~~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kr~~~~~~~~~~~~~~~   89 (93)
T 3a01_A           13 TPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANR   89 (93)
T ss_dssp             CCCCCCCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHTCC----------
T ss_pred             CCCCCCCCCcCCCHHHHHHHHHHHHcCCCcCHHHHHHHHHHhCCChhhcccccHhhhhhhhhhhHHHHHHHHHHHHH
Confidence            34567888999999999999999999999999999999999999999999999999999999887776666555443
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 528
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 6e-19
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-18
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-18
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 9e-18
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 9e-17
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-16
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-16
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-16
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 5e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 5e-16
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-16
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 9e-16
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-15
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-15
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 8e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-14
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-14
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 6e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 9e-14
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-13
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 6e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 9e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-10
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 79.1 bits (195), Expect = 6e-19
 Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 132 PPRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKT 191
             RKKR   +T  Q  ELE  F    +    +R E+++ L L  RQVK WFQNRR +MK 
Sbjct: 12  STRKKR-CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 70

Query: 192 Q 192
            
Sbjct: 71  I 71
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query528
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.74
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.74
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.74
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.73
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.73
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.73
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.72
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.72
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.7
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.7
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.7
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.7
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.69
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.68
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.68
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.65
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.65
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.64
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.63
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.63
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.63
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.61
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.6
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.55
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.55
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.53
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.5
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.47
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.46
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.45
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.36
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.68
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 98.33
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 97.99
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 97.91
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 89.06
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.74  E-value=4.7e-19  Score=144.54  Aligned_cols=64  Identities=36%  Similarity=0.440  Sum_probs=59.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHhhcCCCCCHHHHHHHHhhhCcccceEEEeecchhhHHHHHHHHH
Q 009692          133 PRKKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMKTQLERH  196 (528)
Q Consensus       133 k~kr~R~rfT~eQl~~LE~~F~~~~~Ps~~~r~eLA~~LgLs~rQVkvWFQNRRak~Kr~~~r~  196 (528)
                      .+||+|++||++|+.+||..|+.++||+..+|++||..|||+++||++||||||+|+|+..+..
T Consensus        12 ~~rr~Rt~ft~~Ql~~Le~~F~~~~yPs~~~r~~LA~~l~l~~~qV~iWFqNrR~k~kr~~~~~   75 (77)
T d1pufa_          12 STRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDR   75 (77)
T ss_dssp             TTSCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCCHHHhhhhhhhhHHHHHHHHHHh
Confidence            4567789999999999999999999999999999999999999999999999999999876543
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure