Citrus Sinensis ID: 009719


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS
ccccccccccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccccEEcccccccccccccccccccEEEcccccccccccccccccccccccEEEEEEcccccEEEHHccccccccccccccEEEcccccccccccccEEEEEEccccccccEEEEcccccccccHHHHHHHHHHHHHHHcHHHHEEEccEEEEEccccccHHccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccccccccHHHHccccccEEEEEcccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEcccccccc
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHccccccccccccHHHHcccEcccccccEEEEcccccccHccccccccHHHHHccccHHcHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccEEEEEHcccccccccccEcEHHcccccccccccccEEEEEEHHEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHcccccccccccccccccccEEcccHHcccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcHHccHHHHHHHccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEEEEccc
mghlnlpaskrnARQWKLLDIVSATFFGLVLLFFLLVFtplgdslaASGRQAllmstsdprQRQRLVALIEAghhvkpiescpadsvdhmpcedprrnsqlsremnfyrerhcplpdqtplclippprgykipvpwpeslSKVASFGgsmlseniltlsfaprdsHKAQIQFALERGIPAFVAMLgtrrlpfpafsfdivhcsrclipftaynATYLIEVDrllrpggylvisgppvqwpkqdkEWADLQAVARALCYELIAVDgntviwkkpvgesclsnqnefglelcdesddpnyAWYFKLKkcvsgtssvkgeyavgtipkwpqrltkapsralvmkngydvfeadSRRWRRRVAYYKNTlnvklgtpairNIMDMNAFFGGFaaaltsdpvwvmnvvparksstlsviydrgligvyhdwcepfstyprtydLIHVSGIEsliknpgsnknscSLVDLMVEMDrmlrpegtvvvrdspevIDKVSRIANTVRWTAavhdkepgsngrEKILVATKSLWKLPS
mghlnlpaskrnaRQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDPRQRQRLVALIEAGhhvkpiescpadsvdhmpCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCvsgtssvkgeyavgtipkwpqrltkapsralvmkngydvfeadsrrwRRRVAYYkntlnvklgtpAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIEsliknpgsnknSCSLVDLMVEMDRMLRPegtvvvrdspevidkvsriantvrwtaavhdkepgsngrekiLVATKSLWKLPS
MGHLNLPASKRNARQWKLLDIVSATffglvllffllvfTPLGDSLAASGRQALLMSTSDPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS
*************RQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAA******************LVALIEAGHHV******************************FYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVH***********ILVA*********
****************KLLDIVSATFFGLVLLFFLLVFTPLG************************************IESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPV*******************DDPNYAWYFKLKKCVS*************************************FEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHD*****NGREKILVATKSLWKL**
MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS
*********KRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGD************************A**EAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVK****VGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query527 2.2.26 [Sep-21-2011]
Q93W95600 Probable methyltransferas yes no 1.0 0.878 0.653 0.0
Q9ZPH9633 Probable methyltransferas no no 0.713 0.593 0.460 1e-102
Q9C884639 Probable methyltransferas no no 0.717 0.591 0.450 2e-99
B9DFI7616 Probable methyltransferas no no 0.707 0.605 0.468 6e-98
Q94EJ6621 Probable methyltransferas no no 0.703 0.597 0.465 7e-97
O80844631 Probable methyltransferas no no 0.717 0.599 0.438 2e-96
Q9C6S7603 Probable methyltransferas no no 0.707 0.618 0.434 2e-96
Q94II3600 Probable methyltransferas no no 0.707 0.621 0.444 3e-96
Q9SZX8633 Probable methyltransferas no no 0.707 0.589 0.447 3e-96
Q9ZW75611 Probable methyltransferas no no 0.705 0.608 0.440 1e-87
>sp|Q93W95|PMTD_ARATH Probable methyltransferase PMT13 OS=Arabidopsis thaliana GN=At4g00740 PE=1 SV=1 Back     alignment and function desciption
 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/597 (65%), Positives = 457/597 (76%), Gaps = 70/597 (11%)

Query: 1   MGHLNLPASKR-NARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMST-S 58
           MGH+NLPASKR N RQW+LLDIV+A FFG+VLLFF+L+FTPLGDS+AASGRQ LL+ST S
Sbjct: 1   MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS 60

Query: 59  DPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQ 118
           DPRQRQRLV L+EAG H++PIE CPA++V HMPCEDPRRNSQLSREMNFYRERHCPLP++
Sbjct: 61  DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE 120

Query: 119 TPLCLIPPPRGYKIPVPWPESLSKV--------------------------ASF--GGSM 150
           TPLCLIPPP GYKIPVPWPESL K+                           +F  GG+M
Sbjct: 121 TPLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMKREGEYFTFPGGGTM 180

Query: 151 L----SENILTLS-FAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRC 205
                 + I  L+ + P +    +    +  G+ +F   L ++ +   +F+    H S+ 
Sbjct: 181 FPGGAGQYIEKLAQYIPLNGGTLRTALDMGCGVASFGGTLLSQGILALSFAPRDSHKSQI 240

Query: 206 L------------------IPFTAYN-----------------ATYLIEVDRLLRPGGYL 230
                              +PF AY+                 ATY IEVDRLLRPGGYL
Sbjct: 241 QFALERGVPAFVAMLGTRRLPFPAYSFDLMHCSRCLIPFTAYNATYFIEVDRLLRPGGYL 300

Query: 231 VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELC 290
           VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVG+SCL +QNEFGLELC
Sbjct: 301 VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGDSCLPSQNEFGLELC 360

Query: 291 DESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEAD 350
           DES  P+ AWYFKLK+CV+  SSVKGE+A+GTI KWP+RLTK PSRA+VMKNG DVFEAD
Sbjct: 361 DESVPPSDAWYFKLKRCVTRPSSVKGEHALGTISKWPERLTKVPSRAIVMKNGLDVFEAD 420

Query: 351 SRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTL 410
           +RRW RRVAYY+++LN+KL +P +RN+MDMNAFFGGFAA L SDPVWVMNV+PARK  TL
Sbjct: 421 ARRWARRVAYYRDSLNLKLKSPTVRNVMDMNAFFGGFAATLASDPVWVMNVIPARKPLTL 480

Query: 411 SVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRM 470
            VIYDRGLIGVYHDWCEPFSTYPRTYD IHVSGIESLIK   S+K+ CSLVDLMVEMDR+
Sbjct: 481 DVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESLIKRQDSSKSRCSLVDLMVEMDRI 540

Query: 471 LRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS 527
           LRPEG VV+RDSPEV+DKV+R+A+ VRW++++H+KEP S+GREKIL+ATKSLWKLPS
Sbjct: 541 LRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEPESHGREKILIATKSLWKLPS 597





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9ZPH9|PMTF_ARATH Probable methyltransferase PMT15 OS=Arabidopsis thaliana GN=At4g00750 PE=1 SV=1 Back     alignment and function description
>sp|Q9C884|PMTI_ARATH Probable methyltransferase PMT18 OS=Arabidopsis thaliana GN=At1g33170 PE=2 SV=1 Back     alignment and function description
>sp|B9DFI7|PMT2_ARATH Probable methyltransferase PMT2 OS=Arabidopsis thaliana GN=At1g26850 PE=1 SV=2 Back     alignment and function description
>sp|Q94EJ6|PMTE_ARATH Probable methyltransferase PMT14 OS=Arabidopsis thaliana GN=At4g18030 PE=1 SV=1 Back     alignment and function description
>sp|O80844|PMTG_ARATH Probable methyltransferase PMT16 OS=Arabidopsis thaliana GN=At2g45750 PE=3 SV=1 Back     alignment and function description
>sp|Q9C6S7|PMTK_ARATH Probable methyltransferase PMT20 OS=Arabidopsis thaliana GN=At1g31850 PE=1 SV=1 Back     alignment and function description
>sp|Q94II3|PMTL_ARATH Probable methyltransferase PMT21 OS=Arabidopsis thaliana GN=ERD3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZX8|PMTH_ARATH Probable methyltransferase PMT17 OS=Arabidopsis thaliana GN=At4g10440 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZW75|PMTJ_ARATH Probable methyltransferase PMT19 OS=Arabidopsis thaliana GN=At2g43200 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
18411430600 putative methyltransferase PMT13 [Arabid 1.0 0.878 0.653 0.0
297810097602 hypothetical protein ARALYDRAFT_490495 [ 1.0 0.875 0.656 0.0
225453730597 PREDICTED: probable methyltransferase PM 1.0 0.882 0.639 0.0
449432183593 PREDICTED: probable methyltransferase PM 0.726 0.645 0.830 0.0
224130116594 predicted protein [Populus trichocarpa] 0.726 0.644 0.838 0.0
255541472507 conserved hypothetical protein [Ricinus 0.726 0.755 0.828 0.0
356520463594 PREDICTED: probable methyltransferase PM 0.719 0.638 0.793 0.0
356505029597 PREDICTED: probable methyltransferase PM 0.713 0.629 0.787 0.0
356568320596 PREDICTED: probable methyltransferase PM 0.724 0.640 0.817 0.0
356532064597 PREDICTED: probable methyltransferase PM 0.724 0.639 0.798 0.0
>gi|18411430|ref|NP_567184.1| putative methyltransferase PMT13 [Arabidopsis thaliana] gi|75163241|sp|Q93W95.1|PMTD_ARATH RecName: Full=Probable methyltransferase PMT13 gi|16648931|gb|AAL24317.1| Unknown protein [Arabidopsis thaliana] gi|16649087|gb|AAL24395.1| Unknown protein [Arabidopsis thaliana] gi|23197886|gb|AAN15470.1| Unknown protein [Arabidopsis thaliana] gi|30725428|gb|AAP37736.1| At4g00740 [Arabidopsis thaliana] gi|332656528|gb|AEE81928.1| putative methyltransferase PMT13 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/597 (65%), Positives = 457/597 (76%), Gaps = 70/597 (11%)

Query: 1   MGHLNLPASKR-NARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMST-S 58
           MGH+NLPASKR N RQW+LLDIV+A FFG+VLLFF+L+FTPLGDS+AASGRQ LL+ST S
Sbjct: 1   MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS 60

Query: 59  DPRQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQ 118
           DPRQRQRLV L+EAG H++PIE CPA++V HMPCEDPRRNSQLSREMNFYRERHCPLP++
Sbjct: 61  DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE 120

Query: 119 TPLCLIPPPRGYKIPVPWPESLSKV--------------------------ASF--GGSM 150
           TPLCLIPPP GYKIPVPWPESL K+                           +F  GG+M
Sbjct: 121 TPLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMKREGEYFTFPGGGTM 180

Query: 151 L----SENILTLS-FAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRC 205
                 + I  L+ + P +    +    +  G+ +F   L ++ +   +F+    H S+ 
Sbjct: 181 FPGGAGQYIEKLAQYIPLNGGTLRTALDMGCGVASFGGTLLSQGILALSFAPRDSHKSQI 240

Query: 206 L------------------IPFTAYN-----------------ATYLIEVDRLLRPGGYL 230
                              +PF AY+                 ATY IEVDRLLRPGGYL
Sbjct: 241 QFALERGVPAFVAMLGTRRLPFPAYSFDLMHCSRCLIPFTAYNATYFIEVDRLLRPGGYL 300

Query: 231 VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGESCLSNQNEFGLELC 290
           VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVG+SCL +QNEFGLELC
Sbjct: 301 VISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIWKKPVGDSCLPSQNEFGLELC 360

Query: 291 DESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLTKAPSRALVMKNGYDVFEAD 350
           DES  P+ AWYFKLK+CV+  SSVKGE+A+GTI KWP+RLTK PSRA+VMKNG DVFEAD
Sbjct: 361 DESVPPSDAWYFKLKRCVTRPSSVKGEHALGTISKWPERLTKVPSRAIVMKNGLDVFEAD 420

Query: 351 SRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTL 410
           +RRW RRVAYY+++LN+KL +P +RN+MDMNAFFGGFAA L SDPVWVMNV+PARK  TL
Sbjct: 421 ARRWARRVAYYRDSLNLKLKSPTVRNVMDMNAFFGGFAATLASDPVWVMNVIPARKPLTL 480

Query: 411 SVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRM 470
            VIYDRGLIGVYHDWCEPFSTYPRTYD IHVSGIESLIK   S+K+ CSLVDLMVEMDR+
Sbjct: 481 DVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESLIKRQDSSKSRCSLVDLMVEMDRI 540

Query: 471 LRPEGTVVVRDSPEVIDKVSRIANTVRWTAAVHDKEPGSNGREKILVATKSLWKLPS 527
           LRPEG VV+RDSPEV+DKV+R+A+ VRW++++H+KEP S+GREKIL+ATKSLWKLPS
Sbjct: 541 LRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKEPESHGREKILIATKSLWKLPS 597




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297810097|ref|XP_002872932.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. lyrata] gi|297318769|gb|EFH49191.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225453730|ref|XP_002272714.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera] gi|296089064|emb|CBI38767.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432183|ref|XP_004133879.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus] gi|449480142|ref|XP_004155811.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224130116|ref|XP_002320756.1| predicted protein [Populus trichocarpa] gi|222861529|gb|EEE99071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541472|ref|XP_002511800.1| conserved hypothetical protein [Ricinus communis] gi|223548980|gb|EEF50469.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356520463|ref|XP_003528881.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max] Back     alignment and taxonomy information
>gi|356505029|ref|XP_003521295.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max] Back     alignment and taxonomy information
>gi|356568320|ref|XP_003552360.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max] Back     alignment and taxonomy information
>gi|356532064|ref|XP_003534594.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
TAIR|locus:2117733600 QUA3 "QUASIMODO 3" [Arabidopsi 0.730 0.641 0.820 3.8e-238
TAIR|locus:2196651639 AT1G33170 [Arabidopsis thalian 0.717 0.591 0.457 8e-110
TAIR|locus:2127711633 AT4G10440 [Arabidopsis thalian 0.707 0.589 0.45 2.4e-108
TAIR|locus:2117728633 AT4G00750 [Arabidopsis thalian 0.711 0.592 0.462 3.9e-108
TAIR|locus:2202805616 AT1G26850 [Arabidopsis thalian 0.707 0.605 0.468 3.5e-107
TAIR|locus:2141035621 AT4G18030 [Arabidopsis thalian 0.698 0.592 0.475 9.2e-107
TAIR|locus:2134756600 ERD3 "early-responsive to dehy 0.707 0.621 0.444 4e-104
TAIR|locus:2034522603 AT1G31850 [Arabidopsis thalian 0.705 0.616 0.443 7.4e-103
TAIR|locus:2041031611 AT2G43200 [Arabidopsis thalian 0.703 0.607 0.444 2e-98
TAIR|locus:2129660608 AT4G14360 [Arabidopsis thalian 0.707 0.613 0.429 2.6e-94
TAIR|locus:2117733 QUA3 "QUASIMODO 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1739 (617.2 bits), Expect = 3.8e-238, Sum P(2) = 3.8e-238
 Identities = 316/385 (82%), Positives = 357/385 (92%)

Query:   143 VASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHC 202
             VASFGG++LS+ IL LSFAPRDSHK+QIQFALERG+PAFVAMLGTRRLPFPA+SFD++HC
Sbjct:   213 VASFGGTLLSQGILALSFAPRDSHKSQIQFALERGVPAFVAMLGTRRLPFPAYSFDLMHC 272

Query:   203 SRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIA 262
             SRCLIPFTAYNATY IEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIA
Sbjct:   273 SRCLIPFTAYNATYFIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIA 332

Query:   263 VDGNTVIWKKPVGESCLSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGT 322
             VDGNTVIWKKPVG+SCL +QNEFGLELCDES  P+ AWYFKLK+CV+  SSVKGE+A+GT
Sbjct:   333 VDGNTVIWKKPVGDSCLPSQNEFGLELCDESVPPSDAWYFKLKRCVTRPSSVKGEHALGT 392

Query:   323 IPKWPQRLTKAPSRALVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNA 382
             I KWP+RLTK PSRA+VMKNG DVFEAD+RRW RRVAYY+++LN+KL +P +RN+MDMNA
Sbjct:   393 ISKWPERLTKVPSRAIVMKNGLDVFEADARRWARRVAYYRDSLNLKLKSPTVRNVMDMNA 452

Query:   383 FFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVS 442
             FFGGFAA L SDPVWVMNV+PARK  TL VIYDRGLIGVYHDWCEPFSTYPRTYD IHVS
Sbjct:   453 FFGGFAATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVS 512

Query:   443 GIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANTVRWTAAV 502
             GIESLIK   S+K+ CSLVDLMVEMDR+LRPEG VV+RDSPEV+DKV+R+A+ VRW++++
Sbjct:   513 GIESLIKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSI 572

Query:   503 HDKEPGSNGREKILVATKSLWKLPS 527
             H+KEP S+GREKIL+ATKSLWKLPS
Sbjct:   573 HEKEPESHGREKILIATKSLWKLPS 597


GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0016021 "integral to membrane" evidence=IDA
GO:0052546 "cell wall pectin metabolic process" evidence=IMP
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2196651 AT1G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127711 AT4G10440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117728 AT4G00750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202805 AT1G26850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141035 AT4G18030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134756 ERD3 "early-responsive to dehydration 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034522 AT1G31850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041031 AT2G43200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93W95PMTD_ARATH2, ., 1, ., 1, ., -0.65321.00.8783yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 0.0
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 7e-21
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 2e-06
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.003
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
 Score =  577 bits (1490), Expect = 0.0
 Identities = 198/385 (51%), Positives = 265/385 (68%), Gaps = 13/385 (3%)

Query: 143 VASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHC 202
           VASFG  +LS ++LT+SFAP+D H+AQ+QFALERG+PA + +LGTRRLP+P+ SFD+ HC
Sbjct: 128 VASFGAYLLSRDVLTMSFAPKDVHEAQVQFALERGVPAMLGVLGTRRLPYPSRSFDMAHC 187

Query: 203 SRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQD---KEWADLQAVARALCYE 259
           SRCLIP+ A +   L+EVDR+LRPGGY V+SGPPV    ++   +EW  ++A+A++LC++
Sbjct: 188 SRCLIPWHANDGILLLEVDRVLRPGGYFVLSGPPVYARDEEDLQEEWKAMEALAKSLCWK 247

Query: 260 LIAVDGNTVIWKKPVGESC-LSNQNEFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEY 318
           L+A  G+  IW+KPV  SC    +      LC +SDDP+ AWY  ++ C++    V  E 
Sbjct: 248 LVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDAAWYVPMEACITPLPEVSHEV 307

Query: 319 AVGTIPKWPQRLTKAPSRA---LVMKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIR 375
             G + KWP+RLT  P R     +     + F+AD+  W+RRV+ YK  L + +    +R
Sbjct: 308 GGGWLEKWPERLTAVPPRLASGQIGGVSAEAFKADTELWKRRVSKYKRLLKLLIDKGRVR 367

Query: 376 NIMDMNAFFGGFAAALTSDPVWVMNVVPARKSSTLSVIYDRGLIGVYHDWCEPFSTYPRT 435
           N+MDMNA FGGFAAAL  DPVWVMNVVP     TL VIYDRGLIG+YHDWCEPFSTYPRT
Sbjct: 368 NVMDMNAGFGGFAAALIDDPVWVMNVVPVDSPDTLPVIYDRGLIGIYHDWCEPFSTYPRT 427

Query: 436 YDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDKVSRIANT 495
           YDL+H   + SL       K  C+L D+++EMDR+LRP G V++RD  +V+DKV +IA  
Sbjct: 428 YDLLHADHLFSLY------KKRCNLEDILLEMDRILRPGGAVIIRDDVDVLDKVKKIAKA 481

Query: 496 VRWTAAVHDKEPGSNGREKILVATK 520
           +RW   + D E G +  EKIL+A K
Sbjct: 482 MRWEVRITDTEDGPHDPEKILIAQK 506


This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506

>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 527
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.41
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.35
PLN02336475 phosphoethanolamine N-methyltransferase 99.35
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.23
PLN02232160 ubiquinone biosynthesis methyltransferase 99.09
PLN02233261 ubiquinone biosynthesis methyltransferase 99.0
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.92
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.85
PLN02244340 tocopherol O-methyltransferase 98.83
PRK05785226 hypothetical protein; Provisional 98.74
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.73
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.65
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.6
KOG4300252 consensus Predicted methyltransferase [General fun 98.57
PLN02336475 phosphoethanolamine N-methyltransferase 98.52
PRK08317241 hypothetical protein; Provisional 98.5
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.5
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.46
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.46
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.46
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.45
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.44
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.42
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.4
PLN02490340 MPBQ/MSBQ methyltransferase 98.4
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.4
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.33
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.32
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.3
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.29
PRK11207197 tellurite resistance protein TehB; Provisional 98.27
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.25
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.16
TIGR00452314 methyltransferase, putative. Known examples to dat 98.12
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.11
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.1
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.09
PRK06922677 hypothetical protein; Provisional 98.09
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.05
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.04
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.03
PRK12335287 tellurite resistance protein TehB; Provisional 98.02
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.99
KOG3010261 consensus Methyltransferase [General function pred 97.96
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.94
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.91
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.86
PRK06202232 hypothetical protein; Provisional 97.83
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.81
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.75
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.73
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.73
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.73
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.67
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.66
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.65
PLN02233261 ubiquinone biosynthesis methyltransferase 97.65
COG4627185 Uncharacterized protein conserved in bacteria [Fun 97.61
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.58
KOG2940325 consensus Predicted methyltransferase [General fun 97.55
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.54
PLN02244340 tocopherol O-methyltransferase 97.54
PRK08317241 hypothetical protein; Provisional 97.51
PRK12335287 tellurite resistance protein TehB; Provisional 97.51
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.49
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.49
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.45
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.41
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.4
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.39
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.39
PLN03075296 nicotianamine synthase; Provisional 97.38
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.37
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.37
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.36
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.36
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.35
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 97.34
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.34
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.32
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.32
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.31
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.31
PRK11207197 tellurite resistance protein TehB; Provisional 97.29
KOG1331293 consensus Predicted methyltransferase [General fun 97.27
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.26
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.25
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.24
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.23
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.23
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.19
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.18
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 97.15
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.15
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.14
TIGR00452314 methyltransferase, putative. Known examples to dat 97.14
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.12
PRK14968188 putative methyltransferase; Provisional 97.1
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 97.09
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.09
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 97.07
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.07
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.06
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.05
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.05
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.05
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.04
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.02
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.01
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.97
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.95
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.95
TIGR00438188 rrmJ cell division protein FtsJ. 96.95
COG4106257 Tam Trans-aconitate methyltransferase [General fun 96.95
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.93
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.92
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 96.91
PRK14968188 putative methyltransferase; Provisional 96.91
COG1041347 Predicted DNA modification methylase [DNA replicat 96.9
TIGR03438301 probable methyltransferase. This model represents 96.9
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.88
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.8
PRK14967223 putative methyltransferase; Provisional 96.8
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.79
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.77
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.75
PRK04266226 fibrillarin; Provisional 96.74
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.74
PRK05785226 hypothetical protein; Provisional 96.71
TIGR00740239 methyltransferase, putative. A simple BLAST search 96.71
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.69
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.67
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.67
PRK10901427 16S rRNA methyltransferase B; Provisional 96.67
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 96.61
PTZ00146293 fibrillarin; Provisional 96.61
PRK13256226 thiopurine S-methyltransferase; Reviewed 96.59
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 96.57
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 96.57
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.57
PRK14901434 16S rRNA methyltransferase B; Provisional 96.55
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.53
PTZ00146293 fibrillarin; Provisional 96.53
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.5
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 96.5
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 96.49
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 96.48
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.47
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.46
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.44
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.44
PRK14904445 16S rRNA methyltransferase B; Provisional 96.42
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 96.39
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.35
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.34
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.33
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.32
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.23
PRK06202232 hypothetical protein; Provisional 96.2
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.19
PRK04266226 fibrillarin; Provisional 96.15
PRK14967223 putative methyltransferase; Provisional 96.07
PRK14903431 16S rRNA methyltransferase B; Provisional 96.07
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 96.02
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 95.95
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 95.94
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 95.91
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 95.85
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.84
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.83
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 95.82
PRK06922677 hypothetical protein; Provisional 95.82
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 95.8
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 95.75
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 95.71
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.69
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.63
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 95.59
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 95.59
TIGR00536284 hemK_fam HemK family putative methylases. The gene 95.57
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 95.56
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 95.54
PRK14902444 16S rRNA methyltransferase B; Provisional 95.51
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 95.42
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 95.37
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 95.36
TIGR00438188 rrmJ cell division protein FtsJ. 95.35
COG2890280 HemK Methylase of polypeptide chain release factor 95.34
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 95.32
PRK04457262 spermidine synthase; Provisional 95.26
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.26
PLN02490340 MPBQ/MSBQ methyltransferase 95.23
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.11
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 95.06
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 95.05
KOG3010261 consensus Methyltransferase [General function pred 94.93
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 94.92
PRK00811283 spermidine synthase; Provisional 94.9
KOG3045325 consensus Predicted RNA methylase involved in rRNA 94.85
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 94.83
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 94.79
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.76
PRK13699227 putative methylase; Provisional 94.75
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 94.73
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 94.73
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 94.65
COG2521287 Predicted archaeal methyltransferase [General func 94.59
PRK07402196 precorrin-6B methylase; Provisional 94.58
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 94.51
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 94.47
KOG2352482 consensus Predicted spermine/spermidine synthase [ 94.44
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 94.35
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 94.19
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 93.92
KOG2361264 consensus Predicted methyltransferase [General fun 93.81
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.78
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.76
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 93.69
TIGR03438301 probable methyltransferase. This model represents 93.55
TIGR00536284 hemK_fam HemK family putative methylases. The gene 93.54
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 93.49
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 93.44
smart00650169 rADc Ribosomal RNA adenine dimethylases. 93.44
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 93.25
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 93.21
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 93.2
PHA03411279 putative methyltransferase; Provisional 93.2
PRK07402196 precorrin-6B methylase; Provisional 93.2
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 93.15
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 92.77
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 92.56
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 92.44
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 92.35
KOG1271227 consensus Methyltransferases [General function pre 92.29
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 92.29
PRK01581374 speE spermidine synthase; Validated 92.24
PRK04457262 spermidine synthase; Provisional 92.17
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 92.16
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 92.07
PF03269177 DUF268: Caenorhabditis protein of unknown function 92.06
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 91.91
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 91.72
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 91.71
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 91.67
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 91.38
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 91.33
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 91.22
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 91.16
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 91.13
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 91.11
PRK00811283 spermidine synthase; Provisional 91.03
PRK13255218 thiopurine S-methyltransferase; Reviewed 91.02
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 90.93
PRK14902444 16S rRNA methyltransferase B; Provisional 90.86
COG1092393 Predicted SAM-dependent methyltransferases [Genera 90.75
PLN02366308 spermidine synthase 90.5
PRK11524284 putative methyltransferase; Provisional 90.17
PRK03612521 spermidine synthase; Provisional 90.05
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 89.86
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 89.73
PLN03075296 nicotianamine synthase; Provisional 89.71
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 89.24
COG4123248 Predicted O-methyltransferase [General function pr 88.77
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 88.29
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 88.24
PRK14901434 16S rRNA methyltransferase B; Provisional 88.19
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 88.11
PHA03412241 putative methyltransferase; Provisional 87.68
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 87.59
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 86.9
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 86.87
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 86.77
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 86.63
KOG3201201 consensus Uncharacterized conserved protein [Funct 86.55
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 86.38
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 86.2
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.91
COG4798238 Predicted methyltransferase [General function pred 85.64
PRK10901427 16S rRNA methyltransferase B; Provisional 85.56
PRK01581374 speE spermidine synthase; Validated 85.55
KOG4300252 consensus Predicted methyltransferase [General fun 85.45
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 85.36
COG4122219 Predicted O-methyltransferase [General function pr 85.34
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 85.16
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 85.14
KOG1271227 consensus Methyltransferases [General function pre 85.08
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 84.05
PLN02232160 ubiquinone biosynthesis methyltransferase 83.86
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 83.32
PRK03612521 spermidine synthase; Provisional 83.02
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 82.88
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 81.72
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 81.69
PLN02823336 spermine synthase 81.53
COG4123248 Predicted O-methyltransferase [General function pr 81.51
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 81.09
PLN02366308 spermidine synthase 80.55
PLN02585315 magnesium protoporphyrin IX methyltransferase 80.55
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
Probab=100.00  E-value=3.3e-157  Score=1243.01  Aligned_cols=427  Identities=52%  Similarity=1.016  Sum_probs=414.6

Q ss_pred             CCCCCCChhHhhhc--cccchhhhhcCCCCCCCCCccccCCCCCCCCCCCCCccchh-----------------------
Q 009719           88 DHMPCEDPRRNSQL--SREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLSK-----------------------  142 (527)
Q Consensus        88 ~y~PC~d~~~~~~~--~~~~~~~reRhCp~~~~~~~Clvp~P~gY~~P~~WP~Srd~-----------------------  142 (527)
                      |||||+|+.+++++  ++++++|||||||+.+++++||||+|+|||+|||||+|||+                       
T Consensus         1 dy~PC~D~~~~~~~~~~~~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~L~~~K~~qnWv~~   80 (506)
T PF03141_consen    1 DYIPCLDNSRAIKFLLSRERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTKLAEEKADQNWVRV   80 (506)
T ss_pred             CCcCCCCHHHHHhhccCcccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchHHhhhcccccceee
Confidence            79999999999999  99999999999999999999999999999999999999999                       


Q ss_pred             -----------------------------------------------hhccccccccCCeeEEeeccCcChHHHHHHHHH
Q 009719          143 -----------------------------------------------VASFGGSMLSENILTLSFAPRDSHKAQIQFALE  175 (527)
Q Consensus       143 -----------------------------------------------vgsfga~Ll~r~V~~msiAp~D~seaqvq~A~e  175 (527)
                                                                     +|||||+|+++||++|++||.|.|++|+|||+|
T Consensus        81 ~gd~~~FPgggt~F~~Ga~~Yid~i~~~~~~~~~~g~iR~~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~qvqfale  160 (506)
T PF03141_consen   81 EGDKFRFPGGGTMFPHGADHYIDQIAEMIPLIKWGGGIRTALDVGCGVASFGAYLLERNVTTMSFAPNDEHEAQVQFALE  160 (506)
T ss_pred             cCCEEEeCCCCccccCCHHHHHHHHHHHhhccccCCceEEEEeccceeehhHHHHhhCCceEEEcccccCCchhhhhhhh
Confidence                                                           899999999999999999999999999999999


Q ss_pred             cCCCcEEeeccccCCCCCCCcccEEEecCcccccccChHHHHHHHhhcccCCcEEEEecCCCCCCCc---hhHHHHHHHH
Q 009719          176 RGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQ---DKEWADLQAV  252 (527)
Q Consensus       176 Rg~pa~~~v~dae~LPFpD~SFDlV~cs~~l~hw~d~~~~aL~Ei~RVLRPGG~lviS~pp~~~~~~---~~~w~~i~~l  252 (527)
                      ||+|+++.+.++++||||+++||+|||++|+++|...++.+|.|++|||||||||++|+||+|....   ..+|+.|+++
T Consensus       161 RGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~r~~~~~~~~~~~~~~l  240 (506)
T PF03141_consen  161 RGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQRTDEDLEEEWNAMEDL  240 (506)
T ss_pred             cCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceEEecCCcccccchHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999889999999999999999999999994333   3479999999


Q ss_pred             HHhcceEEeeeecceEEEeCCCccccccccC-CCCCCCCCCCCCCCcccccccccccccccCCCccccCCCCCCCCcccc
Q 009719          253 ARALCYELIAVDGNTVIWKKPVGESCLSNQN-EFGLELCDESDDPNYAWYFKLKKCVSGTSSVKGEYAVGTIPKWPQRLT  331 (527)
Q Consensus       253 ~~~mcW~~~~~~~~v~iwrKp~~~~c~~~~~-~~~p~~C~~~~d~d~~wy~~~~~Ci~~~~~~~~~~~~~~~~~wP~Rl~  331 (527)
                      |++|||++++++++++|||||.+++||.+|+ .+.||+|++++|||++||++|++||||+|++.++.+++++++||+||+
T Consensus       241 ~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~~~~~WP~RL~  320 (506)
T PF03141_consen  241 AKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPGKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGGWLPKWPERLN  320 (506)
T ss_pred             HHHHHHHHheeeCCEEEEeccCCchhhhhccCCCCCCCCCCCCCCcchhhcchhhhcCcCCcccccccccCCCCChhhhc
Confidence            9999999999999999999999999999965 499999999999999999999999999999988999999999999999


Q ss_pred             CCCccccc---cccCccccchhhHHHHHHHHHHHHHhhhccCCCCeeeEeecCCCccchhhhccCCCeeEEEecCCCCCC
Q 009719          332 KAPSRALV---MKNGYDVFEADSRRWRRRVAYYKNTLNVKLGTPAIRNIMDMNAFFGGFAAALTSDPVWVMNVVPARKSS  408 (527)
Q Consensus       332 ~~p~rl~~---~g~~~~~f~~d~~~W~~~v~~Y~~~l~~~i~~~~iRnvmDm~ag~GgFaAaL~~~~VwvMnvvp~~~~n  408 (527)
                      ++|+||..   .|+++|.|++|+++|+++|++|+++++..+++++||||||||||||||||||+++|||||||||+.++|
T Consensus       321 ~~P~rl~~~~~~g~~~e~F~~Dt~~Wk~~V~~Y~~l~~~~i~~~~iRNVMDMnAg~GGFAAAL~~~~VWVMNVVP~~~~n  400 (506)
T PF03141_consen  321 AVPPRLSSGSIPGISPEEFKEDTKHWKKRVSHYKKLLGLAIKWGRIRNVMDMNAGYGGFAAALIDDPVWVMNVVPVSGPN  400 (506)
T ss_pred             cCchhhhcCCcCCCCHHHHHHHHHHHHHHHHHHHHhhcccccccceeeeeeecccccHHHHHhccCCceEEEecccCCCC
Confidence            99999964   899999999999999999999999888789999999999999999999999999999999999999999


Q ss_pred             chhHhhhccccccccccCCCCCCCCCccchhhhcCccccccCCCCCCCCCcccccceeecccccCCcEEEEeCCHHHHHH
Q 009719          409 TLSVIYDRGLIGVYHDWCEPFSTYPRTYDLIHVSGIESLIKNPGSNKNSCSLVDLMVEMDRMLRPEGTVVVRDSPEVIDK  488 (527)
Q Consensus       409 tl~vi~eRGLiG~~hdwce~fstYPrtyDLiHa~~~fs~~~~~~~~~~rC~~~~illEmDRILRP~G~~iird~~~~~~~  488 (527)
                      ||++||||||||+||||||+|||||||||||||+++||.|+      +||+|++|||||||||||||++||||+.+++++
T Consensus       401 tL~vIydRGLIG~yhDWCE~fsTYPRTYDLlHA~~lfs~~~------~rC~~~~illEmDRILRP~G~~iiRD~~~vl~~  474 (506)
T PF03141_consen  401 TLPVIYDRGLIGVYHDWCEAFSTYPRTYDLLHADGLFSLYK------DRCEMEDILLEMDRILRPGGWVIIRDTVDVLEK  474 (506)
T ss_pred             cchhhhhcccchhccchhhccCCCCcchhheehhhhhhhhc------ccccHHHHHHHhHhhcCCCceEEEeccHHHHHH
Confidence            99999999999999999999999999999999999999997      899999999999999999999999999999999


Q ss_pred             HHHHHhcCCceeEEecCCCCCCCCceEEEEEe
Q 009719          489 VSRIANTVRWTAAVHDKEPGSNGREKILVATK  520 (527)
Q Consensus       489 i~~i~~~l~W~~~~~~~e~~~~~~ekiLi~~K  520 (527)
                      |++|+++|||+++++|+|+|++++||||||||
T Consensus       475 v~~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  475 VKKIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             HHHHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            99999999999999999999999999999998



; GO: 0008168 methyltransferase activity

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 8e-06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-05
3f4k_A257 Putative methyltransferase; structural genomics, P 4e-05
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 5e-05
1vlm_A219 SAM-dependent methyltransferase; possible histamin 5e-05
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 5e-05
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 6e-05
3m33_A226 Uncharacterized protein; structural genomics, PSI- 6e-05
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 1e-04
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 1e-04
1xxl_A239 YCGJ protein; structural genomics, protein structu 2e-04
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 2e-04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 2e-04
1vl5_A260 Unknown conserved protein BH2331; putative methylt 3e-04
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 4e-04
3dh0_A219 SAM dependent methyltransferase; cystal structure, 4e-04
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 6e-04
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 7e-04
3cc8_A230 Putative methyltransferase; structural genomics, j 8e-04
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 8e-04
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
 Score = 46.4 bits (110), Expect = 8e-06
 Identities = 13/61 (21%), Positives = 22/61 (36%), Gaps = 1/61 (1%)

Query: 189 RLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGPPVQWPKQDKEWAD 248
            LPF    F+ +     L          L E+ R+L+  GY  I+        ++  +  
Sbjct: 109 SLPFENEQFEAIMAINSLEWTEEPLRA-LNEIKRVLKSDGYACIAILGPTAKPRENSYPR 167

Query: 249 L 249
           L
Sbjct: 168 L 168


>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.08
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.98
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.98
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.96
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.93
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.93
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.87
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.86
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.84
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.84
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.84
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.83
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.83
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.83
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.82
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.8
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.8
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.79
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.79
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.78
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.77
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.77
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.76
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.74
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.73
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.73
3f4k_A257 Putative methyltransferase; structural genomics, P 98.72
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.71
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.71
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.7
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.7
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.7
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.69
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.69
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.69
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.69
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.69
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.68
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.67
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.66
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.66
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.66
3cc8_A230 Putative methyltransferase; structural genomics, j 98.65
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.65
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.65
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.65
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.64
3lcc_A235 Putative methyl chloride transferase; halide methy 98.63
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.62
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.62
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.62
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.62
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.6
3ocj_A305 Putative exported protein; structural genomics, PS 98.59
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.58
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.57
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.57
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.53
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.51
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.49
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.48
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.47
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.47
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.46
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.45
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.45
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.44
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.43
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.43
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.43
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.42
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.41
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.41
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.39
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.35
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.35
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.34
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.34
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.31
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.29
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.28
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.28
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.27
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.23
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.23
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.21
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.2
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.19
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.19
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.19
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.16
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.15
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.15
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.15
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.12
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.12
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.12
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.1
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.08
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.08
3ocj_A305 Putative exported protein; structural genomics, PS 98.07
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.06
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.06
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.05
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.04
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.03
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.03
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.03
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.03
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.02
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.02
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.02
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.0
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.0
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.0
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.99
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.99
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.99
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.99
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.99
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.98
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.97
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.97
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.97
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.96
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.94
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.94
3lcc_A235 Putative methyl chloride transferase; halide methy 97.93
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.93
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.93
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.93
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.93
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.92
3i9f_A170 Putative type 11 methyltransferase; structural gen 97.92
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.91
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.91
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.91
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.9
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.9
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.89
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.89
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.89
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.89
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.89
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.88
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.87
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.87
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.86
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.85
3cc8_A230 Putative methyltransferase; structural genomics, j 97.85
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.84
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.84
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.84
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.83
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.83
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.83
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.83
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.83
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.82
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.81
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.81
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.81
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.81
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 97.81
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.8
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.8
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.79
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.79
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.79
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.78
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.77
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.77
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.76
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.76
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.76
3ege_A261 Putative methyltransferase from antibiotic biosyn 97.76
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.76
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.75
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.75
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.75
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.75
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.75
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.74
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.74
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.73
3f4k_A257 Putative methyltransferase; structural genomics, P 97.72
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.72
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.72
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.72
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 97.71
3dh0_A219 SAM dependent methyltransferase; cystal structure, 97.71
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.71
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.71
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.7
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.69
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 97.69
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.68
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.67
2fyt_A340 Protein arginine N-methyltransferase 3; structural 97.67
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.67
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.67
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.65
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.65
3lpm_A259 Putative methyltransferase; structural genomics, p 97.63
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.63
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.61
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 97.61
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.61
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.6
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.59
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.59
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.58
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.58
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.57
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.56
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.55
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.55
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 97.55
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.55
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.55
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.54
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.54
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.54
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.53
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.53
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.53
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.52
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.51
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.5
3lpm_A259 Putative methyltransferase; structural genomics, p 97.5
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.5
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.49
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.49
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.48
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.48
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.48
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.47
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.47
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.47
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.46
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.46
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.46
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.45
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 97.45
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.44
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.44
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 97.44
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.44
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.43
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.42
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.42
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.42
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.41
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.4
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.4
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.4
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.39
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.39
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.38
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.38
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.38
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.38
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.37
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.37
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.37
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.37
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.37
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.37
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.36
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.36
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.35
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 97.35
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 97.34
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.34
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.33
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.33
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.32
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.31
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.3
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.3
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.3
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.3
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.28
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.27
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.27
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 97.27
2b25_A336 Hypothetical protein; structural genomics, methyl 97.26
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.26
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.25
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 97.22
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.22
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.22
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.21
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.19
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.17
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 97.17
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.17
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.16
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.16
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.16
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.15
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 97.15
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 97.13
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 97.13
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.12
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.12
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.1
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.1
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.09
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.09
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.09
2h00_A254 Methyltransferase 10 domain containing protein; st 97.09
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 97.08
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.07
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.05
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.05
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.04
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.04
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.03
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.03
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.02
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.0
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.0
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.0
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.99
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 96.98
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 96.98
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 96.96
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.96
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 96.96
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.93
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.92
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.92
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 96.89
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 96.87
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.87
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 96.83
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.83
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.82
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.81
3sso_A419 Methyltransferase; macrolide, natural product, ros 96.81
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 96.81
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.79
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.78
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 96.78
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.75
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.75
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.74
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.74
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.73
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.73
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 96.72
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.7
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.7
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.7
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.7
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.7
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.69
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.67
1ne2_A200 Hypothetical protein TA1320; structural genomics, 96.67
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.67
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.66
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.66
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.66
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 96.65
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.65
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 96.65
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.64
2i7c_A283 Spermidine synthase; transferase, structural genom 96.64
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.62
2o07_A304 Spermidine synthase; structural genomics, structur 96.61
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.6
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.6
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.59
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 96.58
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.57
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.56
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 96.55
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.54
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.53
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.53
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.51
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.48
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.46
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.42
2pt6_A321 Spermidine synthase; transferase, structural genom 96.39
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 96.36
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.35
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 96.35
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.32
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.28
2cmg_A262 Spermidine synthase; transferase, putrescine amino 96.26
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.23
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.23
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.22
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.21
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.2
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 96.19
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.17
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 96.16
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.14
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.13
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.13
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.12
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.1
2b25_A336 Hypothetical protein; structural genomics, methyl 96.08
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 96.07
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.07
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 96.06
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 96.06
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.05
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.04
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.01
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 95.94
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 95.93
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 95.92
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 95.9
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 95.9
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.89
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 95.89
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 95.86
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 95.86
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 95.82
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 95.82
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.82
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 95.81
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 95.81
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 95.79
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 95.78
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.77
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 95.77
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 95.75
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 95.74
2fpo_A202 Methylase YHHF; structural genomics, putative meth 95.67
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 95.65
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 95.59
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 95.58
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 95.58
1xj5_A334 Spermidine synthase 1; structural genomics, protei 95.54
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 95.53
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 95.53
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 95.51
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 95.44
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 95.42
2pt6_A321 Spermidine synthase; transferase, structural genom 95.4
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 95.36
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.29
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 95.19
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 95.15
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 95.1
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.03
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.99
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 94.76
2cmg_A262 Spermidine synthase; transferase, putrescine amino 94.76
2h00_A254 Methyltransferase 10 domain containing protein; st 94.74
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 94.73
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 94.71
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 94.61
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 94.58
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 94.56
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 94.54
2o07_A304 Spermidine synthase; structural genomics, structur 94.47
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 94.4
1ne2_A200 Hypothetical protein TA1320; structural genomics, 94.39
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 94.3
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 94.27
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 94.25
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 94.18
2i7c_A283 Spermidine synthase; transferase, structural genom 94.03
3gjy_A317 Spermidine synthase; APC62791, structural genomics 93.97
2b78_A385 Hypothetical protein SMU.776; structure genomics, 93.95
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 93.73
3k6r_A278 Putative transferase PH0793; structural genomics, 93.67
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 93.65
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 93.63
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 93.52
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 93.47
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 93.25
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 93.16
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 93.05
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 93.05
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 92.97
2zig_A297 TTHA0409, putative modification methylase; methylt 92.86
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 92.86
3k6r_A278 Putative transferase PH0793; structural genomics, 92.75
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 92.37
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 92.04
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 91.75
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 91.69
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 91.67
2qm3_A373 Predicted methyltransferase; putative methyltransf 91.64
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 91.53
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 91.41
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 91.18
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 91.06
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 90.75
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 90.59
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 90.58
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 90.09
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 89.99
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
Probab=99.08  E-value=4.8e-11  Score=117.61  Aligned_cols=87  Identities=17%  Similarity=0.184  Sum_probs=69.3

Q ss_pred             hhccccccccCCeeEEeeccCcChHHHHHHHHHcCCCcEEeeccccCCCCCCCcccEEEecCcccccccChHHHHHHHhh
Q 009719          143 VASFGGSMLSENILTLSFAPRDSHKAQIQFALERGIPAFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDR  222 (527)
Q Consensus       143 vgsfga~Ll~r~V~~msiAp~D~seaqvq~A~eRg~pa~~~v~dae~LPFpD~SFDlV~cs~~l~hw~d~~~~aL~Ei~R  222 (527)
                      .|.++..|..++..+..+   |.+++|++.|+++ ..+.+.+++++.+||++++||+|+|+.++ ||.+... ++.|+.|
T Consensus        50 tG~~~~~l~~~~~~v~gv---D~s~~ml~~a~~~-~~v~~~~~~~e~~~~~~~sfD~v~~~~~~-h~~~~~~-~~~e~~r  123 (257)
T 4hg2_A           50 SGQASLGLAEFFERVHAV---DPGEAQIRQALRH-PRVTYAVAPAEDTGLPPASVDVAIAAQAM-HWFDLDR-FWAELRR  123 (257)
T ss_dssp             TTTTHHHHHTTCSEEEEE---ESCHHHHHTCCCC-TTEEEEECCTTCCCCCSSCEEEEEECSCC-TTCCHHH-HHHHHHH
T ss_pred             CCHHHHHHHHhCCEEEEE---eCcHHhhhhhhhc-CCceeehhhhhhhcccCCcccEEEEeeeh-hHhhHHH-HHHHHHH
Confidence            445555666666544444   7889999988653 34677889999999999999999999998 7776655 9999999


Q ss_pred             cccCCcEEEEecC
Q 009719          223 LLRPGGYLVISGP  235 (527)
Q Consensus       223 VLRPGG~lviS~p  235 (527)
                      ||||||.|++...
T Consensus       124 vLkpgG~l~~~~~  136 (257)
T 4hg2_A          124 VARPGAVFAAVTY  136 (257)
T ss_dssp             HEEEEEEEEEEEE
T ss_pred             HcCCCCEEEEEEC
Confidence            9999999998764



>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 527
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.002
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Histamine methyltransferase
domain: Histamine methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.7 bits (86), Expect = 0.002
 Identities = 8/46 (17%), Positives = 13/46 (28%), Gaps = 1/46 (2%)

Query: 190 LPFPAFSFDIVHCSRCLIPFTAYNATYLIEVDRLLRPGGYLVISGP 235
                  +D +H  + L       AT       LL     ++I   
Sbjct: 117 EKKELQKWDFIHMIQMLYYVKDIPATLK-FFHSLLGTNAKMLIIVV 161


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.24
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.22
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.15
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.13
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.1
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.08
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.03
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.97
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.8
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.78
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.74
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.73
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.63
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.61
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.59
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.55
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.54
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.44
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.33
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.3
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.29
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.26
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.24
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.23
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.21
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.16
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.12
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.09
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.08
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.07
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.07
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.05
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.05
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.0
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.92
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.92
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.92
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.91
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.91
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.91
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.9
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.87
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.86
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.86
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.86
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.83
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.8
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.79
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.75
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.73
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.73
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.72
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.71
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.69
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.65
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.63
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.61
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.6
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 97.52
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.49
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.47
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.45
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.43
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.42
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.42
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.41
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.39
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.34
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 97.26
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.21
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.09
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.08
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.06
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.04
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.02
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.96
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 96.91
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 96.89
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.87
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.86
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.84
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.8
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.78
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.75
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.67
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 96.49
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.48
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.34
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 95.93
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.84
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 95.65
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.55
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 95.37
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.53
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 94.4
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 93.93
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 93.55
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 93.33
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 93.13
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.07
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 92.94
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.87
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 92.72
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 92.48
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 92.24
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 92.05
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 92.01
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 91.96
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 91.75
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 91.66
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 91.37
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 91.26
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.04
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 90.87
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 90.69
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 90.55
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 89.8
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 89.07
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 88.66
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 88.19
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 87.17
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 87.01
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 86.32
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 84.63
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 83.6
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 83.23
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 83.13
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 82.46
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 82.42
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 80.56
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 80.48
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]
Probab=99.24  E-value=2.8e-12  Score=118.42  Aligned_cols=89  Identities=18%  Similarity=0.233  Sum_probs=71.1

Q ss_pred             hhccccccccCCeeEEeeccCcChHHHHHHHHHc----CCC-cEEeeccccCCCCCCCcccEEEecCcccccccChHHHH
Q 009719          143 VASFGGSMLSENILTLSFAPRDSHKAQIQFALER----GIP-AFVAMLGTRRLPFPAFSFDIVHCSRCLIPFTAYNATYL  217 (527)
Q Consensus       143 vgsfga~Ll~r~V~~msiAp~D~seaqvq~A~eR----g~p-a~~~v~dae~LPFpD~SFDlV~cs~~l~hw~d~~~~aL  217 (527)
                      .|.++.+|.+++..+.   ..|.++.|++.|+++    +.+ +.+.+++++.|||++++||+|+|..+++|+.+... +|
T Consensus        26 ~G~~~~~l~~~~~~v~---gvD~s~~~i~~A~~~~~~~~~~~i~~~~~d~~~l~~~~~~fD~v~~~~~l~~~~d~~~-~l  101 (231)
T d1vl5a_          26 GGHVANAFAPFVKKVV---AFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHHFPNPAS-FV  101 (231)
T ss_dssp             TCHHHHHHGGGSSEEE---EEESCHHHHHHHHHHHHHTTCCSEEEEECCC-CCCSCTTCEEEEEEESCGGGCSCHHH-HH
T ss_pred             CcHHHHHHHHhCCEEE---EEECCHHHHhhhhhcccccccccccccccccccccccccccccccccccccccCCHHH-HH
Confidence            4555556677765443   348889999998754    444 56888999999999999999999999988877665 99


Q ss_pred             HHHhhcccCCcEEEEecC
Q 009719          218 IEVDRLLRPGGYLVISGP  235 (527)
Q Consensus       218 ~Ei~RVLRPGG~lviS~p  235 (527)
                      +|+.|+|||||+|++..+
T Consensus       102 ~~~~r~LkpgG~l~i~~~  119 (231)
T d1vl5a_         102 SEAYRVLKKGGQLLLVDN  119 (231)
T ss_dssp             HHHHHHEEEEEEEEEEEE
T ss_pred             HHHHHhcCCCcEEEEEeC
Confidence            999999999999999764



>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure