Citrus Sinensis ID: 010006


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
cccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEccccccccccccccccccccccEEEEEEcccccccccHHHccccccccccccEEEEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHccccccccccccEEEEccccccccccccccHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEEcccccccccEEEEcccccEEEEEcccccccccccccccccccccHHHccccccEEEcccEEEcHHHHHHHHHccccccccccccccccccccccEEEEEcccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcEEcccEEEEccEEEEEEEccccEEccccEEEcEEEEcccccccHHHHHHHHHcccccEEEccccEEEcEEEccccEEccccEEEccccHHHHHcccccEEEcccEEEEccccEEcccccc
ccHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEEEEcccccccccccccccccccccEEEEEEcccccHHHccHHHHccHHHcEEccEEEEEEccccccccccccEEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEEccccEHccHHHHHHHHHHccccEEEEEEEccHHHccHccEEEEccccEEEEEEEccccHHHHHHccccccccccHHHHcccccEEEEEEEEEcHHHHHHHHHHcccccccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccccEEEEEEEEccEEEEcEEEEEEEEEEEEEEcccEEEEcEEEEcccccccHHHHHHHHHcccccEEEccccEEEEEEEEcccEccccEEEEccccccccccccccEEEEccEEEEEcccEcccccEc
masmasigslkvpsspstattssnsnnhsRRSVVKRLAfsssqlsgdkifskavtgdrrserrpivvspqavsdsknsqtcldpeasrSVLGIIlgggagtrlypltkkrakpavplganyrlidipvsnclnsniSKIYVLTQFNSASLNRHLSRAYasnmggykneGFVEVLAaqqspenpnwfqGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLmkideegriiefsekpkgeqlkamkvdttilgldderakempyiASMGIYVISKDVMLNLlrdkfpgandfgsevipgatsiGMRVQAYLydgywediGTIEAFYNanlgitkkpipdfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLaakgsvpigigknshIKRAIIdknarigdnvkivnSDSVQEAARETDGYFIKSGIVTIIkdalipsgtii
masmasigslkvpsspstattssnsnnhsrrsVVKRLafsssqlsgdkifskavtgdrrserrpivvspqavsdsknsqtcldpeasrSVLGIILGGgagtrlypltkkrakpavplGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRiiefsekpkgeqlkamkvdttilgldderakempyIASMGIYVISKDVMLNLLRDKFPGANDFgsevipgatsiGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAkgsvpigigknshikraiidknarigdnvkivnsdsvqeaARETdgyfiksgivtiikdalipsgtii
MASMASIGSLkvpsspstattssnsnnhsrrsvvkrLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
****************************************************************************************SVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQ***NPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEF***********MKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIP*****
**************************************FSS*QLS*******************************************SVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQL**M******LG**DERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
********************************VVKRLAFSSSQLSGDKIFSKA*****************************DPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
**********************************************DKIFSK*VTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPS*TII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query520 2.2.26 [Sep-21-2011]
P52417512 Glucose-1-phosphate adeny N/A no 0.984 1.0 0.885 0.0
Q9M462520 Glucose-1-phosphate adeny N/A no 0.978 0.978 0.870 0.0
P23509521 Glucose-1-phosphate adeny N/A no 0.988 0.986 0.877 0.0
Q42882521 Glucose-1-phosphate adeny N/A no 0.988 0.986 0.867 0.0
P55228520 Glucose-1-phosphate adeny yes no 0.990 0.990 0.853 0.0
P52416508 Glucose-1-phosphate adeny N/A no 0.913 0.935 0.905 0.0
P55232489 Glucose-1-phosphate adeny N/A no 0.890 0.946 0.905 0.0
P15280514 Glucose-1-phosphate adeny yes no 0.882 0.892 0.906 0.0
P55238513 Glucose-1-phosphate adeny N/A no 0.890 0.902 0.904 0.0
P30523473 Glucose-1-phosphate adeny N/A no 0.857 0.942 0.899 0.0
>sp|P52417|GLGS2_VICFA Glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic OS=Vicia faba GN=AGPP PE=2 SV=1 Back     alignment and function desciption
 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/517 (88%), Positives = 492/517 (95%), Gaps = 5/517 (0%)

Query: 4   MASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRSERR 63
           MA+IG LKVP S S++++SS+S     +++ + L+F+SS LSGDKIF+ +    R S R 
Sbjct: 1   MAAIGVLKVPPSSSSSSSSSSS-----KAIARNLSFTSSHLSGDKIFTLSGRTRRTSGRN 55

Query: 64  PIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRL 123
           P +VSP+AVSDSKNSQTCLDP+ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRL
Sbjct: 56  PFIVSPKAVSDSKNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRL 115

Query: 124 IDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENP 183
           IDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASN+GGYKNEGFVEVLAAQQSPENP
Sbjct: 116 IDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNLGGYKNEGFVEVLAAQQSPENP 175

Query: 184 NWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMD 243
           NWFQGTADAVRQYLWLFEEHNVLE+LVLAGDHLYRMDYERFIQAHRE+DADITVAALPMD
Sbjct: 176 NWFQGTADAVRQYLWLFEEHNVLEYLVLAGDHLYRMDYERFIQAHRESDADITVAALPMD 235

Query: 244 EKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYV 303
           E RATAFGLMKIDEEGRIIEFSE PKGEQLKAMKVDTTILGLDD+RAKEMPYIASMGIYV
Sbjct: 236 EARATAFGLMKIDEEGRIIEFSENPKGEQLKAMKVDTTILGLDDDRAKEMPYIASMGIYV 295

Query: 304 ISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGI 363
           +SK VML+LLRDKFPGANDFGSEVIPGAT +GMRVQAYLYDGYWEDIGTIEAFYNANLGI
Sbjct: 296 VSKHVMLDLLRDKFPGANDFGSEVIPGATELGMRVQAYLYDGYWEDIGTIEAFYNANLGI 355

Query: 364 TKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSC 423
           TKKP+PDFSFYDRS+PIYTQPRYLPPSKMLDAD+TDSVIGEGCVIKNCKIHHSVVGLRSC
Sbjct: 356 TKKPVPDFSFYDRSSPIYTQPRYLPPSKMLDADITDSVIGEGCVIKNCKIHHSVVGLRSC 415

Query: 424 ISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKI 483
           ISEGAIIEDTLLMGADYYETDADRRFLAAKG VPIGIGKNSHI+RAIIDKNARIGD+VKI
Sbjct: 416 ISEGAIIEDTLLMGADYYETDADRRFLAAKGGVPIGIGKNSHIRRAIIDKNARIGDDVKI 475

Query: 484 VNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII 520
           +NSD+VQEAARET+GYFIKSGIVT+IKDALIPSGT+I
Sbjct: 476 INSDNVQEAARETEGYFIKSGIVTVIKDALIPSGTVI 512




This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP-glucose from Glc-1-P and ATP.
Vicia faba (taxid: 3906)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 2EC: 7
>sp|Q9M462|GLGS_BRANA Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Brassica napus GN=AGPS1 PE=2 SV=1 Back     alignment and function description
>sp|P23509|GLGS_SOLTU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Solanum tuberosum PE=1 SV=2 Back     alignment and function description
>sp|Q42882|GLGS_SOLLC Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|P55228|GLGS_ARATH Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Arabidopsis thaliana GN=APS1 PE=2 SV=2 Back     alignment and function description
>sp|P52416|GLGS1_VICFA Glucose-1-phosphate adenylyltransferase small subunit 1, chloroplastic OS=Vicia faba GN=AGPC PE=2 SV=1 Back     alignment and function description
>sp|P55232|GLGS_BETVU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic (Fragment) OS=Beta vulgaris GN=AGPB1 PE=2 SV=1 Back     alignment and function description
>sp|P15280|GLGS_ORYSJ Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=AGPS PE=2 SV=4 Back     alignment and function description
>sp|P55238|GLGS_HORVU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description
>sp|P30523|GLGS_WHEAT Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Triticum aestivum GN=AGP-S PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
111660950520 ADP-glucose pyrophosphorylase small subu 1.0 1.0 0.998 0.0
5917789515 ADP-glucose pyrophosphorylase small subu 0.990 1.0 0.957 0.0
356501685515 PREDICTED: glucose-1-phosphate adenylylt 0.990 1.0 0.890 0.0
356501687516 PREDICTED: glucose-1-phosphate adenylylt 0.990 0.998 0.888 0.0
89089752520 ADP-glucose pyrophosphorylase small subu 0.992 0.992 0.896 0.0
1237080516 ADP-glucose pyrophosphorylase [Pisum sat 0.990 0.998 0.892 0.0
7671230523 ADP-glucose pyrophosphorylase catalytic 0.990 0.984 0.859 0.0
260751192515 ADP-glucose pyrophosphorylase small subu 0.990 1.0 0.888 0.0
357462397514 Glucose-1-phosphate adenylyltransferase 0.984 0.996 0.892 0.0
388512925520 unknown [Lotus japonicus] 0.994 0.994 0.883 0.0
>gi|111660950|gb|ABH12112.1| ADP-glucose pyrophosphorylase small subunit [Citrus sinensis] Back     alignment and taxonomy information
 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/520 (99%), Positives = 520/520 (100%)

Query: 1   MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRS 60
           MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRS
Sbjct: 1   MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRS 60

Query: 61  ERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGAN 120
           ERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGAN
Sbjct: 61  ERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGAN 120

Query: 121 YRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSP 180
           YRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSP
Sbjct: 121 YRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSP 180

Query: 181 ENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAAL 240
           ENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAAL
Sbjct: 181 ENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAAL 240

Query: 241 PMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMG 300
           PMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMG
Sbjct: 241 PMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMG 300

Query: 301 IYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNAN 360
           IYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNAN
Sbjct: 301 IYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNAN 360

Query: 361 LGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGL 420
           LGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGL
Sbjct: 361 LGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGL 420

Query: 421 RSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDN 480
           RSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDK+ARIGDN
Sbjct: 421 RSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKDARIGDN 480

Query: 481 VKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII 520
           VKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII
Sbjct: 481 VKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII 520




Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|5917789|gb|AAD56041.1|AF184597_1 ADP-glucose pyrophosphorylase small subunit [Citrus unshiu] Back     alignment and taxonomy information
>gi|356501685|ref|XP_003519654.1| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356501687|ref|XP_003519655.1| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|89089752|gb|ABD60582.1| ADP-glucose pyrophosphorylase small subunit [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|1237080|emb|CAA65539.1| ADP-glucose pyrophosphorylase [Pisum sativum] Back     alignment and taxonomy information
>gi|7671230|gb|AAF66434.1|AF249915_1 ADP-glucose pyrophosphorylase catalytic subunit [Perilla frutescens] Back     alignment and taxonomy information
>gi|260751192|gb|ACX48912.1| ADP-glucose pyrophosphorylase small subunit S1 isoform [Lens culinaris] Back     alignment and taxonomy information
>gi|357462397|ref|XP_003601480.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula] gi|355490528|gb|AES71731.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388512925|gb|AFK44524.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2IUY3GLGC_NOSP72, ., 7, ., 7, ., 2, 70.65580.82300.9976yesno
A5GLA9GLGC_SYNPW2, ., 7, ., 7, ., 2, 70.61660.82690.9976yesno
P55228GLGS_ARATH2, ., 7, ., 7, ., 2, 70.85330.99030.9903yesno
B1XLF1GLGC_SYNP22, ., 7, ., 7, ., 2, 70.64760.79800.9673yesno
P55242GLGL2_SOLTU2, ., 7, ., 7, ., 2, 70.50290.91340.9152N/Ano
P55243GLGL3_SOLTU2, ., 7, ., 7, ., 2, 70.58630.83070.8944N/Ano
P52416GLGS1_VICFA2, ., 7, ., 7, ., 2, 70.90560.91340.9350N/Ano
P52417GLGS2_VICFA2, ., 7, ., 7, ., 2, 70.88580.98461.0N/Ano
P52415GLGC_SYNY32, ., 7, ., 7, ., 2, 70.65350.82300.9749N/Ano
B1WT08GLGC_CYAA52, ., 7, ., 7, ., 2, 70.64200.82300.9976yesno
Q3MBJ4GLGC_ANAVT2, ., 7, ., 7, ., 2, 70.65810.82300.9976yesno
Q42882GLGS_SOLLC2, ., 7, ., 7, ., 2, 70.86750.98840.9865N/Ano
Q9M462GLGS_BRANA2, ., 7, ., 7, ., 2, 70.87000.97880.9788N/Ano
P15280GLGS_ORYSJ2, ., 7, ., 7, ., 2, 70.90630.88260.8929yesno
P12299GLGL2_WHEAT2, ., 7, ., 7, ., 2, 70.50680.81920.8160N/Ano
P55233GLGL1_BETVU2, ., 7, ., 7, ., 2, 70.53370.86340.8601N/Ano
P55232GLGS_BETVU2, ., 7, ., 7, ., 2, 70.90580.89030.9468N/Ano
B8HM61GLGC_CYAP42, ., 7, ., 7, ., 2, 70.60270.82300.9976yesno
Q5N3K9GLGC_SYNP62, ., 7, ., 7, ., 2, 70.63510.8250.9976yesno
Q00081GLGL1_SOLTU2, ., 7, ., 7, ., 2, 70.53650.82690.9148N/Ano
P30524GLGL1_HORVU2, ., 7, ., 7, ., 2, 70.50910.81920.8145N/Ano
P55238GLGS_HORVU2, ., 7, ., 7, ., 2, 70.90490.89030.9025N/Ano
B7KDB8GLGC_CYAP72, ., 7, ., 7, ., 2, 70.64430.82300.9976yesno
P30523GLGS_WHEAT2, ., 7, ., 7, ., 2, 70.89910.85760.9429N/Ano
P30521GLGC_NOSS12, ., 7, ., 7, ., 2, 70.65810.82300.9976yesno
P23509GLGS_SOLTU2, ., 7, ., 7, ., 2, 70.87710.98840.9865N/Ano
B7K5U7GLGC_CYAP82, ., 7, ., 7, ., 2, 70.61660.82300.9976yesno
Q31QN4GLGC_SYNE72, ., 7, ., 7, ., 2, 70.63510.8250.9976yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.998
4th Layer2.7.7.270.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
PLN02241436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 0.0
PRK02862429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 0.0
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 1e-170
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 1e-154
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 1e-117
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 1e-117
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 7e-97
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 2e-86
cd02508200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory 4e-79
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 1e-42
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 1e-38
TIGR02092369 TIGR02092, glgD, glucose-1-phosphate adenylyltrans 4e-33
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 2e-32
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 1e-22
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 1e-22
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 6e-17
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 1e-15
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 4e-15
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 4e-15
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 5e-13
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 2e-11
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 7e-11
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short f 7e-09
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 9e-09
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 3e-08
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 7e-08
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 6e-07
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 1e-06
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 2e-06
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 2e-06
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 3e-06
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltra 7e-06
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 3e-05
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 4e-05
COG1213239 COG1213, COG1213, Predicted sugar nucleotidyltrans 2e-04
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 3e-04
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 3e-04
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 3e-04
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 6e-04
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 0.002
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 0.002
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 0.002
pfam12804178 pfam12804, NTP_transf_3, MobA-like NTP transferase 0.003
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 0.003
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
 Score =  857 bits (2216), Expect = 0.0
 Identities = 304/437 (69%), Positives = 357/437 (81%), Gaps = 4/437 (0%)

Query: 87  SRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFN 146
            +SV  IILGGGAGTRL+PLTK+RAKPAVP+G NYRLIDIP+SNC+NS I+KIYVLTQFN
Sbjct: 1   PKSVAAIILGGGAGTRLFPLTKRRAKPAVPIGGNYRLIDIPMSNCINSGINKIYVLTQFN 60

Query: 147 SASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEH--- 203
           SASLNRHLSRAY    GG   +GFVEVLAA Q+P    WFQGTADAVRQ+LWLFE+    
Sbjct: 61  SASLNRHLSRAYNFGNGGNFGDGFVEVLAATQTPGEKGWFQGTADAVRQFLWLFEDAKNK 120

Query: 204 NVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIE 263
           NV E L+L+GDHLYRMDY  F+Q HRE+ ADIT+A LP+DE RA+ FGLMKID+ GRIIE
Sbjct: 121 NVEEVLILSGDHLYRMDYMDFVQKHRESGADITIACLPVDESRASDFGLMKIDDTGRIIE 180

Query: 264 FSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDF 323
           FSEKPKG++LKAM+VDTT+LGL  E AKE PYIASMGIYV  KDV+L LLR +FP ANDF
Sbjct: 181 FSEKPKGDELKAMQVDTTVLGLSPEEAKEKPYIASMGIYVFKKDVLLKLLRWRFPTANDF 240

Query: 324 GSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQ 383
           GSE+IPGA   G  VQAYL+DGYWEDIGTI++FY ANL +TK+P P FSFYD  APIYT 
Sbjct: 241 GSEIIPGAIKEGYNVQAYLFDGYWEDIGTIKSFYEANLALTKQP-PKFSFYDPDAPIYTS 299

Query: 384 PRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYET 443
           PR+LPPSK+ D  +TDS+I  GC ++ CKI HSVVGLRS I EG  IEDT++MGADYYET
Sbjct: 300 PRFLPPSKIEDCRITDSIISHGCFLRECKIEHSVVGLRSRIGEGVEIEDTVMMGADYYET 359

Query: 444 DADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKS 503
           + +   L A+G VPIGIG+N+ I+ AIIDKNARIG NV I+N D VQEA RE +GY+I+S
Sbjct: 360 EEEIASLLAEGKVPIGIGENTKIRNAIIDKNARIGKNVVIINKDGVQEADREEEGYYIRS 419

Query: 504 GIVTIIKDALIPSGTII 520
           GIV I+K+A+IP GT+I
Sbjct: 420 GIVVILKNAVIPDGTVI 436


Length = 436

>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 520
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1461 673 consensus Translation initiation factor 2B, epsilo 100.0
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 100.0
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1462433 consensus Translation initiation factor 2B, gamma 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 100.0
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 100.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 100.0
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 100.0
PRK10122297 GalU regulator GalF; Provisional 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 100.0
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 100.0
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 100.0
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 100.0
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 100.0
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 100.0
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 100.0
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 100.0
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 100.0
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 100.0
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 100.0
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.98
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.98
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.97
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.97
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.97
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.96
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.96
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.96
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.95
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.94
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.93
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.92
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.92
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.91
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.89
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.88
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.87
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.86
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.85
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 99.77
PLN02917293 CMP-KDO synthetase 99.76
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.68
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.67
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 99.67
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.65
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.65
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.58
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.58
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.58
TIGR00454183 conserved hypothetical protein TIGR00454. At this 99.56
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 99.55
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.54
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.52
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.52
COG2068199 Uncharacterized MobA-related protein [General func 99.5
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.48
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.48
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.48
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.47
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.47
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 99.46
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 99.46
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.43
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.43
COG1043260 LpxA Acyl-[acyl carrier protein] 99.43
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.42
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 99.41
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 99.4
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 99.39
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.38
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.37
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.36
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.36
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 99.34
cd02503181 MobA MobA catalyzes the formation of molybdopterin 99.34
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.34
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.34
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 99.34
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.33
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.32
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.32
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.3
PF01128221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.29
PRK05289 262 UDP-N-acetylglucosamine acyltransferase; Provision 99.29
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 99.29
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.28
PLN02296269 carbonate dehydratase 99.28
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 99.27
PRK12461 255 UDP-N-acetylglucosamine acyltransferase; Provision 99.27
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.26
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.25
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.25
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 99.25
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.23
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.23
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.22
PRK13627196 carnitine operon protein CaiE; Provisional 99.22
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 99.22
PLN02472246 uncharacterized protein 99.21
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.21
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.16
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.15
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.15
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 99.14
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 99.14
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.12
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.12
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.11
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.11
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.1
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.1
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.1
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.1
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.08
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.08
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.07
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.07
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.07
PRK13627196 carnitine operon protein CaiE; Provisional 99.06
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.05
PLN02296269 carbonate dehydratase 99.04
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.03
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.03
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.03
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.02
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 99.02
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 98.99
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 98.99
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 98.98
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 98.98
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 98.97
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 98.97
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 98.96
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 98.95
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 98.95
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 98.95
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 98.95
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 98.94
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 98.94
PLN02472246 uncharacterized protein 98.94
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 98.94
COG1043 260 LpxA Acyl-[acyl carrier protein] 98.93
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 98.92
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 98.91
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 98.91
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.9
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 98.89
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 98.88
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 98.88
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 98.88
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 98.87
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 98.86
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 98.82
KOG1462433 consensus Translation initiation factor 2B, gamma 98.79
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 98.74
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.73
PLN02694294 serine O-acetyltransferase 98.73
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 98.7
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 98.68
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 98.67
PTZ00339482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.67
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 98.66
PRK10502182 putative acyl transferase; Provisional 98.65
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 98.65
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 98.63
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.63
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.6
PRK11132273 cysE serine acetyltransferase; Provisional 98.56
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.54
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.53
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.52
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 98.51
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.5
PLN02357360 serine acetyltransferase 98.5
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.49
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.49
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.48
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.48
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 98.48
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.46
PRK10092183 maltose O-acetyltransferase; Provisional 98.46
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.46
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.46
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.44
PLN02739355 serine acetyltransferase 98.43
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.42
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.42
PRK11132273 cysE serine acetyltransferase; Provisional 98.41
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.39
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.39
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.33
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthes 98.33
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.33
PLN02241436 glucose-1-phosphate adenylyltransferase 98.33
PRK10502182 putative acyl transferase; Provisional 98.3
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 98.29
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.29
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.28
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.27
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 98.25
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.23
PLN02694294 serine O-acetyltransferase 98.23
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.22
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.19
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.18
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.18
PRK10191146 putative acyl transferase; Provisional 98.18
PRK10191146 putative acyl transferase; Provisional 98.17
PRK10092183 maltose O-acetyltransferase; Provisional 98.11
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 98.05
COG1861241 SpsF Spore coat polysaccharide biosynthesis protei 98.03
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.02
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 98.02
PLN02357360 serine acetyltransferase 98.02
PF01704420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 98.01
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 97.99
PLN02739355 serine acetyltransferase 97.99
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 97.95
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 97.88
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 97.86
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.76
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.71
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 97.7
PLN02435493 probable UDP-N-acetylglucosamine pyrophosphorylase 97.65
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 97.61
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 97.6
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transp 97.57
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.57
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 97.53
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 97.37
PLN02830615 UDP-sugar pyrophosphorylase 97.32
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 97.2
KOG2638498 consensus UDP-glucose pyrophosphorylase [Carbohydr 97.17
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.14
COG4801 277 Predicted acyltransferase [General function predic 97.06
COG4801 277 Predicted acyltransferase [General function predic 97.01
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.0
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 96.96
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 96.92
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 96.59
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 96.27
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 95.85
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 95.26
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 95.17
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 93.13
COG1920210 Predicted nucleotidyltransferase, CobY/MobA/RfbA f 91.35
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 91.33
cd06442224 DPM1_like DPM1_like represents putative enzymes si 88.36
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 87.61
cd04188211 DPG_synthase DPG_synthase is involved in protein N 86.66
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 86.31
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 84.0
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 83.89
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 82.21
cd06423180 CESA_like CESA_like is the cellulose synthase supe 80.21
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=7.4e-70  Score=544.61  Aligned_cols=386  Identities=42%  Similarity=0.757  Sum_probs=351.4

Q ss_pred             ccceEEEEEeCCCCCCCCccccCCCccceecCCccchhHHHHHHhHhCCCCeEEEEeccChhHHHHHHHHhhhccCCCCc
Q 010006           87 SRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYK  166 (520)
Q Consensus        87 ~~~~~aIILAaG~GtRl~PlT~~~pK~Llpv~G~~plI~~~l~~l~~~gi~~I~Iv~~~~~~~i~~~l~~~~~~~~~~~~  166 (520)
                      ++++.|+|||||.|+||.|||+.++||.+|++|+|+|||++|+||.++||++|.|+++|+..+|.+||+.+++|.++  .
T Consensus         3 ~~~~laiILaGg~G~rL~~LT~~RakpAVpFgGkYRiIDF~LSN~vNSGi~~I~VltQy~~~SL~~Hi~~G~~w~l~--~   80 (393)
T COG0448           3 KKNVLAIILAGGRGSRLSPLTKDRAKPAVPFGGKYRIIDFALSNCVNSGIRRIGVLTQYKSHSLNDHIGRGWPWDLD--R   80 (393)
T ss_pred             ccceEEEEEcCCCCCccchhhhCccccccccCceeEEEeEEcccccccCCCeEEEEeccchhHHHHHhhCCCccccc--c
Confidence            56799999999999999999999999999999999999999999999999999999999999999999999999654  3


Q ss_pred             CCCeEEEeecccCCCCCCCccCcHHHHHHHHHHhhhcCcceEEEEeCceeccccHHHHHHHHHhcCCcEEEEEEecCccc
Q 010006          167 NEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKR  246 (520)
Q Consensus       167 ~~~~v~vl~~~~~~~~~~~~~Gt~~al~~~~~~l~~~~~~~~Lvl~gD~l~~~dl~~ll~~h~~~~a~~tl~~~~~~~~~  246 (520)
                      ..+++.++++++...++.|+.||++++++-++++++...+.+|+++||++|++|+.++++.|.++++++|+++.+++.++
T Consensus        81 ~~~~v~ilp~~~~~~~~~wy~Gtadai~Qnl~~i~~~~~eyvlIlsgDhIYkmDy~~ml~~H~~~gadiTv~~~~Vp~~e  160 (393)
T COG0448          81 KNGGVFILPAQQREGGERWYEGTADAIYQNLLIIRRSDPEYVLILSGDHIYKMDYSDMLDFHIESGADVTVAVKEVPREE  160 (393)
T ss_pred             ccCcEEEeCchhccCCCcceeccHHHHHHhHHHHHhcCCCEEEEecCCEEEecCHHHHHHHHHHcCCCEEEEEEECChHh
Confidence            34668899888765667799999999999999999888899999999999999999999999999999999999999999


Q ss_pred             CcceEEEEeCCCCCEEEeeeCCChhhhhhcccccccccCCchhhccCCceeeeeEEEEeHHHHHHHHhhhCC---CCCCc
Q 010006          247 ATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFP---GANDF  323 (520)
Q Consensus       247 ~~~~g~v~~d~~g~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~GIyifs~~vl~~ll~~~~~---~~~~~  323 (520)
                      ++.||++.+|++++|++|.|||.....                   ...+++||+|+|++++|.++|++...   +..||
T Consensus       161 as~fGim~~D~~~~i~~F~eKp~~~~~-------------------~~~laSMgiYIf~~~~L~~~L~~~~~~~~~~~Df  221 (393)
T COG0448         161 ASRFGVMNVDENGRIIEFVEKPADGPP-------------------SNSLASMGIYIFNTDLLKELLEEDAKDPNSSHDF  221 (393)
T ss_pred             hhhcCceEECCCCCEEeeeeccCcCCc-------------------ccceeeeeeEEEcHHHHHHHHHHHhcccCccccc
Confidence            999999999999999999999997211                   12279999999999999999986543   45789


Q ss_pred             cccchHhhhhCCceEEEEEecceEEeCCCHHHHHHhhhhcccCCCCCCccccCCCccccCCCcCCCceee-cccccceEE
Q 010006          324 GSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKML-DADVTDSVI  402 (520)
Q Consensus       324 ~~dil~~li~~~~~v~a~~~~g~w~dI~t~~dy~~An~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~i~-~~~i~~~~I  402 (520)
                      +.++||.+++++ +++||+++|||.||+|+++|++||+.++... |.+.+++++++|++.....||+++. ++.+.+|.|
T Consensus       222 gkdiIp~~~~~~-~v~AY~f~gYw~dVgTi~syy~aNmdLl~~~-~~~~lyd~~w~IyT~~~~~pPak~~~~s~v~nSLv  299 (393)
T COG0448         222 GKDIIPKLLERG-KVYAYEFSGYWRDVGTIDSYYEANMDLLSPQ-PELNLYDRNWPIYTKNKNLPPAKFVNDSEVSNSLV  299 (393)
T ss_pred             hHHHHHHHHhcC-CEEEEeccchhhhcccHHHHHHhhHHhcCCC-CcccccCCCCceeecCCCCCCceEecCceEeeeee
Confidence            999999999955 5999999999999999999999999999844 7788999999999999999999997 566799999


Q ss_pred             CCCcEEeeeEEeeeEECCCCEECCCCEEcccEEECCccccccccccccccCCCcceeeCCCCEEcceEECCCCEECCCcE
Q 010006          403 GEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVK  482 (520)
Q Consensus       403 g~g~~I~~~~i~~s~Ig~~~~Ig~~~~I~~~~i~~~~~~~~~~~~~~~~~~~~~~~~Ig~~~~i~~~ii~~~~~Ig~~~~  482 (520)
                      +.||+|.+ .|.||+|+.+++|+++|.|++|++|++                   +.||+||+|++|||++||.|++|++
T Consensus       300 ~~GciI~G-~V~nSVL~~~v~I~~gs~i~~svim~~-------------------~~IG~~~~l~~aIIDk~v~I~~g~~  359 (393)
T COG0448         300 AGGCIISG-TVENSVLFRGVRIGKGSVIENSVIMPD-------------------VEIGEGAVLRRAIIDKNVVIGEGVV  359 (393)
T ss_pred             eCCeEEEe-EEEeeEEecCeEECCCCEEEeeEEeCC-------------------cEECCCCEEEEEEeCCCcEeCCCcE
Confidence            99999999 889999999999999999999999997                   6999999999999999999999999


Q ss_pred             EecCCCcCCcccccCCeEEccCeEEEcCCCEeCCCcc
Q 010006          483 IVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTI  519 (520)
Q Consensus       483 i~~~~~v~~~~~~~~~~~I~~~~v~Ig~~~~i~~gtv  519 (520)
                      |.+..  ++..+.. +.+. +++++|+++++++.+.+
T Consensus       360 i~~~~--~~~d~~~-~~~~-~~ivVv~k~~~~~~~~~  392 (393)
T COG0448         360 IGGDK--PEEDRKR-FRSE-EGIVVVPKGMVIKLDIM  392 (393)
T ss_pred             EcCCc--chhcccc-cccc-CCcEEEecccEeccccc
Confidence            98755  5666655 6666 88899999999987754



>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>KOG2638 consensus UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>COG1920 Predicted nucleotidyltransferase, CobY/MobA/RfbA family [General function prediction only] Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
1yp2_A451 Crystal Structure Of Potato Tuber Adp-Glucose Pyrop 0.0
3brk_X420 Crystal Structure Of Adp-Glucose Pyrophosphorylase 6e-50
4arw_A302 Pseudomonas Aeruginosa Rmla In Complex With Alloste 3e-06
4b2x_A303 Pseudomonas Aeruginosa Rmla In Complex With Alloste 3e-06
1fxo_A293 The Structural Basis Of The Catalytic Mechanism And 3e-06
1lvw_A295 Crystal Structure Of Glucose-1-phosphate Thymidylyl 1e-05
1g23_A293 The Structural Basis Of The Catalytic Mechanism And 2e-05
1h5s_D293 Thymidylyltransferase Complexed With Tmp Length = 2 4e-05
1iim_A292 Thymidylyltransferase Complexed With Ttp Length = 2 6e-05
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 7e-05
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 8e-05
3hl3_A269 2.76 Angstrom Crystal Structure Of A Putative Gluco 8e-05
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 8e-05
1mp3_A292 L89t Variant Of S. Enterica Rmla Length = 292 8e-05
1mp5_A292 Y177f Variant Of S. Enterica Rmla Length = 292 9e-05
1mp4_A292 W224h Variant Of S. Enterica Rmla Length = 292 9e-05
3pkp_A292 Q83s Variant Of S. Enterica Rmla With Datp Length = 1e-04
3pkq_A292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 1e-04
>pdb|1YP2|A Chain A, Crystal Structure Of Potato Tuber Adp-Glucose Pyrophosphorylase Length = 451 Back     alignment and structure

Iteration: 1

Score = 877 bits (2265), Expect = 0.0, Method: Compositional matrix adjust. Identities = 427/450 (94%), Positives = 445/450 (98%) Query: 71 AVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN 130 AVSDS+NSQTCLDP+ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN Sbjct: 2 AVSDSQNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN 61 Query: 131 CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTA 190 CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENP+WFQGTA Sbjct: 62 CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTA 121 Query: 191 DAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAF 250 DAVRQYLWLFEEH VLE+L+LAGDHLYRMDYE+FIQAHRETDADITVAALPMDEKRATAF Sbjct: 122 DAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAF 181 Query: 251 GLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVML 310 GLMKIDEEGRIIEF+EKP+GEQL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVML Sbjct: 182 GLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVML 241 Query: 311 NLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPD 370 NLLRDKFPGANDFGSEVIPGATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PD Sbjct: 242 NLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPD 301 Query: 371 FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII 430 FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII Sbjct: 302 FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII 361 Query: 431 EDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQ 490 ED+LLMGADYYETDADR+ LAAKGSVPIGIGKN HIKRAIIDKNARIGDNVKI+N D+VQ Sbjct: 362 EDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQ 421 Query: 491 EAARETDGYFIKSGIVTIIKDALIPSGTII 520 EAARETDGYFIKSGIVT+IKDALIPSG II Sbjct: 422 EAARETDGYFIKSGIVTVIKDALIPSGIII 451
>pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420 Back     alignment and structure
>pdb|4ARW|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 302 Back     alignment and structure
>pdb|4B2X|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 303 Back     alignment and structure
>pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293 Back     alignment and structure
>pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure
>pdb|1G23|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Glucose-1-Phosphate Complex. Length = 293 Back     alignment and structure
>pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|3HL3|A Chain A, 2.76 Angstrom Crystal Structure Of A Putative Glucose-1-Phosphate Thymidylyltransferase From Bacillus Anthracis In Complex With A Sucrose. Length = 269 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
>pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 0.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 0.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 5e-21
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 3e-19
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 8e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 6e-10
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 7e-07
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 5e-06
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 1e-05
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 1e-05
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 2e-05
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 2e-05
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 4e-05
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 3e-04
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 5e-05
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 8e-05
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 1e-04
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 1e-04
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 1e-04
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 1e-04
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
 Score =  736 bits (1902), Expect = 0.0
 Identities = 427/450 (94%), Positives = 445/450 (98%)

Query: 71  AVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN 130
           AVSDS+NSQTCLDP+ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN
Sbjct: 2   AVSDSQNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSN 61

Query: 131 CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTA 190
           CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENP+WFQGTA
Sbjct: 62  CLNSNISKIYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTA 121

Query: 191 DAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAF 250
           DAVRQYLWLFEEH VLE+L+LAGDHLYRMDYE+FIQAHRETDADITVAALPMDEKRATAF
Sbjct: 122 DAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAF 181

Query: 251 GLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVML 310
           GLMKIDEEGRIIEF+EKP+GEQL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVML
Sbjct: 182 GLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVML 241

Query: 311 NLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPD 370
           NLLRDKFPGANDFGSEVIPGATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PD
Sbjct: 242 NLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPD 301

Query: 371 FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII 430
           FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII
Sbjct: 302 FSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAII 361

Query: 431 EDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQ 490
           ED+LLMGADYYETDADR+ LAAKGSVPIGIGKN HIKRAIIDKNARIGDNVKI+N D+VQ
Sbjct: 362 EDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQ 421

Query: 491 EAARETDGYFIKSGIVTIIKDALIPSGTII 520
           EAARETDGYFIKSGIVT+IKDALIPSG II
Sbjct: 422 EAARETDGYFIKSGIVTVIKDALIPSGIII 451


>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Length = 269 Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Length = 295 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Length = 293 Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Length = 296 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 100.0
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 100.0
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.98
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.98
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.97
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.97
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.97
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.97
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.97
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.97
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.96
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.96
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.95
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.95
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.94
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.93
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.92
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.91
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.89
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.89
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.89
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.87
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.87
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.86
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.85
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.84
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.82
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.82
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.82
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.81
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.79
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.77
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.77
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 99.73
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.72
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.72
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 99.71
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 99.71
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 99.71
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 99.7
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.69
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.62
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 99.61
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 99.57
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.56
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.52
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.52
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.52
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.52
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.51
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.51
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.5
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.49
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.48
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.47
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 99.46
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 99.44
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.44
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.43
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.43
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.42
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.41
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.4
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.4
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.4
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.39
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.39
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.37
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.37
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.37
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.36
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.35
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.35
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.35
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.35
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.34
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.34
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.33
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.33
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 99.33
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.32
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.32
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.32
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.31
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.3
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.28
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 99.28
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.27
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.27
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.26
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.26
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.24
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.22
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.21
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.2
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.2
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.2
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.19
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.18
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.18
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.15
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.15
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.14
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.13
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.11
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.1
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.1
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.07
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.05
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.04
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.02
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.01
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.0
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 98.96
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 98.96
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 98.9
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 98.9
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 98.88
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 98.87
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.87
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 98.85
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 98.83
4hur_A220 Virginiamycin A acetyltransferase; structural geno 98.81
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 98.8
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 98.8
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 98.8
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.78
3srt_A188 Maltose O-acetyltransferase; structural genomics, 98.77
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 98.76
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 98.74
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 98.72
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 98.7
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 98.69
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 98.68
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 98.67
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 98.66
4hur_A220 Virginiamycin A acetyltransferase; structural geno 98.65
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.61
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.61
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.61
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 98.6
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.6
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 98.59
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.54
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.54
3srt_A188 Maltose O-acetyltransferase; structural genomics, 98.53
3r3i_A528 UTP--glucose-1-phosphate uridylyltransferase; ross 98.53
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.52
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.51
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.5
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.47
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.46
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.42
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.39
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.28
3gue_A484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 98.25
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.21
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.14
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.13
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.13
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.04
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 97.93
3ogz_A630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 97.26
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 96.41
3cgx_A242 Putative nucleotide-diphospho-sugar transferase; Y 87.56
3bcv_A240 Putative glycosyltransferase protein; protein stru 86.39
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 81.11
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-62  Score=520.55  Aligned_cols=448  Identities=95%  Similarity=1.445  Sum_probs=366.5

Q ss_pred             cCCCCCCCCCCcccccceEEEEEeCCCCCCCCccccCCCccceecCCccchhHHHHHHhHhCCCCeEEEEeccChhHHHH
Q 010006           73 SDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNR  152 (520)
Q Consensus        73 ~~~~~~~~~~~~~~~~~~~aIILAaG~GtRl~PlT~~~pK~Llpv~G~~plI~~~l~~l~~~gi~~I~Iv~~~~~~~i~~  152 (520)
                      ++++...++.++..|++|+|||||||.||||+|||..+||+|+|++|++|||+|++++|.++|+++|+|+++++.+++.+
T Consensus         4 ~~~~~~~~~~~~~~~~~~~avILAaG~gtRl~plT~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~~~i~~   83 (451)
T 1yp2_A            4 SDSQNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNR   83 (451)
T ss_dssp             ------CCCCSSCHHHHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHH
T ss_pred             ccccccceecCcccccceEEEEECCCCCCcccchhcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCHHHHHH
Confidence            34455566777777888999999999999999999999999999998669999999999999999999999999999999


Q ss_pred             HHHHhhhccCCCCcCCCeEEEeecccCCCCCCCccCcHHHHHHHHHHhhhcCcceEEEEeCceeccccHHHHHHHHHhcC
Q 010006          153 HLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETD  232 (520)
Q Consensus       153 ~l~~~~~~~~~~~~~~~~v~vl~~~~~~~~~~~~~Gt~~al~~~~~~l~~~~~~~~Lvl~gD~l~~~dl~~ll~~h~~~~  232 (520)
                      |+.+.+...++..+....++++...+.+.+++|..|++++|+.++.+++....++||+++||++++.++.++++.|++.+
T Consensus        84 ~~~~~~~~~~~~~~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~  163 (451)
T 1yp2_A           84 HLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETD  163 (451)
T ss_dssp             HHHHHCC--------CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTT
T ss_pred             HHhhhhhcccccccccCcEEEecccccccccccccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHcC
Confidence            99864310111000223356665555555677889999999999988864335799999999999999999999999989


Q ss_pred             CcEEEEEEecCcccCcceEEEEeCCCCCEEEeeeCCChhhhhhcccccccccCCchhhccCCceeeeeEEEEeHHHHHHH
Q 010006          233 ADITVAALPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNL  312 (520)
Q Consensus       233 a~~tl~~~~~~~~~~~~~g~v~~d~~g~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~GIyifs~~vl~~l  312 (520)
                      +++|+++.+...+++..||++.+|++++|..|.|||.......+.++.++++..+......++++++|+|+|++++|.++
T Consensus       164 ~~~tl~~~~~~~~~~~~~g~v~~d~~~~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~  243 (451)
T 1yp2_A          164 ADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNL  243 (451)
T ss_dssp             CSEEEEEEEECHHHHTTSEEEEECTTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHH
T ss_pred             CcEEEEEEEcChhhcccCCEEEECCCCCEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHH
Confidence            99999888875445678999999988999999999997766667777777765544333456799999999999998778


Q ss_pred             HhhhCCCCCCccccchHhhhhCCceEEEEEecceEEeCCCHHHHHHhhhhcccCCCCCCccccCCCccccCCCcCCCcee
Q 010006          313 LRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKM  392 (520)
Q Consensus       313 l~~~~~~~~~~~~dil~~li~~~~~v~a~~~~g~w~dI~t~~dy~~An~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~i  392 (520)
                      +++.++...+|.+++|+.+++++.+++++.++++|.||+|+++|+++++.++....+...++++.+++++.+.+.|++.+
T Consensus       244 l~~~~~~~~~~~~~~l~~~i~~g~~v~~~~~~~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i  323 (451)
T 1yp2_A          244 LRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKM  323 (451)
T ss_dssp             HHTTCTTCCCTTTTHHHHHHHTTCCEEEEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEE
T ss_pred             HHhhcccccchHhhHHHHHHhcCCceEEEEeCCEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEE
Confidence            77655556678889999999867899999999999999999999999999887654556889999999999999999999


Q ss_pred             ecccccceEECCCcEEeeeEEeeeEECCCCEECCCCEEcccEEECCccccccccccccccCCCcceeeCCCCEEcceEEC
Q 010006          393 LDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIID  472 (520)
Q Consensus       393 ~~~~i~~~~Ig~g~~I~~~~i~~s~Ig~~~~Ig~~~~I~~~~i~~~~~~~~~~~~~~~~~~~~~~~~Ig~~~~i~~~ii~  472 (520)
                      .++.|.+++||++|+|+++.|.+++||++|.||++|+|.++++++++++++........-.|.+.+.||+++.|.+++||
T Consensus       324 ~~~~I~~~~Ig~~~~I~~~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig  403 (451)
T 1yp2_A          324 LDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIID  403 (451)
T ss_dssp             EEEEEEEEEECTTCEEEEEEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEEC
T ss_pred             cceEEeCeEECCCCEEcceEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeC
Confidence            88888899999999999888889999999999999999999999987776543322222222222589999999999999


Q ss_pred             CCCEECCCcEEecCCCcCCcccccCCeEEccCeEEEcCCCEeCCCccC
Q 010006          473 KNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII  520 (520)
Q Consensus       473 ~~~~Ig~~~~i~~~~~v~~~~~~~~~~~I~~~~v~Ig~~~~i~~gtvi  520 (520)
                      ++|.||+|++|.+++++.++.++|++++|+++.|+||++++||+||+|
T Consensus       404 ~~~~IG~~~~i~~~~~~~~~~~ig~~~~ig~~~v~Ig~~a~i~agsvv  451 (451)
T 1yp2_A          404 KNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIKDALIPSGIII  451 (451)
T ss_dssp             TTCEECTTCEECCSSCCSCEEEGGGTEEEETTEEEECTTCEECTTCBC
T ss_pred             CCcEECCCCEEeCCcccccCceeCCCEEEcCCEEEECCCcEECCCccC
Confidence            999999999999999998888999999999998899999999999987



>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 520
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 2e-97
d1yp2a1135 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt 7e-35
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 8e-31
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 2e-26
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 3e-25
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 2e-19
d2icya2378 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 1e-17
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 9e-12
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 3e-09
d2cu2a2268 c.68.1.20 (A:1-268) Putative mannose-1-phosphate g 8e-09
d2oi6a2248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 2e-06
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 0.003
d2dpwa1231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 0.004
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain
species: Potato (Solanum tuberosum) [TaxId: 4113]
 Score =  295 bits (755), Expect = 2e-97
 Identities = 294/307 (95%), Positives = 306/307 (99%)

Query: 79  QTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISK 138
           QTCLDP+ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISK
Sbjct: 1   QTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISK 60

Query: 139 IYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLW 198
           IYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENP+WFQGTADAVRQYLW
Sbjct: 61  IYVLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLW 120

Query: 199 LFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAALPMDEKRATAFGLMKIDEE 258
           LFEEH VLE+L+LAGDHLYRMDYE+FIQAHRETDADITVAALPMDEKRATAFGLMKIDEE
Sbjct: 121 LFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEE 180

Query: 259 GRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFP 318
           GRIIEF+EKP+GEQL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVMLNLLRDKFP
Sbjct: 181 GRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFP 240

Query: 319 GANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSA 378
           GANDFGSEVIPGATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSA
Sbjct: 241 GANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSA 300

Query: 379 PIYTQPR 385
           PIYTQPR
Sbjct: 301 PIYTQPR 307


>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 378 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 100.0
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 100.0
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 100.0
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.97
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.97
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.97
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.95
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.94
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.9
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.87
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.7
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.64
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.63
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.61
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.46
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.45
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.41
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 99.4
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.39
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.36
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.33
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 99.31
d2jf2a1 262 UDP N-acetylglucosamine acyltransferase {Escherich 99.28
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.2
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 99.2
d1j2za_ 259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.18
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 99.17
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.13
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.12
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.1
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.09
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.09
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 99.05
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 99.04
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.03
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 98.99
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 98.96
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 98.92
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 98.88
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 98.88
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 98.86
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 98.81
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 98.77
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.74
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 98.74
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 98.73
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 98.71
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.63
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.6
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.47
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.36
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.34
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.27
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.25
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.05
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 97.95
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 97.93
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain
species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00  E-value=1.5e-46  Score=376.91  Aligned_cols=306  Identities=96%  Similarity=1.479  Sum_probs=266.4

Q ss_pred             CCCCcccccceEEEEEeCCCCCCCCccccCCCccceecCCccchhHHHHHHhHhCCCCeEEEEeccChhHHHHHHHHhhh
Q 010006           80 TCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA  159 (520)
Q Consensus        80 ~~~~~~~~~~~~aIILAaG~GtRl~PlT~~~pK~Llpv~G~~plI~~~l~~l~~~gi~~I~Iv~~~~~~~i~~~l~~~~~  159 (520)
                      .|.+|++.+++.|||||||.||||+|||+.+|||||||+|++|||+|+|++|.++||++|+|+++++.+++.+|+.+.+.
T Consensus         2 ~~~~~~~~~~~~AIILAaG~GtRL~plT~~~PK~llpv~g~~plI~~~l~~l~~~gi~~I~Iv~~~~~~~i~~~l~~~~~   81 (307)
T d1yp2a2           2 TCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA   81 (307)
T ss_dssp             CCCSSCHHHHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHHHHHHHCC
T ss_pred             CccCCCcCCceEEEEECCCCcccCChhhcCCCcceEEECCCCCHHHHHHHHHHHcCCCEEEEEeccccccchhhhhcccc
Confidence            46778888889999999999999999999999999999987799999999999999999999999999999999999887


Q ss_pred             ccCCCCcCCCeEEEeecccCCCCCCCccCcHHHHHHHHHHhhhcCcceEEEEeCceeccccHHHHHHHHHhcCCcEEEEE
Q 010006          160 SNMGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLFEEHNVLEFLVLAGDHLYRMDYERFIQAHRETDADITVAA  239 (520)
Q Consensus       160 ~~~~~~~~~~~v~vl~~~~~~~~~~~~~Gt~~al~~~~~~l~~~~~~~~Lvl~gD~l~~~dl~~ll~~h~~~~a~~tl~~  239 (520)
                      +.++.....+..+++...+.+.+++|..|++++++.++.++++...++|++++||++++.|+..+++.|+.+++++++++
T Consensus        82 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~g~~~ai~~~~~~i~~~~~~~~iv~~~D~~~~~d~~~~~~~~~~~~~~~~~~~  161 (307)
T d1yp2a2          82 SNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAA  161 (307)
T ss_dssp             --------CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEE
T ss_pred             cccccccccccceeeceeeeccccccccchhHHHHHhHHhhhccccceEEEecCcceeccchhhhhhhhhhccccceEEE
Confidence            76655556666777777777778889999999999999999877778999999999999999999999999999999888


Q ss_pred             EecCcccCcceEEEEeCCCCCEEEeeeCCChhhhhhcccccccccCCchhhccCCceeeeeEEEEeHHHHHHHHhhhCCC
Q 010006          240 LPMDEKRATAFGLMKIDEEGRIIEFSEKPKGEQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPG  319 (520)
Q Consensus       240 ~~~~~~~~~~~g~v~~d~~g~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~GIyifs~~vl~~ll~~~~~~  319 (520)
                      .....++...||++.+|++++|..|.|||.......+..+...+.+.........++.++|+|+|++++|.++++...+.
T Consensus       162 ~~~~~~~~~~~gvv~~d~~~~v~~~~Ek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~giyi~~~~~l~~~~~~~~~~  241 (307)
T d1yp2a2         162 LPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPG  241 (307)
T ss_dssp             EEECHHHHTTSEEEEECTTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCTT
T ss_pred             EecccccccccceEEECCCCcEEEEEECCCCcccccccccccccccccchhhcccchhhCceEEECHHHHHHHhhhcccc
Confidence            87777777899999999999999999999998877778888888887776667778999999999999999888877778


Q ss_pred             CCCccccchHhhhhCCceEEEEEecceEEeCCCHHHHHHhhhhcccCCCCCCccccCCCccccCCC
Q 010006          320 ANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPR  385 (520)
Q Consensus       320 ~~~~~~dil~~li~~~~~v~a~~~~g~w~dI~t~~dy~~An~~~l~~~~~~~~~~~~~~~i~~~~~  385 (520)
                      .+++..|+++.+++++.++++++++|+|.||||+++|++||..+++...+++.|++++.+|||.++
T Consensus       242 ~~~~~~d~i~~li~~g~~v~~~~~~g~W~Digt~~~~~~a~~~ll~~~~~~~~~~~~~~~i~~~~~  307 (307)
T d1yp2a2         242 ANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPR  307 (307)
T ss_dssp             CCCTTTTHHHHHHHTTCCEEEEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCC
T ss_pred             ccchHHHHHHHHHHCCCcEEEEEeCCeEEECcCHHHHHHHHHHHhcCCCchhhccCCCCCccCCCC
Confidence            888999999999998999999999999999999999999999999988888899999999998753



>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure