Citrus Sinensis ID: 010010
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 520 | ||||||
| 357161222 | 576 | PREDICTED: vacuolar-sorting receptor 1-l | 0.951 | 0.859 | 0.707 | 0.0 | |
| 224091118 | 625 | predicted protein [Populus trichocarpa] | 0.844 | 0.702 | 0.849 | 0.0 | |
| 255575588 | 625 | Vacuolar sorting receptor 1 precursor, p | 0.842 | 0.700 | 0.850 | 0.0 | |
| 359481218 | 624 | PREDICTED: vacuolar-sorting receptor 1-l | 0.842 | 0.701 | 0.823 | 0.0 | |
| 83284015 | 621 | vacuolar sorting receptor protein PV72-l | 0.796 | 0.666 | 0.826 | 0.0 | |
| 195649637 | 575 | vacuolar sorting receptor 3 precursor [Z | 0.953 | 0.862 | 0.627 | 0.0 | |
| 7484768 | 624 | vacuolar sorting receptor protein homolo | 0.798 | 0.665 | 0.812 | 0.0 | |
| 449439799 | 624 | PREDICTED: vacuolar-sorting receptor 1-l | 0.786 | 0.655 | 0.802 | 0.0 | |
| 357146095 | 579 | PREDICTED: vacuolar-sorting receptor 3-l | 0.957 | 0.860 | 0.624 | 0.0 | |
| 218186303 | 626 | hypothetical protein OsI_37233 [Oryza sa | 0.811 | 0.674 | 0.777 | 0.0 |
| >gi|357161222|ref|XP_003579020.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 3 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Score = 823 bits (2125), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 389/550 (70%), Positives = 445/550 (80%), Gaps = 55/550 (10%)
Query: 21 GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL 80
GRFVVEKNSLKVT+P+ ++G YECAIGNFGVPQYGGT++G V YPKAN+KACK FD+ D+
Sbjct: 25 GRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI 84
Query: 81 SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA 140
S+K++PG PTFLLVDRGDC+FT KAWNAQ G AAILVADDK EPLITMDTPEE + A
Sbjct: 85 SYKAKPGSFPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEE-SGRA 143
Query: 141 EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC 200
++L+NITIPSALI+KS GD ++K+++ G+MVN+NLDW E+LPHPDERVEYEFWTNSNDEC
Sbjct: 144 DHLENITIPSALITKSFGDRLRKAVNNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC 203
Query: 201 GPKCESQIDFVKNFKGAAQILEQRGYTQFTPHYITWYCPEAFILSKQCKSQCINHGRYCA 260
GPKC+SQI+FVK+FKG AQILE++GYT+FTPHYITWYCPEAF LSKQCKSQCINHGRYCA
Sbjct: 204 GPKCDSQIEFVKSFKGPAQILEKKGYTEFTPHYITWYCPEAFTLSKQCKSQCINHGRYCA 263
Query: 261 PDPEQDFSRGYDGKDVVVQNLRQACFFKVANESRKPWLWWDYVTDFAIRCPMKEKKYTKE 320
PDPEQDFS+GYDGKDVVVQNLRQ C +KVA E +KPWLWWDYVTDFAIRCPMKEKKYTKE
Sbjct: 264 PDPEQDFSKGYDGKDVVVQNLRQVCVYKVAKEHKKPWLWWDYVTDFAIRCPMKEKKYTKE 323
Query: 321 CAEQVIKSLGVDLKKVDECVGDPEADVDNQVLKTEQDAQIGKGSRGDVTILPTLVINNRQ 380
CA+ VIKSLG+D K +D+C+GDP+AD +N VLK EQDAQIGKGSRGDVTILPTLVINNRQ
Sbjct: 324 CADGVIKSLGLDHKAIDKCIGDPDADEENPVLKAEQDAQIGKGSRGDVTILPTLVINNRQ 383
Query: 381 YRGKLDKGAVLKAICAGFQETTEPAICLS------------------------------- 409
YRGKLDKGAVLKA+CAGFQETTEPA+CLS
Sbjct: 384 YRGKLDKGAVLKALCAGFQETTEPAVCLSEDIQTNECLENNGGCWQDKAANISACKDTFR 443
Query: 410 ----------------------EDVDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQ 447
EDVDEC+EK ACQC ECKCK+TWGSYEC CG G+LYM+
Sbjct: 444 GRVCECPVVKGVKFVGDGYTHCEDVDECKEKTACQCKECKCKNTWGSYECGCGGGMLYMK 503
Query: 448 EHDTCISKDVRSEASWGFVWMVILGLAATGVAGYAFYKYRIRRYMDSEIRAIMAQYMPLD 507
EHDTCISK +A W F+W+ + LA G+AGYA YKYRIR YMDSEIRAIMAQYMPLD
Sbjct: 504 EHDTCISKSA-GQAGWNFLWVTLFALATAGLAGYAVYKYRIRSYMDSEIRAIMAQYMPLD 562
Query: 508 SQAEVQHASH 517
+Q E+ + SH
Sbjct: 563 NQGEIPNHSH 572
|
Source: Brachypodium distachyon Species: Brachypodium distachyon Genus: Brachypodium Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224091118|ref|XP_002309184.1| predicted protein [Populus trichocarpa] gi|222855160|gb|EEE92707.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255575588|ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis] gi|223531866|gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359481218|ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1-like [Vitis vinifera] gi|297735537|emb|CBI18031.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|83284015|gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|195649637|gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|7484768|pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit gi|2943792|dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri] | Back alignment and taxonomy information |
|---|
| >gi|449439799|ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus] gi|449497165|ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357146095|ref|XP_003573874.1| PREDICTED: vacuolar-sorting receptor 3-like isoform 2 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|218186303|gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 520 | ||||||
| TAIR|locus:2085136 | 623 | VSR1 "vacuolar sorting recepto | 0.838 | 0.699 | 0.756 | 1.5e-234 | |
| TAIR|locus:2046931 | 628 | VSR4 "vacuolar sorting recepto | 0.844 | 0.699 | 0.688 | 4.4e-215 | |
| TAIR|locus:2046911 | 628 | VSR3 "vaculolar sorting recept | 0.836 | 0.692 | 0.701 | 2.5e-177 | |
| TAIR|locus:2015726 | 631 | VSR6 "VACUOLAR SORTING RECEPTO | 0.848 | 0.698 | 0.560 | 9.6e-174 | |
| TAIR|locus:2044782 | 618 | VSR5 "VACUOLAR SORTING RECEPTO | 0.8 | 0.673 | 0.555 | 5.9e-161 | |
| TIGR_CMR|SO_3800 | 1215 | SO_3800 "serine protease, subt | 0.180 | 0.077 | 0.336 | 4e-06 | |
| TAIR|locus:2198733 | 536 | SPPL5 "SIGNAL PEPTIDE PEPTIDAS | 0.176 | 0.171 | 0.37 | 4.6e-05 | |
| UNIPROTKB|E2QZ01 | 381 | RNF13 "Uncharacterized protein | 0.257 | 0.351 | 0.313 | 7.2e-05 | |
| RGD|1594062 | 380 | Rnf13 "ring finger protein 13" | 0.238 | 0.326 | 0.309 | 0.00012 | |
| UNIPROTKB|O43567 | 381 | RNF13 "E3 ubiquitin-protein li | 0.213 | 0.291 | 0.322 | 0.00015 |
| TAIR|locus:2085136 VSR1 "vacuolar sorting receptor homolog 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1868 (662.6 bits), Expect = 1.5e-234, Sum P(2) = 1.5e-234
Identities = 335/443 (75%), Positives = 390/443 (88%)
Query: 4 KLGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV 63
KLG L+ L+ GRFVVEKN+LKVTSP+ IKG+YECAIGNFGVPQYGGTL+GTVV
Sbjct: 2 KLGLFTLSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV 61
Query: 64 YPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDK 123
YPK+NQKACK + + D+SFKS+PG LPTF+L+DRGDCYFTLKAW AQ+ GAAAILVAD K
Sbjct: 62 YPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSK 121
Query: 124 TEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPH 183
EPLITMDTPEE+ +DA+YLQNITIPSALI+K+LGDSIK +LSGG+MVNM LDWTE++PH
Sbjct: 122 AEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPH 181
Query: 184 PDERVEYEFWTNSNDECGPKCESQIDFVKNFKGAAQILEQRGYTQFTPHYITWYCPEAFI 243
PDERVEYE WTNSNDECG KC++QI+F+KNFKGAAQILE+ G+TQFTPHYITWYCPEAF
Sbjct: 182 PDERVEYELWTNSNDECGKKCDTQIEFLKNFKGAAQILEKGGHTQFTPHYITWYCPEAFT 241
Query: 244 LSKQCKSQCINHGRYCAPDPEQDFSRGYDGKDVVVQNLRQACFFKVANESRKPWLWWDYV 303
LSKQCKSQCINHGRYCAPDPEQDF++GYDGKDVVVQNLRQAC ++V N++ KPW+WWDYV
Sbjct: 242 LSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLRQACVYRVMNDTGKPWVWWDYV 301
Query: 304 TDFAIRCPMKEKKYTKECAEQVIKSLGVDLKKVDECVGDPEADVDNQVLKTEQDAQIGKG 363
TDFAIRCPMKEKKYTKECA+ +IKSLG+DLKKVD+C+GDPEADV+N VLK EQ++QIGKG
Sbjct: 302 TDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGDPEADVENPVLKAEQESQIGKG 361
Query: 364 SRGDVTILPTLVINNRQYRGKLDKGAVLKAICAGFQETTEPAICLSEDVD--EC-EEKLA 420
SRGDVTILPTLV+NNRQYRGKL+KGAVLKA+C+GFQE+TEPAICL+ED++ EC E
Sbjct: 362 SRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQESTEPAICLTEDLETNECLENNGG 421
Query: 421 CQCPECK----CKDTWGSYECSC 439
C + C+DT+ C C
Sbjct: 422 CWQDKAANITACRDTFRGRLCEC 444
|
|
| TAIR|locus:2046931 VSR4 "vacuolar sorting receptor 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046911 VSR3 "vaculolar sorting receptor 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015726 VSR6 "VACUOLAR SORTING RECEPTOR 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044782 VSR5 "VACUOLAR SORTING RECEPTOR 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_3800 SO_3800 "serine protease, subtilase family" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198733 SPPL5 "SIGNAL PEPTIDE PEPTIDASE-LIKE 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZ01 RNF13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1594062 Rnf13 "ring finger protein 13" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43567 RNF13 "E3 ubiquitin-protein ligase RNF13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 520 | |||
| cd02125 | 127 | cd02125, PA_VSR, PA_VSR: Protease-associated (PA) | 7e-70 | |
| cd00538 | 126 | cd00538, PA, PA: Protease-associated (PA) domain | 2e-17 | |
| cd02123 | 153 | cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a | 3e-16 | |
| cd04818 | 118 | cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas | 3e-14 | |
| cd02132 | 139 | cd02132, PA_GO-like, PA_GO-like: Protease-associat | 2e-13 | |
| pfam02225 | 96 | pfam02225, PA, PA domain | 2e-11 | |
| cd04813 | 117 | cd04813, PA_1, PA_1: Protease-associated (PA) doma | 4e-09 | |
| cd02129 | 120 | cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-as | 5e-07 | |
| cd02127 | 118 | cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease- | 4e-06 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 3e-05 | |
| cd02133 | 143 | cd02133, PA_C5a_like, PA_C5a_like: Protease-associ | 4e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 4e-05 | |
| cd02126 | 126 | cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as | 1e-04 | |
| cd04816 | 122 | cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease- | 3e-04 | |
| cd02122 | 138 | cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-a | 8e-04 |
| >gnl|CDD|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) | Back alignment and domain information |
|---|
Score = 219 bits (559), Expect = 7e-70
Identities = 79/128 (61%), Positives = 97/128 (75%), Gaps = 1/128 (0%)
Query: 48 NFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAW 107
NFG+PQYGGTL G VVYPK N+ CK FD KS PG P LL+DRG C+FTLKAW
Sbjct: 1 NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAW 60
Query: 108 NAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSG 167
NAQ+ GAAA+LVAD+ EPL+TMDTPEE A+Y++ ITIPSALI+K+ G+ +KK++S
Sbjct: 61 NAQQAGAAAVLVADNVDEPLLTMDTPEES-GSADYIEKITIPSALITKAFGEKLKKAISN 119
Query: 168 GEMVNMNL 175
GEMV + L
Sbjct: 120 GEMVVIKL 127
|
This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 127 |
| >gnl|CDD|238300 cd00538, PA, PA: Protease-associated (PA) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like | Back alignment and domain information |
|---|
| >gnl|CDD|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 | Back alignment and domain information |
|---|
| >gnl|CDD|216938 pfam02225, PA, PA domain | Back alignment and domain information |
|---|
| >gnl|CDD|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239044 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like | Back alignment and domain information |
|---|
| >gnl|CDD|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) | Back alignment and domain information |
|---|
| >gnl|CDD|239037 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 520 | |||
| cd02125 | 127 | PA_VSR PA_VSR: Protease-associated (PA) domain-con | 99.95 | |
| cd02122 | 138 | PA_GRAIL_like PA _GRAIL_like: Protease-associated | 99.86 | |
| cd02123 | 153 | PA_C_RZF_like PA_C-RZF_ like: Protease-associated | 99.86 | |
| cd02126 | 126 | PA_EDEM3_like PA_EDEM3_like: protease associated d | 99.86 | |
| cd02127 | 118 | PA_hPAP21_like PA_hPAP21_like: Protease-associated | 99.86 | |
| cd02132 | 139 | PA_GO-like PA_GO-like: Protease-associated domain | 99.84 | |
| cd04813 | 117 | PA_1 PA_1: Protease-associated (PA) domain subgrou | 99.8 | |
| cd04816 | 122 | PA_SaNapH_like PA_SaNapH_like: Protease-associated | 99.75 | |
| cd02129 | 120 | PA_hSPPL_like PA_hSPPL_like: Protease-associated d | 99.75 | |
| cd02130 | 122 | PA_ScAPY_like PA_ScAPY_like: Protease-associated d | 99.73 | |
| cd04818 | 118 | PA_subtilisin_1 PA_subtilisin_1: Protease-associat | 99.7 | |
| KOG3920 | 193 | consensus Uncharacterized conserved protein, conta | 99.65 | |
| cd02124 | 129 | PA_PoS1_like PA_PoS1_like: Protease-associated (PA | 99.64 | |
| cd04817 | 139 | PA_VapT_like PA_VapT_like: Protease-associated dom | 99.62 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.54 | |
| PF02225 | 101 | PA: PA domain; InterPro: IPR003137 The PA (Proteas | 99.48 | |
| cd00538 | 126 | PA PA: Protease-associated (PA) domain. The PA dom | 99.48 | |
| cd02133 | 143 | PA_C5a_like PA_C5a_like: Protease-associated domai | 99.35 | |
| KOG2442 | 541 | consensus Uncharacterized conserved protein, conta | 99.35 | |
| cd04819 | 127 | PA_2 PA_2: Protease-associated (PA) domain subgrou | 99.31 | |
| cd04815 | 134 | PA_M28_2 PA_M28_2: Protease-associated (PA) domain | 99.2 | |
| cd02120 | 126 | PA_subtilisin_like PA_subtilisin_like: Protease-as | 99.02 | |
| PF02128 | 378 | Peptidase_M36: Fungalysin metallopeptidase (M36); | 98.86 | |
| cd02128 | 183 | PA_TfR PA_TfR: Protease-associated domain containi | 98.81 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.43 | |
| cd02121 | 220 | PA_GCPII_like PA_GCPII_like: Protease-associated d | 98.25 | |
| cd04822 | 151 | PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do | 98.14 | |
| cd04814 | 142 | PA_M28_1 PA_M28_1: Protease-associated (PA) domain | 98.11 | |
| cd04820 | 137 | PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do | 97.98 | |
| cd02131 | 153 | PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso | 97.81 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.06 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 96.47 | |
| KOG1219 | 4289 | consensus Uncharacterized conserved protein, conta | 95.84 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 95.49 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 95.43 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 95.28 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.16 | |
| PRK00523 | 72 | hypothetical protein; Provisional | 94.55 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 94.49 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 94.38 | |
| KOG4260 | 350 | consensus Uncharacterized conserved protein [Funct | 93.84 | |
| KOG1214 | 1289 | consensus Nidogen and related basement membrane pr | 93.82 | |
| PRK01844 | 72 | hypothetical protein; Provisional | 93.32 | |
| cd04821 | 157 | PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do | 92.47 | |
| COG3763 | 71 | Uncharacterized protein conserved in bacteria [Fun | 92.2 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 91.68 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 91.07 | |
| PF03672 | 64 | UPF0154: Uncharacterised protein family (UPF0154); | 89.57 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 89.34 | |
| PF12273 | 130 | RCR: Chitin synthesis regulation, resistance to Co | 88.79 | |
| cd03024 | 201 | DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D | 86.98 | |
| PF04639 | 305 | Baculo_E56: Baculoviral E56 protein, specific to O | 85.54 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 85.41 | |
| cd03022 | 192 | DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car | 84.28 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 83.57 |
| >cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) | Back alignment and domain information |
|---|
Probab=99.95 E-value=6.7e-28 Score=217.36 Aligned_cols=127 Identities=62% Similarity=1.063 Sum_probs=107.6
Q ss_pred ccCCCCCCCceEEEEeccCCCccCCCCCCCCCcccCCCCCCCCeEEEEecCCCCHHHHHHHHHhcCCcEEEEEeCCCCCc
Q 010010 48 NFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPL 127 (520)
Q Consensus 48 ~FG~~~yg~~l~G~lv~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLV~RG~CsF~~Kv~nAQ~aGA~aVII~dn~~e~l 127 (520)
|||.|+||++++|.|+|++++.+||++++....+.+.++...++|+||+||+|+|.+|++|||++||++|||||+.++++
T Consensus 1 ~FG~~~yg~~~~G~l~~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLv~RG~C~F~~K~~~Aq~aGA~avII~n~~~~~~ 80 (127)
T cd02125 1 NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAWNAQQAGAAAVLVADNVDEPL 80 (127)
T ss_pred CCCCCCcCCeeEEEEEecCCccccCCCCcccccccccccCCCceEEEEECCCcCHHHHHHHHHHCCCcEEEEEECCCCcc
Confidence 79999999999999999988999999997642233223457799999999999999999999999999999999988878
Q ss_pred eecCCCCcccccccccCCcceeEEEEehhhHHHHHHHHhCCCeeEEEE
Q 010010 128 ITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNL 175 (520)
Q Consensus 128 ~tM~~p~d~~~~~~~~~~i~IPsv~Isk~dG~~L~~~l~~g~~V~v~l 175 (520)
++|..|+++. ..++..+++||+++|++++|+.|++.|++|..|+|+|
T Consensus 81 ~~m~~~~~~~-~~~~~~~i~IP~v~Is~~~G~~L~~~l~~g~~V~v~~ 127 (127)
T cd02125 81 LTMDTPEESG-SADYIEKITIPSALITKAFGEKLKKAISNGEMVVIKL 127 (127)
T ss_pred ccccCccccc-ccccCCCceEeEEEECHHHHHHHHHHHhcCCeEEEeC
Confidence 8887654421 1134567899999999999999999999999998875
|
This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may partic |
| >cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like | Back alignment and domain information |
|---|
| >cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like | Back alignment and domain information |
|---|
| >cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins | Back alignment and domain information |
|---|
| >cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) | Back alignment and domain information |
|---|
| >cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 | Back alignment and domain information |
|---|
| >cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1 | Back alignment and domain information |
|---|
| >cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) | Back alignment and domain information |
|---|
| >cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like | Back alignment and domain information |
|---|
| >cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) | Back alignment and domain information |
|---|
| >cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 | Back alignment and domain information |
|---|
| >KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like | Back alignment and domain information |
|---|
| >cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530 | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [] | Back alignment and domain information |
|---|
| >cd00538 PA PA: Protease-associated (PA) domain | Back alignment and domain information |
|---|
| >cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase | Back alignment and domain information |
|---|
| >KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2 | Back alignment and domain information |
|---|
| >cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2 | Back alignment and domain information |
|---|
| >cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases | Back alignment and domain information |
|---|
| >PF02128 Peptidase_M36: Fungalysin metallopeptidase (M36); InterPro: IPR001842 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR) | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like | Back alignment and domain information |
|---|
| >cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3 | Back alignment and domain information |
|---|
| >cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1 | Back alignment and domain information |
|---|
| >cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1 | Back alignment and domain information |
|---|
| >cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2) | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PRK00523 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG4260 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] | Back alignment and domain information |
|---|
| >PRK01844 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2 | Back alignment and domain information |
|---|
| >COG3763 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF03672 UPF0154: Uncharacterised protein family (UPF0154); InterPro: IPR005359 The proteins in this entry are functionally uncharacterised | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls | Back alignment and domain information |
|---|
| >cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif | Back alignment and domain information |
|---|
| >PF04639 Baculo_E56: Baculoviral E56 protein, specific to ODV envelope; InterPro: IPR006733 This family represents the E56 protein, which is localized to the occlusion derived virus (ODV) envelope, but not to the budded virus (BV) envelope [] | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 520 | |||
| 3icu_A | 194 | E3 ubiquitin-protein ligase RNF128; E3 ligase, ene | 5e-19 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 7e-07 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-06 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 8e-06 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 4e-06 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 4e-05 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 4e-05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 4e-05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 2e-04 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 5e-05 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 6e-05 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-04 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-04 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 2e-04 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-04 |
| >3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194 | Back alignment and structure |
|---|
Score = 84.5 bits (208), Expect = 5e-19
Identities = 25/137 (18%), Positives = 46/137 (33%), Gaps = 12/137 (8%)
Query: 44 CAIGNFGVPQYGGTLIGTVVYPKA--NQKACKGFDEVDLSFKSRPGGLPTFL-LVDRGD- 99
G +G + G +V P AC + ++L L+ RG
Sbjct: 56 SEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGG 115
Query: 100 CYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGD 159
C F K A + GA+ ++ + + + + I + +I G
Sbjct: 116 CTFADKIHLAYERGASGAVIFNFPGTRNEVIPMS--------HPGAVDIVAIMIGNLKGT 167
Query: 160 SIKKSLSGGEMVNMNLD 176
I +S+ G V M ++
Sbjct: 168 KILQSIQRGIQVTMVIE 184
|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 520 | |||
| 3icu_A | 194 | E3 ubiquitin-protein ligase RNF128; E3 ligase, ene | 99.88 | |
| 3iib_A | 444 | Peptidase M28; YP_926796.1, structural genomics, J | 98.96 | |
| 2ek8_A | 421 | Aminopeptidase; metalloproteinase, hydrolase; 1.80 | 98.87 | |
| 3fed_A | 707 | Glutamate carboxypeptidase III; metallopeptidase, | 98.53 | |
| 3kas_A | 640 | Transferrin receptor protein 1; transferrin recept | 98.32 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 98.03 | |
| 3i6s_A | 649 | Subtilisin-like protease; PA-domain, FN3-domain, h | 97.94 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.87 | |
| 1y9z_A | 441 | Alkaline serine protease; subtilisin-like alpha/be | 97.75 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 97.62 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.3 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.29 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.19 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.14 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.13 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.09 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.96 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 96.88 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 96.88 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.87 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.87 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.87 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.79 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.63 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.56 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 96.47 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.37 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 96.33 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 96.27 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.15 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 96.13 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.09 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.08 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 95.93 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.83 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.68 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.63 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 95.56 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 95.55 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 95.54 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 95.19 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 95.18 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 95.04 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 94.87 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 94.85 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 94.83 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 94.78 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 94.69 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 94.67 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 94.55 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 94.42 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 94.35 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.11 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 93.33 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 93.27 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 93.12 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 93.09 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 92.45 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 92.36 | |
| 3gmf_A | 205 | Protein-disulfide isomerase; oxidoreductase, PSI-2 | 91.73 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 91.72 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 91.11 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 90.31 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 90.18 | |
| 2imf_A | 203 | HCCA isomerase, 2-hydroxychromene-2-carboxylate is | 89.17 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 89.12 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 88.91 | |
| 3fz5_A | 202 | Possible 2-hydroxychromene-2-carboxylate isomeras; | 88.02 | |
| 3vta_A | 621 | Cucumisin; subtilisin-like fold, serine protease, | 87.71 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 87.57 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 87.35 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 87.28 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 87.21 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 87.01 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 86.75 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 86.13 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 86.11 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 85.93 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 85.68 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 85.65 | |
| 3gl5_A | 239 | Putative DSBA oxidoreductase SCO1869; probable DSB | 84.87 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 84.1 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 83.7 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 83.53 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 82.56 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 82.13 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 82.05 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 81.76 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 81.37 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 80.36 |
| >3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.88 E-value=9e-22 Score=187.73 Aligned_cols=148 Identities=22% Similarity=0.272 Sum_probs=112.0
Q ss_pred eeEEEeeceEEEEc--ccc--c-cceeeeeecccCCCCCCCceEEEEeccC--CCccCCCCCCCCCcccC-CCCCCCCeE
Q 010010 21 GRFVVEKNSLKVTS--PEK--I-KGVYECAIGNFGVPQYGGTLIGTVVYPK--ANQKACKGFDEVDLSFK-SRPGGLPTF 92 (520)
Q Consensus 21 ~~fvve~~~l~V~~--P~~--l-~~~y~~~~a~FG~~~yg~~l~G~lv~~~--~~~~gC~~~~~~~~~~~-~~~~~~~~I 92 (520)
......+..+.|+. |.. . -.......|+||...+.+.++|.|+++. ++.+||++++++..+.. .....+++|
T Consensus 28 ~~~~~~~A~vn~sy~d~~~~~n~t~~~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~gkI 107 (194)
T 3icu_A 28 GAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWL 107 (194)
T ss_dssp CSSCEEEEEEEEEEECCSSCTTCEEEEEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCCEE
T ss_pred cceeEEEEEEEEEEECCCCCccceeeecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCCeE
Confidence 33344455555444 432 1 1135567899999999999999999976 47899999876431110 011246899
Q ss_pred EEEecCC-CCHHHHHHHHHhcCCcEEEEEeCCC--CCceecCCCCcccccccccCCcceeEEEEehhhHHHHHHHHhCCC
Q 010010 93 LLVDRGD-CYFTLKAWNAQKGGAAAILVADDKT--EPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGE 169 (520)
Q Consensus 93 vLV~RG~-CsF~~Kv~nAQ~aGA~aVII~dn~~--e~l~tM~~p~d~~~~~~~~~~i~IPsv~Isk~dG~~L~~~l~~g~ 169 (520)
+||+||+ |+|.+|++|||++||+||||||+.. +.+++|..++ ..+||++||++++|+.|+++|++|.
T Consensus 108 aLV~RG~~CsF~~Kv~nAq~aGA~avIIyNn~~~g~~~~~m~~~~----------~~~IPsv~Is~~~G~~L~~~L~~G~ 177 (194)
T 3icu_A 108 ALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPG----------AVDIVAIMIGNLKGTKILQSIQRGI 177 (194)
T ss_dssp EEEESCTTCCHHHHHHHHHHTTCSEEEEECCTTCTTCCCCCCCTT----------CCSSEEEEECHHHHHHHHHHHHTTC
T ss_pred EEEECCCCcCHHHHHHHHHHCCCcEEEEEeCCCCCCceeeecCCC----------CCceeEEEECHHHHHHHHHHHHCCC
Confidence 9999999 9999999999999999999999852 3557886332 3579999999999999999999999
Q ss_pred eeEEEEEec
Q 010010 170 MVNMNLDWT 178 (520)
Q Consensus 170 ~V~v~l~~~ 178 (520)
+|+++|...
T Consensus 178 ~Vtvti~vg 186 (194)
T 3icu_A 178 QVTMVIEVG 186 (194)
T ss_dssp CEEEEEEEE
T ss_pred eEEEEEECC
Confidence 999988773
|
| >3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} | Back alignment and structure |
|---|
| >2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* | Back alignment and structure |
|---|
| >3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... | Back alignment and structure |
|---|
| >3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 520 | ||||
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 3e-06 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 1e-05 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 7e-05 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 1e-04 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 2e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 3e-04 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 3e-04 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 5e-04 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 8e-04 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 0.001 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 0.001 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 0.002 |
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.7 bits (98), Expect = 3e-06
Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 1/43 (2%)
Query: 411 DVDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQEHDTCI 453
D+DEC+ C C +T GSY C C G CI
Sbjct: 1 DIDECQRDPLL-CRGGVCHNTEGSYRCECPPGHQLSPNISACI 42
|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 520 | |||
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d1de4c2 | 193 | Transferrin receptor ectodomain, apical domain {Hu | 98.65 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.51 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.49 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.44 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.37 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.33 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.28 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.27 | |
| d3bi1a2 | 233 | Glutamate carboxypeptidase II {Human (Homo sapiens | 98.22 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.2 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.73 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.71 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.15 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.96 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.65 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 96.57 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 96.36 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 96.33 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.25 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 95.67 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.15 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 94.89 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.21 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 91.65 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 91.37 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 90.26 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 89.28 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 88.92 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 88.36 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 86.86 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 86.83 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 84.1 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 83.37 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 82.37 |
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.80 E-value=7.1e-10 Score=78.34 Aligned_cols=42 Identities=36% Similarity=0.808 Sum_probs=36.4
Q ss_pred chhhhhhhccCCCCCCccccCCCceeeecCCCccccccCCeee
Q 010010 411 DVDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQEHDTCI 453 (520)
Q Consensus 411 didEC~~~~~c~c~~~~C~nt~g~y~C~C~~~~~~~~~~~~Ci 453 (520)
|||||++. ...|....|.||.|||+|.|+.||.+..++.+||
T Consensus 1 DidEC~~~-~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~Cv 42 (42)
T d1lmja2 1 DIDECQRD-PLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI 42 (42)
T ss_dssp ECCHHHHC-SSTTTTSEEEEETTEEEEESCTTSCCCSSSCCCC
T ss_pred CccccCCC-CCCCCCCEeECCCCCeEEeCCCCCeECcCCCccC
Confidence 89999875 4556677999999999999999999988888886
|
| >d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|