Citrus Sinensis ID: 010011

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520

MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKVVHSFYL

ccEEEcccccccccccccEEEEEccccccccccccEEEEEccccEEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEccccccccccccccccEEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEEEccccccccccEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEEcccccccccccEEEEEccccccEEEEEccccccccccccEEEEEcccccccccEEccccccccccccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEEEc

ccccEcccEEEEEcccccEEEccccccccccccccEEEEEEEccEEEEEEccccccccccEEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccccEcccEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEEccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEccccEEEEEcccccccccccccEEEEEEEccccEEEEEEcccccccccccEEEEccccccccccccccccccccEEEEEEccccccccEEEEccccccccccccccccccccccccccccccccHEEEEEcccccccEEEEEEccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccHccccccccccccccccccEEEEEEcc

mrwekvqpkspqALVAQQLVSseisssgpgkrwghtcnaikggrflyvfggygkdncqtnqvHVFDTVnqtwsqpvikgspptprdshscttvgenlyvfggtdgmnplrdlhildtsshtwispsvrgegpeareghsAALVGKRLFifggcgkssntndevyyndlyILNTETFVWKRattsgnppsardshtcsswkNKIIViggedghdyylsdvhildtdtltwkelntsgmvlspraghstvafGKNLfvfggftdsqnlyddlymidvdsglwtkvittgegpsarfsvagdcldplkgGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKcqeqnftpvhdrALVRIdtisdvhqptpllsygeprrnnfplnegkktfqakvtesfplgytiettidgkplrgilfankptsasttnhnssrkRAVGEIggamlngdcnsnSKAFKALRqdgmdqeqvdgvqvkeftshegaaaaapdmknpahsdafqpvKVVHSFYL

mrwekvqpkspqalVAQQLVSseisssgpgkrwGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTwsqpvikgspptprdshsctTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTsgnppsardshtcssWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLkcqeqnftpvhdrALVRIDTIsdvhqptpllsygeprrnnfplnegKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANkptsasttnhnssrkRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKVVHSFYL

*******************************RWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVI************CTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWI****************AALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA*************TCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSY***************TFQAKVTESFPLGYTIETTIDGKPLRGILFA********************************************************************************************

MRWEK**PKSPQALVAQ*L************RWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVIT*****SARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERK*****************NFTPVHDRALVRIDTIS*************************************************************************************************************************************************SFYL

**************VAQQ**************WGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVI************CTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISP*************SAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRAT**************SSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKP************KRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKVVHSFYL

*RWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKP******************************************************************************QPVKVVHSFYL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		520	2.2.26 [Sep-21-2011]
Q8VEM9		382	Kelch domain-containing p	yes	no	0.582	0.793	0.282	7e-32
Q6AYI2		382	Kelch domain-containing p	yes	no	0.582	0.793	0.282	7e-32
Q58CV6		382	Kelch domain-containing p	yes	no	0.582	0.793	0.279	7e-31
Q7M3S9		943	RING finger protein B OS=	no	no	0.55	0.303	0.300	1e-30
P87061		1147	Tip elongation aberrant p	yes	no	0.532	0.241	0.302	1e-30
Q6AXB2		366	Rab9 effector protein wit	N/A	no	0.515	0.732	0.309	2e-30
Q9BQ90		382	Kelch domain-containing p	yes	no	0.582	0.793	0.282	6e-30
Q5EA50		372	Rab9 effector protein wit	no	no	0.509	0.712	0.298	1e-27
Q54C94		1127	Ras guanine nucleotide ex	no	no	0.505	0.233	0.286	2e-27
Q7Z6M1		372	Rab9 effector protein wit	no	no	0.473	0.661	0.306	2e-27

>sp\|Q8VEM9\|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1	Back alignment and function desciption

 Score =  139 bits (349), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 156/336 (46%), Gaps = 33/336 (9%)

Query: 39  AIKGGRFLYVFGGY--GKDNCQTNQ--VHVFDTVNQTWSQ-----PVIKGSPPTP---RD 86
           A+  G  +Y FGGY  G+D     Q  VH+F+ V+  W++     P ++G  P     R 
Sbjct: 19  AVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVRPAVRGQAPVVPYMRY 78

Query: 87  SHSCTTVGENLYVFGG-TDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGK 145
            HS   + + ++++GG  D       L+  D ++H W +P V G  P AR+GHSA ++GK
Sbjct: 79  GHSTVLIDDTVFLWGGRNDTEGACNVLYAFDVNTHKWSTPRVSGTVPGARDGHSACVLGK 138

Query: 146 RLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIV 205
            ++IFGG  + +    + + ND++ L+T T  W    T GNP   RD H+ +   N + V
Sbjct: 139 IMYIFGGYEQLA----DCFSNDIHKLDTSTMTWTLVCTKGNPARWRDFHSATMLGNHMYV 194

Query: 206 IGGE--------DGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVF 257
            GG           ++ Y + + + DT T  W +   + ++   R  HS   +   L++F
Sbjct: 195 FGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPHTPVLPEGRRSHSAFGYNGELYIF 254

Query: 258 GGFTDSQNL-YDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCN 316
           GG+    N  + DL+  +  S  W K+   G+GP  R      C   +   +++F G   
Sbjct: 255 GGYNARLNRHFHDLWKFNPGSFTWKKIEPKGKGPCPR---RRQCCCIVGDKIVLFGGTSP 311

Query: 317 KSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQ 352
              E L D +     L++   L  L     LK  C+
Sbjct: 312 SPEEGLGDEF----DLIDHSDLHILDFSPSLKTLCK 343

May be involved in meiotic recombination process.
Mus musculus (taxid: 10090)

>sp\|Q6AYI2\|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1	Back alignment and function description

>sp\|Q58CV6\|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2	Back alignment and function description

>sp\|Q7M3S9\|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2	Back alignment and function description

>sp\|P87061\|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1	Back alignment and function description

>sp\|Q6AXB2\|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1	Back alignment and function description

>sp\|Q9BQ90\|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1	Back alignment and function description

>sp\|Q5EA50\|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1	Back alignment and function description

>sp\|Q54C94\|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1	Back alignment and function description

>sp\|Q7Z6M1\|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		520
255547157		556	kelch repeat protein, putative [Ricinus	0.919	0.859	0.737	0.0
297734075		605	unnamed protein product [Vitis vinifera]	0.934	0.803	0.703	0.0
359491361		589	PREDICTED: kelch domain-containing prote	0.903	0.797	0.697	0.0
449440856		597	PREDICTED: uncharacterized protein LOC10	0.965	0.840	0.678	0.0
334182672		556	galactose oxidase/kelch repeat domain-co	0.915	0.856	0.641	0.0
356562638		609	PREDICTED: kelch domain-containing prote	0.946	0.807	0.651	0.0
449477505		535	PREDICTED: uncharacterized protein LOC10	0.842	0.818	0.676	1e-178
297844816		450	predicted protein [Arabidopsis lyrata su	0.823	0.951	0.662	1e-178
356507056		997	PREDICTED: uncharacterized protein LOC10	0.896	0.467	0.620	1e-175
356513479		438	PREDICTED: actin-fragmin kinase-like [Gl	0.786	0.933	0.715	1e-174

>gi\|255547157\|ref\|XP_002514636.1\| kelch repeat protein, putative [Ricinus communis] gi\|223546240\|gb\|EEF47742.1\| kelch repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/506 (73%), Positives = 414/506 (81%), Gaps = 28/506 (5%)

Query: 1   MRWEKVQPKSPQALVAQQLVSSEISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTN 60
           MRWE++Q +   + +          ++GPGKRWGHTCN++KGGRFLYVFGGYGKDNCQTN
Sbjct: 1   MRWERLQQQQQSSNI----------NNGPGKRWGHTCNSVKGGRFLYVFGGYGKDNCQTN 50

Query: 61  QVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSH 120
           QVHVFDT  QTWSQPVIKG+PPTPRDSHSCTTVG++LYVFGGTDGMNPL+DLHILDT SH
Sbjct: 51  QVHVFDTATQTWSQPVIKGTPPTPRDSHSCTTVGDSLYVFGGTDGMNPLKDLHILDTLSH 110

Query: 121 TWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKR 180
           TWI+P+VRGEGPEAREGHSAALVGKRLFIFGGCGKSSN NDEVY+NDLYILNTETFVWK+
Sbjct: 111 TWIAPAVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNNNDEVYFNDLYILNTETFVWKK 170

Query: 181 ATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLS 240
           A TSG PPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILD +TL WKELN +G  L 
Sbjct: 171 AVTSGTPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDAETLVWKELNATGQKLP 230

Query: 241 PRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDC 300
           PRAGHSTV+FGKNLFVFGGFTD+QNLYDDLYM+DVD+G+WTK++T G GPSARFSVAGDC
Sbjct: 231 PRAGHSTVSFGKNLFVFGGFTDAQNLYDDLYMLDVDTGVWTKIMTAGIGPSARFSVAGDC 290

Query: 301 LDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLV---NERKLEKLSLRKQLKLKCQEQNF- 356
           LDP  GGVLVFIGGCNKSLEALDDMYYLYTGL    +E +LEKLSLRKQLKLKCQEQN  
Sbjct: 291 LDPQIGGVLVFIGGCNKSLEALDDMYYLYTGLARIRDELRLEKLSLRKQLKLKCQEQNLN 350

Query: 357 TPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETT 416
           +PVHD+AL+RIDT           S    R N   L++GKKTFQAKVTE FP GYTIET 
Sbjct: 351 SPVHDKALLRIDT-----------SRENLRLNQVQLHQGKKTFQAKVTECFPHGYTIETI 399

Query: 417 IDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQ 476
           IDGKPL GILFANKP S+   + ++SRKR   EI G +LN D N+ SK  KAL+QDG+D 
Sbjct: 400 IDGKPLHGILFANKPISSPMASQSNSRKRVSAEI-GPLLNSDHNNKSKTSKALKQDGVDH 458

Query: 477 EQVDGVQVKEFTSHEGAAAAAPDMKN 502
            Q D V  KE   HE    A  D KN
Sbjct: 459 LQPDNVHGKETLMHESKPEA--DAKN 482

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297734075\|emb\|CBI15322.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359491361\|ref\|XP_002265482.2\| PREDICTED: kelch domain-containing protein 3-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449440856\|ref\|XP_004138200.1\| PREDICTED: uncharacterized protein LOC101209027 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334182672\|ref\|NP_173296.3\| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana] gi\|9795595\|gb\|AAF98413.1\|AC026238_5 Hypothetical protein [Arabidopsis thaliana] gi\|332191613\|gb\|AEE29734.1\| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356562638\|ref\|XP_003549576.1\| PREDICTED: kelch domain-containing protein 3-like [Glycine max]	Back alignment and taxonomy information

>gi\|449477505\|ref\|XP_004155043.1\| PREDICTED: uncharacterized protein LOC101224155 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297844816\|ref\|XP_002890289.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297336131\|gb\|EFH66548.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356507056\|ref\|XP_003522287.1\| PREDICTED: uncharacterized protein LOC100785267 [Glycine max]	Back alignment and taxonomy information

>gi\|356513479\|ref\|XP_003525441.1\| PREDICTED: actin-fragmin kinase-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		520
DICTYBASE\|DDB_G0270750		485	DDB_G0270750 "Kelch repeat-con	0.503	0.540	0.336	2.7e-36
MGI\|MGI:2651568		382	Klhdc3 "kelch domain containin	0.596	0.811	0.295	1.3e-34
RGD\|1307105		382	Klhdc3 "kelch domain containin	0.596	0.811	0.295	1.3e-34
UNIPROTKB\|A5GFR1		410	KLHDC3 "Uncharacterized protei	0.596	0.756	0.295	3.6e-34
UNIPROTKB\|Q58CV6		382	KLHDC3 "Kelch domain-containin	0.596	0.811	0.293	1.2e-33
UNIPROTKB\|Q9BQ90		382	KLHDC3 "Kelch domain-containin	0.596	0.811	0.295	4.1e-33
DICTYBASE\|DDB_G0272080		1523	gacHH "RhoGAP domain-containin	0.303	0.103	0.381	2.6e-20
UNIPROTKB\|Q58D25		550	KLHDC3 "Kelch domain-containin	0.603	0.570	0.290	4.4e-32
UNIPROTKB\|E2RCI2		553	KLHDC3 "Uncharacterized protei	0.603	0.567	0.293	7.3e-32
ZFIN\|ZDB-GENE-040426-2426		310	zgc:85727 "zgc:85727" [Danio r	0.498	0.835	0.298	2.2e-31

DICTYBASE\|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

 Score = 391 (142.7 bits), Expect = 2.7e-36, P = 2.7e-36
 Identities = 93/276 (33%), Positives = 138/276 (50%)

Query:     7 QPKSPQALVAQQLVSSEISSSG--PGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHV 64
             Q +  Q +    ++S+   ++G  P +R GHT    K    L  FGG    +   + ++ 
Sbjct:    92 QQQQQQQIQPSSIISTTQETTGFFPVERHGHTTCLYKNKVIL--FGGTPDGSHGLSDLYF 149

Query:    65 FDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDGMNPLRDLHILDTSSHTWIS 124
                   +W +   KG+ P  R  HS   + + +Y+FGG      L DLH+LD  + TW  
Sbjct:   150 LYLDTYSWVEIKTKGNAPNGRYRHSAIIIEDKMYIFGGYRS-KCLNDLHVLDLETFTWSE 208

Query:   125 PSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTS 184
             P   GE P AR  HS   VGK + +FGG G         Y N+L+ L+T T  W +    
Sbjct:   209 PICIGEAPSARSSHSVCCVGKMMILFGGSGAR-------YSNELFSLDTVTMRWTKHDVL 261

Query:   185 GNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAG 244
             G PPS R  HT  S+  K++  GG +      + V+ILDTDT+ W +  TSG    PR  
Sbjct:   262 GTPPSERWCHTMCSFGKKVVTFGGSNDKRKD-NKVYILDTDTMEWSQPPTSGNCPIPRQL 320

Query:   245 HSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLW 280
             H+ VA G+++ VFGG+   Q L +DLY+++  +  W
Sbjct:   321 HTAVAIGESMIVFGGWGKHQEL-NDLYILNTRTMKW 355

GO:0008150 "biological_process" evidence=ND

GO:0005575 "cellular_component" evidence=ND

GO:0003674 "molecular_function" evidence=ND

MGI\|MGI:2651568 Klhdc3 "kelch domain containing 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1307105 Klhdc3 "kelch domain containing 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|A5GFR1 KLHDC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q58CV6 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BQ90 KLHDC3 "Kelch domain-containing protein 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q58D25 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RCI2 KLHDC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2426 zgc:85727 "zgc:85727" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		520
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-20
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-19
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	3e-19
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	6e-16
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-15
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	9e-13
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	5e-11
PLN02772		398	PLN02772, PLN02772, guanylate kinase	3e-10
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	3e-09
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	3e-08
TIGR03547		346	TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	8e-08
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	1e-07
pfam01344		46	pfam01344, Kelch_1, Kelch motif	2e-07
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	2e-07
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	7e-07
pfam13854		42	pfam13854, Kelch_5, Kelch motif	7e-07
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	9e-07
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	1e-06
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	1e-06
COG3055		381	COG3055, COG3055, Uncharacterized protein conserve	2e-06
pfam13854		42	pfam13854, Kelch_5, Kelch motif	5e-06
pfam07646		48	pfam07646, Kelch_2, Kelch motif	6e-06
pfam13964		50	pfam13964, Kelch_6, Kelch motif	8e-06
PLN02772		398	PLN02772, PLN02772, guanylate kinase	9e-06
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	9e-06
pfam13964		50	pfam13964, Kelch_6, Kelch motif	1e-05
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	2e-05
pfam01344		46	pfam01344, Kelch_1, Kelch motif	2e-05
pfam01344		46	pfam01344, Kelch_1, Kelch motif	2e-05
pfam13964		50	pfam13964, Kelch_6, Kelch motif	3e-05
TIGR03548		323	TIGR03548, mutarot_permut, cyclically-permuted mut	3e-05
pfam13854		42	pfam13854, Kelch_5, Kelch motif	4e-05
pfam07646		48	pfam07646, Kelch_2, Kelch motif	4e-05
pfam13964		50	pfam13964, Kelch_6, Kelch motif	1e-04
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	2e-04
pfam13964		50	pfam13964, Kelch_6, Kelch motif	2e-04
TIGR03548		323	TIGR03548, mutarot_permut, cyclically-permuted mut	2e-04
PRK14131		376	PRK14131, PRK14131, N-acetylneuraminic acid mutaro	2e-04
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	3e-04
TIGR03547		346	TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	4e-04
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	4e-04
PRK14131		376	PRK14131, PRK14131, N-acetylneuraminic acid mutaro	4e-04
PRK14131		376	PRK14131, PRK14131, N-acetylneuraminic acid mutaro	5e-04
pfam13854		42	pfam13854, Kelch_5, Kelch motif	0.002
COG3055		381	COG3055, COG3055, Uncharacterized protein conserve	0.002
TIGR03547		346	TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	0.003
pfam01344		46	pfam01344, Kelch_1, Kelch motif	0.003
pfam01344		46	pfam01344, Kelch_1, Kelch motif	0.003
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	0.004

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

 Score = 94.3 bits (234), Expect = 1e-20
 Identities = 89/324 (27%), Positives = 142/324 (43%), Gaps = 35/324 (10%)

Query: 23  EISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQ-VHVFDTVNQTWSQPVIKGSP 81
           E    GPG R  H    +  G  +Y FGG    N   ++ ++VFD   +TWS     G  
Sbjct: 157 EQKGEGPGLRCSHGIAQV--GNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDV 214

Query: 82  PTPRDSHSC-----TTVGENLYVFGGTDGMNPLRDLHILDTSSHTWISPSVRGEGPEARE 136
           P      SC      ++G  LYVFGG D        +  DT+++ W   +   EGP  R 
Sbjct: 215 PH----LSCLGVRMVSIGSTLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRS 270

Query: 137 GHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTC 196
            HS A   + +++FGG   ++       YN   I++ +   W   +T G+  S R     
Sbjct: 271 FHSMAADEENVYVFGGVSATARLKTLDSYN---IVDKK---WFHCSTPGDSFSIRGGAGL 324

Query: 197 SSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFV 256
              + K+ V+ G +G +  + DVH  D     W ++ T G+  S R+  ++ A GK++ +
Sbjct: 325 EVVQGKVWVVYGFNGCE--VDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVI 382

Query: 257 FGG--------FTDSQNLYDDLYMIDVDSGLWTKVITTG---EGPSARFSVAGD--CLDP 303
           FGG              L D  + +D ++  W ++   G   E PS+R   A     +D 
Sbjct: 383 FGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEETPSSRGWTASTTGTIDG 442

Query: 304 LKGGVLVFIGGCNKSLEALDDMYY 327
            KG  LV  GG   + +  DD+++
Sbjct: 443 KKG--LVMHGGKAPTNDRFDDLFF 464

Length = 470

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215414 PLN02772, PLN02772, guanylate kinase	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|215414 PLN02772, PLN02772, guanylate kinase	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein	Back alignment and domain information

>gnl\|CDD\|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>gnl\|CDD\|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		520
PLN02153		341	epithiospecifier protein	100.0
PLN02193		470	nitrile-specifier protein	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	100.0
PLN02193		470	nitrile-specifier protein	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
PLN02153		341	epithiospecifier protein	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
KOG1230		521	consensus Protein containing repeated kelch motifs	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
KOG1230		521	consensus Protein containing repeated kelch motifs	99.98
PHA02790		480	Kelch-like protein; Provisional	99.98
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	99.98
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	99.97
PHA02790		480	Kelch-like protein; Provisional	99.96
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	99.96
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.79
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.78
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.69
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.63
PF13964		50	Kelch_6: Kelch motif	99.09
PF13964		50	Kelch_6: Kelch motif	99.0
PLN02772		398	guanylate kinase	98.97
PLN02772		398	guanylate kinase	98.94
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.88
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.84
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.73
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.72
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.71
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.71
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.69
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.69
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.69
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.61
PF13854		42	Kelch_5: Kelch motif	98.55
PF13854		42	Kelch_5: Kelch motif	98.49
smart00612		47	Kelch Kelch domain.	98.46
smart00612		47	Kelch Kelch domain.	98.26
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	98.18
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	98.06
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	97.82
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	97.71
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.5
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.39
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.31
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	96.83
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	96.7
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	96.65
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	96.54
PF12768		281	Rax2: Cortical protein marker for cell polarity	95.63
PRK05137		435	tolB translocation protein TolB; Provisional	95.17
KOG2055		514	consensus WD40 repeat protein [General function pr	94.89
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	94.88
PF12768		281	Rax2: Cortical protein marker for cell polarity	94.48
PRK05137		435	tolB translocation protein TolB; Provisional	94.45
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	94.24
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	93.94
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	93.88
PRK04792		448	tolB translocation protein TolB; Provisional	93.77
PRK00178		430	tolB translocation protein TolB; Provisional	93.76
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	93.33
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	93.24
KOG2055		514	consensus WD40 repeat protein [General function pr	93.05
PRK04792		448	tolB translocation protein TolB; Provisional	93.04
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	93.02
PF12217		367	End_beta_propel: Catalytic beta propeller domain o	92.6
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	92.49
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	92.29
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	92.08
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	92.0
PRK04922		433	tolB translocation protein TolB; Provisional	91.92
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	91.77
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	91.77
PRK04043		419	tolB translocation protein TolB; Provisional	91.57
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	90.94
PRK04043		419	tolB translocation protein TolB; Provisional	90.76
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	90.58
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	90.55
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	90.45
PF09910		339	DUF2139: Uncharacterized protein conserved in arch	90.31
PRK00178		430	tolB translocation protein TolB; Provisional	90.26
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	89.61
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	89.48
PRK03629		429	tolB translocation protein TolB; Provisional	89.26
PRK04922		433	tolB translocation protein TolB; Provisional	88.78
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	86.78
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	86.35
PRK03629		429	tolB translocation protein TolB; Provisional	85.7
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	85.5
PRK13684		334	Ycf48-like protein; Provisional	85.16
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	85.02
KOG2321		703	consensus WD40 repeat protein [General function pr	84.83
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	84.38
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	84.21
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	83.86
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	83.66
COG1520		370	FOG: WD40-like repeat [Function unknown]	83.03
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	82.86
PLN00033		398	photosystem II stability/assembly factor; Provisio	82.65
PRK02889		427	tolB translocation protein TolB; Provisional	82.47
KOG0649		325	consensus WD40 repeat protein [General function pr	81.29

>PLN02153 epithiospecifier protein	Back alignment and domain information

Probab=100.00  E-value=1.5e-44  Score=370.48  Aligned_cols=302  Identities=27%  Similarity=0.426  Sum_probs=242.7

Q ss_pred             CCCCCCccceEEEEEcCCCEEEEEcCcCCC-CCCcCeEEEEECCCCeEEeeeccCCCCCC-CCcceEEEECCEEEEEcCC
Q 010011           26 SSGPGKRWGHTCNAIKGGRFLYVFGGYGKD-NCQTNQVHVFDTVNQTWSQPVIKGSPPTP-RDSHSCTTVGENLYVFGGT  103 (520)
Q Consensus        26 g~~P~~R~ghs~~~v~~g~~Iyi~GG~~~~-~~~~~~~~~yd~~t~~W~~l~~~g~~P~~-R~~hs~~~~~~~iyv~GG~  103 (520)
                      +..|.+|.+|+++++  +++|||+||.... ....+++|+||+.+++|.+++..+..|.. +.+|++++++++||+|||.
T Consensus        17 ~~~P~pR~~h~~~~~--~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~p~~~~~~~~~~~~~~~iyv~GG~   94 (341)
T PLN02153         17 GKGPGPRCSHGIAVV--GDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSIAPANGDVPRISCLGVRMVAVGTKLYIFGGR   94 (341)
T ss_pred             CCCCCCCCcceEEEE--CCEEEEECCccCCCCceeCcEEEEECCCCEEEEcCccCCCCCCccCceEEEEECCEEEEECCC
Confidence            457889999999988  6689999998543 22457899999999999997654444443 4589999999999999999


Q ss_pred             CCCCCCCcEEEEECCCCeEEeeccc--CCCCCCCCCceEEEECCEEEEEeCCCCCCCCCCcceeceeEEEEcCcceEEEc
Q 010011          104 DGMNPLRDLHILDTSSHTWISPSVR--GEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA  181 (520)
Q Consensus       104 ~~~~~~~~~~~yd~~t~~W~~~~~~--g~~p~~r~~hs~~~~~~~lyv~GG~~~~~~~~~~~~~~~v~~~d~~t~~W~~v  181 (520)
                      +....++++++||+.+++|+.++..  ...|.+|.+|+++.++++||||||+...........++++++||+.+++|..+
T Consensus        95 ~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~v~~yd~~~~~W~~l  174 (341)
T PLN02153         95 DEKREFSDFYSYDTVKNEWTFLTKLDEEGGPEARTFHSMASDENHVYVFGGVSKGGLMKTPERFRTIEAYNIADGKWVQL  174 (341)
T ss_pred             CCCCccCcEEEEECCCCEEEEeccCCCCCCCCCceeeEEEEECCEEEEECCccCCCccCCCcccceEEEEECCCCeEeeC
Confidence            8777789999999999999987632  12388999999999999999999985432222223468899999999999999


Q ss_pred             ccCCCCCCCCcceeEEeeCCEEEEEecCCCC-------CcccCceEEEECCCCcEEEeeCCCCCCCCCceeEEEEECCEE
Q 010011          182 TTSGNPPSARDSHTCSSWKNKIIVIGGEDGH-------DYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNL  254 (520)
Q Consensus       182 ~~~~~~p~~r~~h~~~~~~~~lyv~GG~~~~-------~~~~~~i~~yd~~t~~W~~~~~~~~~p~~R~~hs~~~~~~~i  254 (520)
                      +..+.+|.+|..|++++++++|||+||....       ...++++++||+++++|+++...+.+|.+|..|+++.++++|
T Consensus       175 ~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~gG~~~~~~~~v~~yd~~~~~W~~~~~~g~~P~~r~~~~~~~~~~~i  254 (341)
T PLN02153        175 PDPGENFEKRGGAGFAVVQGKIWVVYGFATSILPGGKSDYESNAVQFFDPASGKWTEVETTGAKPSARSVFAHAVVGKYI  254 (341)
T ss_pred             CCCCCCCCCCCcceEEEECCeEEEEeccccccccCCccceecCceEEEEcCCCcEEeccccCCCCCCcceeeeEEECCEE
Confidence            8776677899999999999999999996421       123678999999999999998777789999999999999999


Q ss_pred             EEEecccC--------CCCccCcEEEEecCCCcEEEeeeCCCCCCCc--eeeeeeeeccccCCEEEEEcccCCCCCccCc
Q 010011          255 FVFGGFTD--------SQNLYDDLYMIDVDSGLWTKVITTGEGPSAR--FSVAGDCLDPLKGGVLVFIGGCNKSLEALDD  324 (520)
Q Consensus       255 yv~GG~~~--------~~~~~~dv~~yd~~~~~W~~l~~~~~~p~~r--~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~d  324 (520)
                      |||||...        .....+++|+||+++++|+.+...+.+|.+|  ..++++.+  ..++.|||+||++.....++|
T Consensus       255 yv~GG~~~~~~~~~~~~~~~~n~v~~~d~~~~~W~~~~~~~~~~~pr~~~~~~~~~v--~~~~~~~~~gG~~~~~~~~~~  332 (341)
T PLN02153        255 IIFGGEVWPDLKGHLGPGTLSNEGYALDTETLVWEKLGECGEPAMPRGWTAYTTATV--YGKNGLLMHGGKLPTNERTDD  332 (341)
T ss_pred             EEECcccCCccccccccccccccEEEEEcCccEEEeccCCCCCCCCCcccccccccc--CCcceEEEEcCcCCCCccccc
Confidence            99999742        2345689999999999999997654444444  33333222  445689999999888789999


Q ss_pred             eEeeecc
Q 010011          325 MYYLYTG  331 (520)
Q Consensus       325 v~~l~~~  331 (520)
                      +|+++..
T Consensus       333 ~~~~~~~  339 (341)
T PLN02153        333 LYFYAVN  339 (341)
T ss_pred             eEEEecc
Confidence            9998643

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG1520 FOG: WD40-like repeat [Function unknown]	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		520
2vpj_A		301	Crystal Structure Of The Kelch Domain Of Human Klhl		5e-05
3ii7_A		306	Crystal Structure Of The Kelch Domain Of Human Klhl		1e-04
1x2j_A		316	Structural Basis For The Defects Of Human Lung Canc		8e-04
2dyh_A		318	Crystal Structure Of The Keap1 Protein In Complexed		8e-04

>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301

Back alignment and structure

Iteration: 1

Score = 45.8 bits (107), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 60/245 (24%), Positives = 100/245 (40%), Gaps = 29/245 (11%) Query: 45 FLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTD 104 L V GG+G + V +D Q WS S R + ++ + +YV GG D Sbjct: 16 VLLVVGGFGSQQSPIDVVEKYDPKTQEWS---FLPSITRKRRYVASVSLHDRIYVIGGYD 72 Query: 105 GMNPLRDLHILDTSSH---TWISPSVRGEGPEAREGHSAA-LVGKRLFIFGGC-GKSSNT 159 G + L + LD ++ W S + R G + A +G +++ GG G +T Sbjct: 73 GRSRLSSVECLDYTADEDGVWYSVAPM----NVRRGLAGATTLGDMIYVSGGFDGSRRHT 128 Query: 160 NDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDV 219 + E Y ++ + + G+ +AR+ I +GG DG + L+ V Sbjct: 129 SMERYDPNI----------DQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLN-ILNSV 177 Query: 220 HILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYD-DLYMIDVDSG 278 D T W + + + R+G +++V GGF + +L + Y I DS Sbjct: 178 EKYDPHTGHWTNVTP---MATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDS- 233 Query: 279 LWTKV 283 WT V Sbjct: 234 -WTTV 237

PyMOL of 2vpj

>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306

Back alignment and structure

>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316

Back alignment and structure

>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		520
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	2e-56
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	3e-43
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	1e-20
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	3e-12
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	7e-08
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	3e-40
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	3e-34
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	9e-23
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	1e-37
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	2e-34
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	7e-33
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	5e-24
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	4e-36
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	7e-35
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	5e-27
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	1e-18
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	4e-36
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	2e-32
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	9e-25
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	9e-35
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	4e-32
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	2e-21
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	2e-20
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	2e-13
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	2e-34
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	2e-32
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	4e-30
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	2e-23
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	1e-31
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	2e-30
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	4e-30
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	4e-05
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	3e-04
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	5e-04
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	6e-04

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

 Score =  199 bits (506), Expect = 2e-56
 Identities = 56/310 (18%), Positives = 89/310 (28%), Gaps = 35/310 (11%)

Query: 24  ISSSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIK---GS 80
           +    P  R     +    G  ++  GG   +  + N++              I+     
Sbjct: 380 LECECPINRKFGDVDVA--GNDVFYMGGS--NPYRVNEILQLSIHYDKIDMKNIEVSSSE 435

Query: 81  PPTPRDSHSCTTVGEN--LYVFGG-TDGMNPLRDLHILDTSSHTWISPSVRGEGPEAREG 137
            P  R  H+ TT+  N  L + GG       L D  I D  +  W            R  
Sbjct: 436 VPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI---KSLSHTRFR 492

Query: 138 HSAALVGK-RLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTC 196
           HSA  +    + I GG  +            + + N    ++K  T              
Sbjct: 493 HSACSLPDGNVLILGGVTEG---------PAMLLYNVTEEIFKDVTPKDEFFQNSLVSAG 543

Query: 197 SSW----KNKIIVIGGEDGHDYYLSDVHI----LDTDTLTWKELNTSGMVLSPRAGHSTV 248
             +    K  II+ GG            I     +  T     +      L  R G    
Sbjct: 544 LEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITVIKKLQHPLFQRYGSQIK 603

Query: 249 AFGKN-LFVFGGFTDSQNL--YDDLYMIDVDSGLWTKV-ITTGEGPSARFSVAGDCLDPL 304
                 L + GG + S      + +  +D  S   T + I+          +AG  L   
Sbjct: 604 YITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRRIWEDHSLMLAGFSLVST 663

Query: 305 KGGVLVFIGG 314
             G +  IGG
Sbjct: 664 SMGTIHIIGG 673

PyMOL of 2zwa

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Length = 353	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		520
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	99.97
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	99.94
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.96
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.85
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.78
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.78
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.59
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	97.5
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.42
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.42
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	97.33
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	97.25
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.24
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.21
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.18
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.07
3jrp_A		379	Fusion protein of protein transport protein SEC13	97.02
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	96.92
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	96.91
3v9f_A		781	Two-component system sensor histidine kinase/RESP	96.84
4a2l_A		795	BT_4663, two-component system sensor histidine kin	96.67
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	96.59
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	96.58
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.54
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	96.53
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.44
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	96.41
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	96.38
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	96.33
3ow8_A		321	WD repeat-containing protein 61; structural genomi	96.32
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	96.31
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.27
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.27
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	96.24
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.2
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	96.2
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	96.14
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	96.12
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	96.08
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	96.05
3jro_A		753	Fusion protein of protein transport protein SEC13	95.96
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	95.95
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	95.87
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	95.68
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	95.63
3v9f_A		781	Two-component system sensor histidine kinase/RESP	95.62
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	95.59
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	95.58
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	95.55
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	95.54
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	95.53
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	95.48
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	95.45
3ow8_A		321	WD repeat-containing protein 61; structural genomi	95.42
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	95.32
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	95.31
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	95.3
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	95.29
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	95.27
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	95.24
4a2l_A		795	BT_4663, two-component system sensor histidine kin	95.19
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	95.18
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	95.15
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	95.1
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	95.1
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	95.03
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	94.98
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	94.98
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	94.97
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	94.93
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	94.9
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	94.89
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	94.8
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	94.77
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	94.65
3jrp_A		379	Fusion protein of protein transport protein SEC13	94.64
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	94.63
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	94.42
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	94.37
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	94.32
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	94.23
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	94.02
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	93.96
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	93.94
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	93.9
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	93.89
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	93.76
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	93.74
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	93.73
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	93.7
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	93.69
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	93.55
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	93.45
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	93.35
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	93.32
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	93.32
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	93.27
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	93.26
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	93.22
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	93.21
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	93.16
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	93.16
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	92.86
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	92.81
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	92.8
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	92.68
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	92.66
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	92.53
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	92.49
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	92.49
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	92.37
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	92.35
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	92.25
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	92.18
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	92.07
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	92.01
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	91.95
3ott_A		758	Two-component system sensor histidine kinase; beta	91.93
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	91.89
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	91.84
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	91.78
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	91.74
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	91.64
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	91.64
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	91.59
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	91.56
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	91.54
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	91.45
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	91.43
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	91.31
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	91.3
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	91.26
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	91.23
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	91.09
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	91.08
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	91.02
3jro_A		753	Fusion protein of protein transport protein SEC13	90.93
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	90.9
1pex_A		207	Collagenase-3, MMP-13; C-terminal hemopexin-like d	90.83
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	90.8
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	90.7
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	90.68
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	90.63
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	90.62
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	90.51
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	90.37
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	90.17
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	90.02
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	89.99
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	89.97
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	89.75
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	89.58
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	89.44
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	89.43
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	89.4
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	89.36
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	89.25
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	89.22
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	89.21
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	89.16
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	89.06
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	88.85
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	88.69
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	88.48
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	88.42
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	88.26
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	88.11
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	88.05
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	88.05
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	87.82
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	87.8
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	87.77
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	87.46
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	87.4
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	87.29
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	87.24
3b7f_A		394	Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop	87.08
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	86.9
3ott_A		758	Two-component system sensor histidine kinase; beta	86.87
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	86.69
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	86.44
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	86.39
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	86.3
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	86.19
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	85.81
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	84.77
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	84.67
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	84.57
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	84.33
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	84.23
2pm7_B		297	Protein transport protein SEC13, protein transport	84.09
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	83.89
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	83.68
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	83.54
1gen_A		218	Gelatinase A; hydrolase, hemopexin domain, metallo	83.04
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	83.02
1su3_A		450	Interstitial collagenase; prodomain, hemopexin dom	82.41
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	81.18
2pm7_B		297	Protein transport protein SEC13, protein transport	81.05
3ju4_A		670	Endo-N-acetylneuraminidase; endonf, polysia, high-	80.52

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

Probab=100.00  E-value=8.8e-44  Score=357.67  Aligned_cols=283  Identities=18%  Similarity=0.315  Sum_probs=239.2

Q ss_pred             CCCCCCccceEEEEEcCCCEEEEEcCcCCCCCCcCeEEEEECCCCeEEeeeccCCCCCCCCcceEEEECCEEEEEcCC--
Q 010011           26 SSGPGKRWGHTCNAIKGGRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGT--  103 (520)
Q Consensus        26 g~~P~~R~ghs~~~v~~g~~Iyi~GG~~~~~~~~~~~~~yd~~t~~W~~l~~~g~~P~~R~~hs~~~~~~~iyv~GG~--  103 (520)
                      ++.|.+|.+|+++.+  +++||++||..  ....+++++||+.+++|..++   ++|.+|.+|+++.++++||++||.  
T Consensus         9 ~~~~~~~~~~~~~~~--~~~i~v~GG~~--~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~   81 (308)
T 1zgk_A            9 HSSGLVPRGSHAPKV--GRLIYTAGGYF--RQSLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNN   81 (308)
T ss_dssp             ------------CCC--CCCEEEECCBS--SSBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEE
T ss_pred             ccCCeeeCCccccCC--CCEEEEEeCcC--CCCcceEEEEcCCCCeEeECC---CCCcccccceEEEECCEEEEECCCcC
Confidence            456779999999988  66899999982  346789999999999999974   889999999999999999999998  


Q ss_pred             --CCCCCCCcEEEEECCCCeEEeecccCCCCCCCCCceEEEECCEEEEEeCCCCCCCCCCcceeceeEEEEcCcceEEEc
Q 010011          104 --DGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA  181 (520)
Q Consensus       104 --~~~~~~~~~~~yd~~t~~W~~~~~~g~~p~~r~~hs~~~~~~~lyv~GG~~~~~~~~~~~~~~~v~~~d~~t~~W~~v  181 (520)
                        ++...++++++||+.+++|+.++   ++|.+|..|+++.++++|||+||..      ....++++++||+.+++|+.+
T Consensus        82 ~~~~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~------~~~~~~~~~~yd~~~~~W~~~  152 (308)
T 1zgk_A           82 SPDGNTDSSALDCYNPMTNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSH------GCIHHNSVERYEPERDEWHLV  152 (308)
T ss_dssp             ETTEEEECCCEEEEETTTTEEEECC---CCSSCCBTCEEEEETTEEEEECCEE------TTEECCCEEEEETTTTEEEEC
T ss_pred             CCCCCeecceEEEECCCCCeEeECC---CCCcCccccEEEEECCEEEEEcCCC------CCcccccEEEECCCCCeEeEC
Confidence              55567899999999999999987   7899999999999999999999963      335678999999999999999


Q ss_pred             ccCCCCCCCCcceeEEeeCCEEEEEecCCCCCcccCceEEEECCCCcEEEeeCCCCCCCCCceeEEEEECCEEEEEeccc
Q 010011          182 TTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFT  261 (520)
Q Consensus       182 ~~~~~~p~~r~~h~~~~~~~~lyv~GG~~~~~~~~~~i~~yd~~t~~W~~~~~~~~~p~~R~~hs~~~~~~~iyv~GG~~  261 (520)
                      +   ++|.+|..|+++.++++||++||.+... .++++++||+.+++|+.+..   +|.+|.+|+++.++++|||+||..
T Consensus       153 ~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~---~p~~r~~~~~~~~~~~iyv~GG~~  225 (308)
T 1zgk_A          153 A---PMLTRRIGVGVAVLNRLLYAVGGFDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVLHNCIYAAGGYD  225 (308)
T ss_dssp             C---CCSSCCBSCEEEEETTEEEEECCBCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBC
T ss_pred             C---CCCccccceEEEEECCEEEEEeCCCCCC-cCceEEEEeCCCCeEeeCCC---CCCccccceEEEECCEEEEEeCCC
Confidence            7   6899999999999999999999987665 48999999999999999976   889999999999999999999987


Q ss_pred             CCCCccCcEEEEecCCCcEEEeeeCCCCCCCceeeeeeeeccccCCEEEEEcccCCCCCccCceEeeeccccccccccc
Q 010011          262 DSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEK  340 (520)
Q Consensus       262 ~~~~~~~dv~~yd~~~~~W~~l~~~~~~p~~r~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~dv~~l~~~~~~~~~~~~  340 (520)
                      .. ...+++++||+++++|+.+.+   .|.+|..++++.+    +++|||+||.+.. ..+++++.|++....|..+..
T Consensus       226 ~~-~~~~~v~~yd~~~~~W~~~~~---~p~~r~~~~~~~~----~~~i~v~GG~~~~-~~~~~v~~yd~~~~~W~~~~~  295 (308)
T 1zgk_A          226 GQ-DQLNSVERYDVETETWTFVAP---MKHRRSALGITVH----QGRIYVLGGYDGH-TFLDSVECYDPDTDTWSEVTR  295 (308)
T ss_dssp             SS-SBCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEE----TTEEEEECCBCSS-CBCCEEEEEETTTTEEEEEEE
T ss_pred             CC-CccceEEEEeCCCCcEEECCC---CCCCccceEEEEE----CCEEEEEcCcCCC-cccceEEEEcCCCCEEeecCC
Confidence            53 458999999999999999875   4778888776554    7899999998764 567899999999988877644

PyMOL of 1zgk

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A*	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		520
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	2e-14
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	9e-10
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	2e-09
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	2e-08
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	1e-06
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	4e-06
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	4e-05
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	8e-05
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	1e-04

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure


class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.5 bits (173), Expect = 2e-14
 Identities = 43/285 (15%), Positives = 76/285 (26%), Gaps = 28/285 (9%)

Query: 43  GRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGG 102
           GR +Y  GGY       + +  ++  N TW +         PR   +   VG  LY  GG
Sbjct: 4   GRLIYTAGGY--FRQSLSYLEAYNPSNGTWLR---LADLQVPRSGLAGCVVGGLLYAVGG 58

Query: 103 T-DGMNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTND 161
             +  +   D   LD  +      S        R      ++   ++  GG     + N 
Sbjct: 59  RNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNS 118

Query: 162 EVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHI 221
              Y                       + R     +     +  +GG D     L+    
Sbjct: 119 VERYE---------PERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFD-GTNRLNSAEC 168

Query: 222 LDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWT 281
              +   W+ +         R+G         ++  GG+     L               
Sbjct: 169 YYPERNEWRMITAMNT---IRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE----TE 221

Query: 282 KVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMY 326
                      R ++          G +  +GG +     LD + 
Sbjct: 222 TWTFVAPMKHRRSALGITVHQ----GRIYVLGGYDGH-TFLDSVE 261

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		520
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.96
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.92
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	96.97
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	96.02
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	95.77
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	95.14
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	94.88
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	94.86
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	94.77
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	94.46
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	94.36
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	93.99
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	93.42
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	93.31
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	92.42
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	92.36
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	91.92
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	91.77
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	91.56
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	91.41
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	90.49
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	89.54
d1tbga_		340	beta1-subunit of the signal-transducing G protein	89.37
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	89.21
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	88.59
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	88.16
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	87.07
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	86.82
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	86.62
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	86.59
d1qhua1		192	Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId:	86.58
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	86.47
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	86.09
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	85.35
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	85.32
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	84.75
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	84.34
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	84.24
d1tbga_		340	beta1-subunit of the signal-transducing G protein	80.72
d1gena_		200	Gelatinase A (MMP-2), C-terminal domain {Human (Ho	80.39

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.7e-37  Score=299.46  Aligned_cols=269  Identities=18%  Similarity=0.333  Sum_probs=234.3

Q ss_pred             CCEEEEEcCcCCCCCCcCeEEEEECCCCeEEeeeccCCCCCCCCcceEEEECCEEEEEcCCCC----CCCCCcEEEEECC
Q 010011           43 GRFLYVFGGYGKDNCQTNQVHVFDTVNQTWSQPVIKGSPPTPRDSHSCTTVGENLYVFGGTDG----MNPLRDLHILDTS  118 (520)
Q Consensus        43 g~~Iyi~GG~~~~~~~~~~~~~yd~~t~~W~~l~~~g~~P~~R~~hs~~~~~~~iyv~GG~~~----~~~~~~~~~yd~~  118 (520)
                      |+.||+|||+...  ..+++++||+.+++|++++   ++|.+|.+|+++.++++|||+||...    ...++++|+||+.
T Consensus         4 g~~iyv~GG~~~~--~~~~~~~yd~~t~~W~~~~---~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~   78 (288)
T d1zgka1           4 GRLIYTAGGYFRQ--SLSYLEAYNPSNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPM   78 (288)
T ss_dssp             CCCEEEECCBSSS--BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETT
T ss_pred             CCEEEEECCcCCC--CCceEEEEECCCCeEEECC---CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccc
Confidence            6689999998643  6789999999999999965   89999999999999999999999742    3467899999999


Q ss_pred             CCeEEeecccCCCCCCCCCceEEEECCEEEEEeCCCCCCCCCCcceeceeEEEEcCcceEEEcccCCCCCCCCcceeEEe
Q 010011          119 SHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSS  198 (520)
Q Consensus       119 t~~W~~~~~~g~~p~~r~~hs~~~~~~~lyv~GG~~~~~~~~~~~~~~~v~~~d~~t~~W~~v~~~~~~p~~r~~h~~~~  198 (520)
                      +++|+.++   ++|.+|.+|++++++++||++||..      ....+++.++||+.+.+|....   .++.+|..|+++.
T Consensus        79 ~~~w~~~~---~~p~~r~~~~~~~~~~~i~~~gg~~------~~~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~  146 (288)
T d1zgka1          79 TNQWSPCA---PMSVPRNRIGVGVIDGHIYAVGGSH------GCIHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAV  146 (288)
T ss_dssp             TTEEEECC---CCSSCCBTCEEEEETTEEEEECCEE------TTEECCCEEEEETTTTEEEECC---CCSSCCBSCEEEE
T ss_pred             cccccccc---cccceecceeccccceeeEEeccee------cccccceeeeeccccCcccccc---ccccccccceeee
Confidence            99999887   7999999999999999999999953      4456788999999999999887   6788999999999


Q ss_pred             eCCEEEEEecCCCCCcccCceEEEECCCCcEEEeeCCCCCCCCCceeEEEEECCEEEEEecccCCCCccCcEEEEecCCC
Q 010011          199 WKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSG  278 (520)
Q Consensus       199 ~~~~lyv~GG~~~~~~~~~~i~~yd~~t~~W~~~~~~~~~p~~R~~hs~~~~~~~iyv~GG~~~~~~~~~dv~~yd~~~~  278 (520)
                      .+++++++||..... ..++++.||+.+++|.....   .+.++..++++..+++|+++||... ...+++++.||+.++
T Consensus       147 ~~~~~~~~GG~~~~~-~~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~~~~i~i~GG~~~-~~~~~~~~~~~~~~~  221 (288)
T d1zgka1         147 LNRLLYAVGGFDGTN-RLNSAECYYPERNEWRMITA---MNTIRSGAGVCVLHNCIYAAGGYDG-QDQLNSVERYDVETE  221 (288)
T ss_dssp             ETTEEEEECCBCSSC-BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCS-SSBCCCEEEEETTTT
T ss_pred             eeecceEecCccccc-ccceEEEeeccccccccccc---cccccccccccceeeeEEEecCccc-cccccceeeeeecce
Confidence            999999999987654 67889999999999998876   7788999999999999999999865 456789999999999


Q ss_pred             cEEEeeeCCCCCCCceeeeeeeeccccCCEEEEEcccCCCCCccCceEeeeccccccccccch
Q 010011          279 LWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKL  341 (520)
Q Consensus       279 ~W~~l~~~~~~p~~r~~~~~~~~~~~~~~~l~v~GG~~~~~~~~~dv~~l~~~~~~~~~~~~l  341 (520)
                      +|+.+.+   .|.+|..|+++.+    +++|||+||.+.. ..++++|.|++....|+.+..+
T Consensus       222 ~~~~~~~---~p~~r~~~~~~~~----~~~l~v~GG~~~~-~~~~~v~~yd~~~~~W~~~~~~  276 (288)
T d1zgka1         222 TWTFVAP---MKHRRSALGITVH----QGRIYVLGGYDGH-TFLDSVECYDPDTDTWSEVTRM  276 (288)
T ss_dssp             EEEECCC---CSSCCBSCEEEEE----TTEEEEECCBCSS-CBCCEEEEEETTTTEEEEEEEC
T ss_pred             eeecccC---ccCcccceEEEEE----CCEEEEEecCCCC-eecceEEEEECCCCEEEECCCC
Confidence            9999864   4778888776543    7899999998664 6778999999999888777543

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure