Citrus Sinensis ID: 010034

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
ccEEEEEccccccccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEccEEcccccccccccccccEEEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEccccccccccccccccccccccccccccEEEEcccccccccccccccEEEccEEEEEcccccccccccccccccEEEEEEcccccEEEEccccccccccccEEEEEEccEEEEEcccccccccccEEEEEcccccccccccccccccccccccEEEEccccEEEEcccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEc
ccccEccccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEcccccEEEEEcccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEcccccEEEEccccccccccccccEEEEEEccEEEEEEccccccccccEEEEccccccEEEEcccccccccccccEEEEEccEEEEEEccccccccccccHHcccEEEEccccccEEEccccccccccccccEEEEEccEEEEEEccccccccccHHHHcccEEEEcccccEEEEEccccccccccccEEEEEEccEEEEEEccccccccccEEEEcccccccEEEcccccccccccccccccEEEEEccEEccccccccccccccHccccccccccccccccccccccccEEcccEEEEEccccccccccEEEEccccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mhywvrasssdfggtvpqprsghsavnigkSKVVVFGGLVDKRFLSDVVVYDIdnklwfqpectgngsngqvgpgprAFHIAVAIDCHmfifggrfgsrrlgdfwvldtdiwqwseltsfgdlpsprdfAAASAIGNRKIVMYggwdgkkwlsDVYVLDTISLEwmqlpvtgsvppprcghtaTMVEKRLLIyggrggggpimGDLWALKGlieeenetpgwtqlklpgqapssrcghtitsgGHYLLLfgghgtggwlsrydiyynDTIILDRLSAQwkrlpigneppparayhsmTCLGSLYllfggfdgkstfgdiwwlvpeedpiakrytesppkvlpenkdvgmenynsqfavkeSQRESSAIVELQKKLDIsvslsrpglqimdeLEDEEFLELASRLMGagvfsngqvSRIQATQVLRDhwkkstprsipikelgpLLRDYQRLIARHLANLqstelglpgkeaytfyhlknssqMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
mhywvrasssdfggtvpqprsghsavnigKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSEltsfgdlpsPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQkkldisvslsrpglqiMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQvlrdhwkkstprsipikelgPLLRDYQRLIARHLANlqstelglpGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYggrggggPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSgghylllfgghgtggwlSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMdeledeeflelASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
*************************VNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL*******RCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE**************************************************I*V*****GLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLI*
MHYWVRASS******VPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLP***EPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPI********************ENYNSQFAVKESQRESSAIVELQKKLDISVS*********************************************************************************************FYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
**********************HSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL********CGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFA***********VELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
**YWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQMQTIHITAAKSLRNLACIITIYFQTYLAICFSDFLIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query519 2.2.26 [Sep-21-2011]
Q7M3S9 943 RING finger protein B OS= no no 0.456 0.251 0.289 2e-23
A8JAM0 1159 Coiled-coil domain-contai N/A no 0.337 0.150 0.342 2e-22
Q6AXB2366 Rab9 effector protein wit N/A no 0.516 0.732 0.263 1e-21
Q9V4C8 1500 Host cell factor OS=Droso yes no 0.560 0.194 0.282 2e-21
P51611 2090 Host cell factor 1 OS=Mes N/A no 0.572 0.142 0.289 4e-21
Q61191 2045 Host cell factor 1 OS=Mus yes no 0.572 0.145 0.289 4e-21
P87061 1147 Tip elongation aberrant p yes no 0.464 0.210 0.283 8e-21
P51610 2035 Host cell factor 1 OS=Hom no no 0.572 0.145 0.287 1e-20
Q5EA50372 Rab9 effector protein wit no no 0.510 0.712 0.294 1e-18
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.541 0.433 0.274 2e-18
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 122/259 (47%), Gaps = 22/259 (8%)

Query: 14  GTVPQPRSGHSAVNIGKS--------KVVVFGGLVDKRFLSDV-VVYDIDNKLWFQPECT 64
           G  P  R GHSAV             +++ FGG    +  SD+ ++Y   N+ +   + T
Sbjct: 62  GNAPSERYGHSAVLYQSQSRPYSDSYQIIFFGGRATSKPFSDINILYVNSNRSFIWKQVT 121

Query: 65  GNGSNGQVGPGPRAFHIAVAIDCHMFIFGG--RFGSRRLGDFWVLDTDIWQWSELTSFGD 122
                G      RA H AV    ++ +FGG     S+      +   +  +W +    G 
Sbjct: 122 TKSIEG------RAGHTAVVYRQNLVVFGGHNNHKSKYYNSVLLFSLESNEWRQQVCGGV 175

Query: 123 LPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHT 182
           +PS R   +   + N K+ ++GG+DGKK+ +D+Y LD  +  W ++   G+ P PR GH+
Sbjct: 176 IPSARATHSTFQVNNNKMFIFGGYDGKKYYNDIYYLDLETWIWKKVEAKGTPPKPRSGHS 235

Query: 183 ATMVE-KRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPG-QAPSSRCGHTI 240
           ATM++  +L+I+GG G     + D+  L   IE  NE   W Q    G + P +R  HT 
Sbjct: 236 ATMIQNNKLMIFGGCGSDSNFLNDIHILH--IEGANEYR-WEQPSYLGLEIPQARFRHTT 292

Query: 241 TSGGHYLLLFGGHGTGGWL 259
              G  + ++ G G+G  +
Sbjct: 293 NFIGGRVYIYAGTGSGNLM 311

Dictyostelium discoideum (taxid: 44689)
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
225449698507 PREDICTED: rab9 effector protein with ke 0.938 0.960 0.781 0.0
296090416509 unnamed protein product [Vitis vinifera] 0.938 0.956 0.774 0.0
255564088501 conserved hypothetical protein [Ricinus 0.930 0.964 0.776 0.0
224100649494 predicted protein [Populus trichocarpa] 0.915 0.961 0.728 0.0
356576309497 PREDICTED: acyl-CoA-binding domain-conta 0.930 0.971 0.736 0.0
334184721503 galactose oxidase/kelch repeat-containin 0.934 0.964 0.705 0.0
30686755496 galactose oxidase/kelch repeat-containin 0.922 0.965 0.709 0.0
356576311505 PREDICTED: acyl-CoA-binding domain-conta 0.930 0.956 0.724 0.0
334184717512 galactose oxidase/kelch repeat-containin 0.934 0.947 0.693 0.0
334184719511 galactose oxidase/kelch repeat-containin 0.934 0.949 0.694 0.0
>gi|225449698|ref|XP_002267817.1| PREDICTED: rab9 effector protein with kelch motifs-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/495 (78%), Positives = 434/495 (87%), Gaps = 8/495 (1%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           MHYWVRAS SDF GT+PQ RSGH+AVNIGKSK+VVFGGLVDKRF+SD+ VYDI+NKLWFQ
Sbjct: 1   MHYWVRASPSDFSGTLPQRRSGHTAVNIGKSKIVVFGGLVDKRFISDLCVYDIENKLWFQ 60

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSF 120
           PECTGNGS GQVGP PRAFHIA+AIDCHMF+FGGR G +RLGDFWVLDTDIWQWSELTSF
Sbjct: 61  PECTGNGSVGQVGPSPRAFHIAIAIDCHMFVFGGRSGGKRLGDFWVLDTDIWQWSELTSF 120

Query: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCG 180
           GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDV+VLDTISLEWM+L V+GS+PPPRCG
Sbjct: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVFVLDTISLEWMELSVSGSLPPPRCG 180

Query: 181 HTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTI 240
           HTATMVEKR+L+YGGRGGGGPIMGDLWALKGL+EEENETPGWTQLKLPGQAPS RCGHTI
Sbjct: 181 HTATMVEKRMLVYGGRGGGGPIMGDLWALKGLLEEENETPGWTQLKLPGQAPSPRCGHTI 240

Query: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCL 300
           TSGGHYLLLFGGHGTGGWLSRYDIYYN+ I+LDR+S QWKRLP  NEPPPARAYHSMTC+
Sbjct: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNECIVLDRVSVQWKRLPTSNEPPPARAYHSMTCI 300

Query: 301 GSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKE 360
           GS YLLFGGFDGKSTF D+WWLVPEEDPIAKR T SP K +PE+KD+ +    +Q + + 
Sbjct: 301 GSRYLLFGGFDGKSTFDDLWWLVPEEDPIAKRLTSSPAKNIPEDKDLAIAK-ETQLSHEA 359

Query: 361 SQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAG--VFSNGQVSRI 418
           SQ+E SA+ EL+K+LDISVS+S P LQI+DELED+EFLELA  L+G G  V SNGQ+S  
Sbjct: 360 SQKEESAVSELRKRLDISVSISVPELQIIDELEDKEFLELALSLIGVGEKVSSNGQISHT 419

Query: 419 QATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHL-----ANLQSTELGLPGKEAYT 473
           QA Q LRDHW +STP+ IP+KELGPLLRDYQRLI RH      ++ Q TE    GKEAY 
Sbjct: 420 QAAQALRDHWGESTPKLIPLKELGPLLRDYQRLITRHHTGNGPSDSQFTESCFSGKEAYR 479

Query: 474 FYHLKNSSQMQTIHI 488
           FYH+K++SQ++   I
Sbjct: 480 FYHVKSASQLRMDDI 494

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090416|emb|CBI40235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564088|ref|XP_002523042.1| conserved hypothetical protein [Ricinus communis] gi|223537725|gb|EEF39346.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224100649|ref|XP_002311962.1| predicted protein [Populus trichocarpa] gi|222851782|gb|EEE89329.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576309|ref|XP_003556275.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|334184721|ref|NP_001189691.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254150|gb|AEC09244.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30686755|ref|NP_850263.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|79324451|ref|NP_001031493.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|20260248|gb|AAM13022.1| unknown protein [Arabidopsis thaliana] gi|22136502|gb|AAM91329.1| unknown protein [Arabidopsis thaliana] gi|222423480|dbj|BAH19710.1| AT2G36360 [Arabidopsis thaliana] gi|330254146|gb|AEC09240.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254147|gb|AEC09241.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356576311|ref|XP_003556276.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|334184717|ref|NP_001189689.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254148|gb|AEC09242.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334184719|ref|NP_001189690.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254149|gb|AEC09243.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query519
UNIPROTKB|A8JAM0 1159 FAP50 "Coiled-coil domain-cont 0.331 0.148 0.337 3e-19
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.416 0.445 0.286 1.1e-18
DICTYBASE|DDB_G0272080 1523 gacHH "RhoGAP domain-containin 0.219 0.074 0.365 1.9e-18
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.418 0.230 0.284 1.6e-16
GENEDB_PFALCIPARUM|PF14_0630 889 PF14_0630 "protein serine/thre 0.414 0.241 0.272 5.4e-16
UNIPROTKB|Q8IKH5 889 PF14_0630 "Serine/threonine-pr 0.414 0.241 0.272 5.4e-16
UNIPROTKB|F1P3T0252 RABEPK "Rab9 effector protein 0.323 0.666 0.303 6.7e-16
UNIPROTKB|F1RZU3 2074 HCFC1 "Uncharacterized protein 0.420 0.105 0.316 1.3e-15
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.427 0.596 0.275 1.5e-15
UNIPROTKB|E1BGF3 2001 Bt.44379 "Uncharacterized prot 0.408 0.105 0.319 1.6e-15
UNIPROTKB|A8JAM0 FAP50 "Coiled-coil domain-containing protein lobo homolog" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 3.0e-19, P = 3.0e-19
 Identities = 61/181 (33%), Positives = 91/181 (50%)

Query:    14 GTVPQPRSGHSAV-NIGKSKVVVFGG-LVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQ 71
             G  P PR  H+A  +   +++VVFGG   +++ L+D+   D+D+  WF+P   G      
Sbjct:   344 GEKPPPRYNHAACYDEENNRLVVFGGRTAERKRLNDIYFLDLDSWTWFKPSTEGTA---- 399

Query:    72 VGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAA 131
               P PR   +A      M +FGG     R  D ++LD   WQWS+    G  PSPR  A 
Sbjct:   400 --PTPREQAVATFWAGSMVLFGGHAIGGRTNDLFLLDLGAWQWSQPAFSGTAPSPRQ-AC 456

Query:   132 ASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLL 191
             A  IG+  ++   G      L D++V+D +S  W ++P  G VPPPR  H  T+   +L 
Sbjct:   457 ALCIGHGNLLFVHGGRNNFVLEDLHVMDFVSKNWTEIPCEGRVPPPRHSHRITVHRDQLY 516

Query:   192 I 192
             +
Sbjct:   517 L 517
GO:0031514 "motile cilium" evidence=IDA
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0630 PF14_0630 "protein serine/threonine phosphatase" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IKH5 PF14_0630 "Serine/threonine-protein phosphatase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3T0 RABEPK "Rab9 effector protein with kelch motifs" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZU3 HCFC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGF3 Bt.44379 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034963001
SubName- Full=Chromosome chr13 scaffold_74, whole genome shotgun sequence; (447 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 4e-14
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-13
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 3e-11
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-09
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 8e-08
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-06
PLN02772398 PLN02772, PLN02772, guanylate kinase 6e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-05
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 5e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-04
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 7e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.001
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.001
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.002
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.003
smart0061247 smart00612, Kelch, Kelch domain 0.003
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information 
 Score = 73.1 bits (179), Expect = 4e-14
 Identities = 66/258 (25%), Positives = 98/258 (37%), Gaps = 10/258 (3%)

Query: 59  FQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRL--GDFWVLDTDIWQWSE 116
            Q         G  GPGPR  H    +   ++ FGG          D +V D +   WS 
Sbjct: 5   LQGGWIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSI 64

Query: 117 LTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEW---MQLPVTGS 173
             + GD+P              K+ ++GG D K+  SD Y  DT+  EW    +L   G 
Sbjct: 65  APANGDVPRISCLGVRMVAVGTKLYIFGGRDEKREFSDFYSYDTVKNEWTFLTKLDEEGG 124

Query: 174 VPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPG-WTQLKLPGQAP 232
            P  R  H+    E  + ++GG   GG +M      +  IE  N   G W QL  PG+  
Sbjct: 125 -PEARTFHSMASDENHVYVFGGVSKGG-LMKTPERFR-TIEAYNIADGKWVQLPDPGENF 181

Query: 233 SSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTI-ILDRLSAQWKRLPIGNEPPPA 291
             R G         + +  G  T         Y ++ +   D  S +W  +      P A
Sbjct: 182 EKRGGAGFAVVQGKIWVVYGFATSILPGGKSDYESNAVQFFDPASGKWTEVETTGAKPSA 241

Query: 292 RAYHSMTCLGSLYLLFGG 309
           R+  +   +G   ++FGG
Sbjct: 242 RSVFAHAVVGKYIIIFGG 259

Length = 341
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 519
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 99.98
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.95
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.76
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.7
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.62
PF1396450 Kelch_6: Kelch motif 99.16
PF1396450 Kelch_6: Kelch motif 99.08
PLN02772398 guanylate kinase 98.95
PF1341549 Kelch_3: Galactose oxidase, central domain 98.9
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.88
PF1341549 Kelch_3: Galactose oxidase, central domain 98.86
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.84
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.82
PLN02772398 guanylate kinase 98.78
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.78
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.72
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.62
PF1385442 Kelch_5: Kelch motif 98.6
smart0061247 Kelch Kelch domain. 98.56
PF1385442 Kelch_5: Kelch motif 98.56
smart0061247 Kelch Kelch domain. 98.5
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.44
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.39
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.26
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.25
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.19
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.98
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.12
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.69
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.49
PF12768281 Rax2: Cortical protein marker for cell polarity 96.26
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.1
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.84
PF12768281 Rax2: Cortical protein marker for cell polarity 95.62
KOG2055514 consensus WD40 repeat protein [General function pr 95.51
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.29
PRK13684334 Ycf48-like protein; Provisional 95.13
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.07
PRK13684334 Ycf48-like protein; Provisional 95.05
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.7
PRK04792448 tolB translocation protein TolB; Provisional 94.53
PRK05137435 tolB translocation protein TolB; Provisional 94.43
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.15
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.15
PRK04792448 tolB translocation protein TolB; Provisional 94.03
KOG2055514 consensus WD40 repeat protein [General function pr 93.81
PRK00178430 tolB translocation protein TolB; Provisional 93.77
PRK00178430 tolB translocation protein TolB; Provisional 93.65
PRK04922433 tolB translocation protein TolB; Provisional 93.63
PRK05137435 tolB translocation protein TolB; Provisional 93.62
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.15
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.48
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.08
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 92.05
PF09910339 DUF2139: Uncharacterized protein conserved in arch 91.97
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.89
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 91.62
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.44
PRK03629429 tolB translocation protein TolB; Provisional 91.25
PRK04922433 tolB translocation protein TolB; Provisional 91.15
KOG0310487 consensus Conserved WD40 repeat-containing protein 89.28
PRK04043419 tolB translocation protein TolB; Provisional 89.22
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 89.03
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 88.8
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.56
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.46
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.22
PRK02889427 tolB translocation protein TolB; Provisional 87.52
PLN00033398 photosystem II stability/assembly factor; Provisio 87.19
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 87.12
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 86.7
PRK04043419 tolB translocation protein TolB; Provisional 86.05
PRK11028330 6-phosphogluconolactonase; Provisional 85.96
PRK03629429 tolB translocation protein TolB; Provisional 85.17
COG4946 668 Uncharacterized protein related to the periplasmic 84.68
PLN00181793 protein SPA1-RELATED; Provisional 84.4
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 83.01
PF12217367 End_beta_propel: Catalytic beta propeller domain o 83.0
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.98
PRK11028330 6-phosphogluconolactonase; Provisional 81.96
PRK02889427 tolB translocation protein TolB; Provisional 81.49
PF12217367 End_beta_propel: Catalytic beta propeller domain o 81.36
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 80.29
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=6e-48  Score=354.69  Aligned_cols=352  Identities=22%  Similarity=0.334  Sum_probs=294.4

Q ss_pred             CceeEEceeCCCCCCCCCCCcceEEEEECCcEEEEEcCcCCCc-----cCCcEEEEEcCCCcEEeeeec--CCCC--CCC
Q 010034            1 MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKR-----FLSDVVVYDIDNKLWFQPECT--GNGS--NGQ   71 (519)
Q Consensus         1 ~~~W~~~~~~~~~g~~P~~R~gh~~~~~~~~~lyv~GG~~~~~-----~~~~~~~yd~~~~~W~~l~~~--~~~~--~~~   71 (519)
                      |++|+--.+      --+.|.+|+++.++ .+||.|||+-.+.     .--|+.++|..+-+|++++..  ....  ..+
T Consensus         1 m~~WTVHLe------GGPrRVNHAavaVG-~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp   73 (392)
T KOG4693|consen    1 MATWTVHLE------GGPRRVNHAAVAVG-SRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYP   73 (392)
T ss_pred             CceEEEEec------CCcccccceeeeec-ceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCC
Confidence            788988773      23579999999999 6999999975432     334899999999999999762  2111  234


Q ss_pred             CCCCCcceeEEEEeCCeEEEEccccC-CcCCCcEEEEECCCCeEEEEeeCCCCCCCCCccEEEEECCcEEEEEecCCC--
Q 010034           72 VGPGPRAFHIAVAIDCHMFIFGGRFG-SRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDG--  148 (519)
Q Consensus        72 ~~p~~R~~h~~~~~~~~iyv~GG~~~-~~~~~dv~~yd~~t~~W~~~~~~g~~P~~r~~~~~~~~~~~~iyv~GG~~~--  148 (519)
                      ..|-.|++|+.+.+++++||+||++. ....|.++.||+++++|......|-+|.+|.+|++|++++ .+|||||+..  
T Consensus        74 ~VPyqRYGHtvV~y~d~~yvWGGRND~egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn-~MyiFGGye~~a  152 (392)
T KOG4693|consen   74 AVPYQRYGHTVVEYQDKAYVWGGRNDDEGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGN-QMYIFGGYEEDA  152 (392)
T ss_pred             ccchhhcCceEEEEcceEEEEcCccCcccccceeeeeccccccccccceeeecCCccCCceeeEECc-EEEEecChHHHH
Confidence            55677999999999999999999987 5667889999999999999888889999999999999987 9999999964  


Q ss_pred             CcCCCcEEEEECCCCcEEEeccCCCCCCcccCeeEEEeCCEEEEEcccCCCCCc---ccccccccccccccCCCCceEEe
Q 010034          149 KKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPI---MGDLWALKGLIEEENETPGWTQL  225 (519)
Q Consensus       149 ~~~~~~v~~yd~~t~~W~~l~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~---~~d~~~l~~v~~Yd~~t~~W~~i  225 (519)
                      ..+.++++.+|+.|.+|+.+.+.|..|.-|..|+++++++.+|||||+++....   .++.+ ++.+..+|..+..|...
T Consensus       153 ~~FS~d~h~ld~~TmtWr~~~Tkg~PprwRDFH~a~~~~~~MYiFGGR~D~~gpfHs~~e~Y-c~~i~~ld~~T~aW~r~  231 (392)
T KOG4693|consen  153 QRFSQDTHVLDFATMTWREMHTKGDPPRWRDFHTASVIDGMMYIFGGRSDESGPFHSIHEQY-CDTIMALDLATGAWTRT  231 (392)
T ss_pred             HhhhccceeEeccceeeeehhccCCCchhhhhhhhhhccceEEEeccccccCCCccchhhhh-cceeEEEeccccccccC
Confidence            468899999999999999999999989999999999999999999999875432   22333 47888999999999999


Q ss_pred             cCCCCCCCCcceeEEEEeCCEEEEEeccCCCCCcccccceeCcEEEEEcCCCeEEEcccCCCCCCCCcceEEEEeCCEEE
Q 010034          226 KLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYL  305 (519)
Q Consensus       226 ~~~g~~P~~r~~~s~~~~~~~iyv~GG~~~~~~~~~~~~~~~~v~~yd~~t~~W~~v~~~~~~p~~R~~~~~v~~~~~iy  305 (519)
                      +..+..|..|..|++.++++++|+|||+.+.-     +.-.|++|.|||.+..|+.+...+..|++|..+++++.++++|
T Consensus       232 p~~~~~P~GRRSHS~fvYng~~Y~FGGYng~l-----n~HfndLy~FdP~t~~W~~I~~~Gk~P~aRRRqC~~v~g~kv~  306 (392)
T KOG4693|consen  232 PENTMKPGGRRSHSTFVYNGKMYMFGGYNGTL-----NVHFNDLYCFDPKTSMWSVISVRGKYPSARRRQCSVVSGGKVY  306 (392)
T ss_pred             CCCCcCCCcccccceEEEcceEEEecccchhh-----hhhhcceeecccccchheeeeccCCCCCcccceeEEEECCEEE
Confidence            88778999999999999999999999987632     3567999999999999999999998999999999999999999


Q ss_pred             EEccCCCCCCccceEEecCCCcccccccccCCCCCCCCCCcccccccccceecCCcccceeeeeecccccCceecc
Q 010034          306 LFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSL  381 (519)
Q Consensus       306 v~GG~~~~~~~~D~w~l~~~~d~~~~~w~~~~~~~~p~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~  381 (519)
                      +|||........        -. .++.--.+++..+.+...+|+      |++.|++++++.+.+|+++++++.+-
T Consensus       307 LFGGTsP~~~~~--------~S-pt~~~G~~~~~~LiD~SDLHv------LDF~PsLKTLa~~~Vl~~~ldqs~Lp  367 (392)
T KOG4693|consen  307 LFGGTSPLPCHP--------LS-PTNYNGMISPSGLIDLSDLHV------LDFAPSLKTLAMQSVLMFELDQSELP  367 (392)
T ss_pred             EecCCCCCCCCC--------CC-ccccCCCCCccccccccccee------eecChhHHHHHHHHHHHHhhhhhhcc
Confidence            999976421110        00 112222455667778888888      99999999999999999999988773

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query519
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-54
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-40
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-30
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-23
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-20
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-16
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-10
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-15
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-09
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 8e-22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-15
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 3e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  191 bits (487), Expect = 9e-54
 Identities = 58/334 (17%), Positives = 106/334 (31%), Gaps = 36/334 (10%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           +    +    +     P  R        G + V   GG    R +++++   I       
Sbjct: 373 VDEDYQLLECEC----PINRKFGDVDVAG-NDVFYMGGSNPYR-VNEILQLSIHYDKIDM 426

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAI--DCHMFIFGGRFGSRR-LGDFWVLDTDIWQWSEL 117
                + S     P  R  H    I  +  + + GGR    + L D W+ D    +WS +
Sbjct: 427 KNIEVSSSEV---PVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 118 TSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPP 177
                L   R   +A ++ +  +++ GG         + + +     +  +         
Sbjct: 484 ---KSLSHTRFRHSACSLPDGNVLILGGVTEG---PAMLLYNVTEEIFKDVTPKDEFFQN 537

Query: 178 RCGHTA----TMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPS 233
                      + ++ +++ GG      +       K   + EN T   T +K       
Sbjct: 538 SLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFK--YDAENATEPITVIKKLQHPLF 595

Query: 234 SRCGHTITS-GGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGN----EP 288
            R G  I       LL+ GG    G         N  I LD LS     +PI      + 
Sbjct: 596 QRYGSQIKYITPRKLLIVGGTSPSGLFD----RTNSIISLDPLSETLTSIPISRRIWEDH 651

Query: 289 PPARAYHSMTCL--GSLYLLFGGFDGKSTFGDIW 320
               A  S+     G+++++ GG      FG + 
Sbjct: 652 SLMLAGFSLVSTSMGTIHIIGGGATCYG-FGSVT 684
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.98
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.65
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.59
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.46
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.38
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.27
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.26
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.22
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.08
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.0
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.97
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.95
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.93
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.9
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.89
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.86
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.66
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.6
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.56
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.56
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.54
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.48
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.47
3jrp_A379 Fusion protein of protein transport protein SEC13 96.47
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.41
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.4
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.28
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.27
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.25
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.25
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.22
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.12
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.02
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.95
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.92
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.89
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.89
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.89
3jro_A 753 Fusion protein of protein transport protein SEC13 95.88
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.82
3ott_A758 Two-component system sensor histidine kinase; beta 95.79
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.75
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.56
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.56
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.5
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.5
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.44
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.39
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.36
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.33
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.32
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.3
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.21
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.21
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.2
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.1
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.07
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.02
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.98
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.98
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.88
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 94.87
3jrp_A379 Fusion protein of protein transport protein SEC13 94.87
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 94.82
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.78
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 94.69
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.68
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.52
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.48
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.46
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.41
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.28
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.28
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.26
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.24
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.21
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.14
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.13
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.1
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.09
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.03
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.02
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 93.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.83
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 93.83
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 93.82
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.77
3ott_A 758 Two-component system sensor histidine kinase; beta 93.74
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.59
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.55
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.48
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.47
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.47
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.39
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 93.28
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.17
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.03
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.01
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.99
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.92
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.89
2pm7_B297 Protein transport protein SEC13, protein transport 92.84
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 92.81
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 92.79
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.68
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.6
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.57
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.51
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.5
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 92.43
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.28
3jro_A 753 Fusion protein of protein transport protein SEC13 92.27
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.23
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.17
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.16
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.16
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 92.05
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.89
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 91.7
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 91.67
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 91.58
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.48
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 91.42
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 91.37
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 91.17
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 91.16
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 91.1
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 90.99
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 90.99
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 90.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 90.9
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 90.86
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.78
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.58
2fp8_A322 Strictosidine synthase; six bladed beta propeller 90.47
1itv_A195 MMP9; adaptive molecular recognition, beta propell 90.08
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 90.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 89.99
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 89.87
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 89.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 89.64
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.59
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.53
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 89.25
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.24
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 89.11
2xyi_A430 Probable histone-binding protein CAF1; transcripti 89.08
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 88.71
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 88.58
1itv_A195 MMP9; adaptive molecular recognition, beta propell 88.58
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 88.37
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 88.1
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 87.32
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 87.23
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 87.18
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.12
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 86.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.93
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 86.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.83
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.43
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 86.33
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 86.21
2fp8_A322 Strictosidine synthase; six bladed beta propeller 86.16
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 86.06
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 85.77
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.76
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 85.74
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 85.72
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 85.72
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 85.64
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 85.19
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 85.14
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.04
2pm7_B297 Protein transport protein SEC13, protein transport 84.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 84.93
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 84.33
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.8
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 81.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 81.74
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.73
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 81.47
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 80.6
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 80.42
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=2.9e-47  Score=381.75  Aligned_cols=290  Identities=19%  Similarity=0.255  Sum_probs=248.2

Q ss_pred             CCCCCCCcceEEEEECCcEEEEEcCcCCCccCCcEEEEEcCCCcEEeeeecCCCCCCCCCCCCcceeEEEEeCCeEEEEc
Q 010034           14 GTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFG   93 (519)
Q Consensus        14 g~~P~~R~gh~~~~~~~~~lyv~GG~~~~~~~~~~~~yd~~~~~W~~l~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~G   93 (519)
                      ++.|.+|.+|+++.++ +.||+|||. ....++++++||+.+++|+.++         ++|.+|.+|++++++++||++|
T Consensus         9 ~~~~~~~~~~~~~~~~-~~i~v~GG~-~~~~~~~~~~~d~~~~~W~~~~---------~~p~~r~~~~~~~~~~~lyv~G   77 (308)
T 1zgk_A            9 HSSGLVPRGSHAPKVG-RLIYTAGGY-FRQSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAVG   77 (308)
T ss_dssp             ------------CCCC-CCEEEECCB-SSSBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEEC
T ss_pred             ccCCeeeCCccccCCC-CEEEEEeCc-CCCCcceEEEEcCCCCeEeECC---------CCCcccccceEEEECCEEEEEC
Confidence            4678899999999988 699999998 5678899999999999999985         5789999999999999999999


Q ss_pred             cc----cCCcCCCcEEEEECCCCeEEEEeeCCCCCCCCCccEEEEECCcEEEEEecCCCCcCCCcEEEEECCCCcEEEec
Q 010034           94 GR----FGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLP  169 (519)
Q Consensus        94 G~----~~~~~~~dv~~yd~~t~~W~~~~~~g~~P~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~l~  169 (519)
                      |.    .+...++++++||+.+++|++++   ++|.+|..|+++++++ +||++||.++....+++++||+.+++|+.++
T Consensus        78 G~~~~~~~~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~-~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~  153 (308)
T 1zgk_A           78 GRNNSPDGNTDSSALDCYNPMTNQWSPCA---PMSVPRNRIGVGVIDG-HIYAVGGSHGCIHHNSVERYEPERDEWHLVA  153 (308)
T ss_dssp             CEEEETTEEEECCCEEEEETTTTEEEECC---CCSSCCBTCEEEEETT-EEEEECCEETTEECCCEEEEETTTTEEEECC
T ss_pred             CCcCCCCCCeecceEEEECCCCCeEeECC---CCCcCccccEEEEECC-EEEEEcCCCCCcccccEEEECCCCCeEeECC
Confidence            98    55567899999999999999998   6999999999999965 9999999988778899999999999999998


Q ss_pred             cCCCCCCcccCeeEEEeCCEEEEEcccCCCCCcccccccccccccccCCCCceEEecCCCCCCCCcceeEEEEeCCEEEE
Q 010034          170 VTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLL  249 (519)
Q Consensus       170 ~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~d~~~l~~v~~Yd~~t~~W~~i~~~g~~P~~r~~~s~~~~~~~iyv  249 (519)
                         ++|.+|.+|+++.++++|||+||.....       .++.+++||+.+++|+.++   ++|.+|.+|++++.+++|||
T Consensus       154 ---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-------~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv  220 (308)
T 1zgk_A          154 ---PMLTRRIGVGVAVLNRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYA  220 (308)
T ss_dssp             ---CCSSCCBSCEEEEETTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEE
T ss_pred             ---CCCccccceEEEEECCEEEEEeCCCCCC-------cCceEEEEeCCCCeEeeCC---CCCCccccceEEEECCEEEE
Confidence               8999999999999999999999987654       2577889999999999998   78999999999999999999


Q ss_pred             EeccCCCCCcccccceeCcEEEEEcCCCeEEEcccCCCCCCCCcceEEEEeCCEEEEEccCCCCCCccceEEecCCCccc
Q 010034          250 FGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPI  329 (519)
Q Consensus       250 ~GG~~~~~~~~~~~~~~~~v~~yd~~t~~W~~v~~~~~~p~~R~~~~~v~~~~~iyv~GG~~~~~~~~D~w~l~~~~d~~  329 (519)
                      +||.....       ..+++++||+.+++|+.++.   .|.+|..|+++.++++|||+||.++...++++|.|    |+.
T Consensus       221 ~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~---~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~y----d~~  286 (308)
T 1zgk_A          221 AGGYDGQD-------QLNSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECY----DPD  286 (308)
T ss_dssp             ECCBCSSS-------BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEE----ETT
T ss_pred             EeCCCCCC-------ccceEEEEeCCCCcEEECCC---CCCCccceEEEEECCEEEEEcCcCCCcccceEEEE----cCC
Confidence            99987543       57999999999999999986   46799999999999999999999887778887754    556


Q ss_pred             ccccccCCCCCCCCCC
Q 010034          330 AKRYTESPPKVLPENK  345 (519)
Q Consensus       330 ~~~w~~~~~~~~p~~~  345 (519)
                      +++|+..++++.++..
T Consensus       287 ~~~W~~~~~~p~~r~~  302 (308)
T 1zgk_A          287 TDTWSEVTRMTSGRSG  302 (308)
T ss_dssp             TTEEEEEEECSSCCBS
T ss_pred             CCEEeecCCCCCCccc
Confidence            7788888777766544
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 519
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 9e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-07
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.6 bits (150), Expect = 2e-11
 Identities = 42/301 (13%), Positives = 89/301 (29%), Gaps = 34/301 (11%)

Query: 27  NIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAID 86
            +G+  +   GG   ++ LS +  Y+  N  W +               PR+      + 
Sbjct: 2   KVGR-LIYTAGGY-FRQSLSYLEAYNPSNGTWLR---------LADLQVPRSGLAGCVVG 50

Query: 87  CHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGW 146
             ++  GGR  S          + +  ++ +T+     +P                    
Sbjct: 51  GLLYAVGGRNNSPDGNTDS---SALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAV 107

Query: 147 DGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDL 206
            G         ++    E  +  +   +   R G    ++ + L   GG           
Sbjct: 108 GGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF---------- 157

Query: 207 WALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY 266
                L   E   P   + ++     + R G  +    + +   GG+     L+  + Y 
Sbjct: 158 DGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD 217

Query: 267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE 326
            +T     ++    R          R+   +T       + GG+DG +    +    P+ 
Sbjct: 218 VETETWTFVAPMKHR----------RSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDT 267

Query: 327 D 327
           D
Sbjct: 268 D 268
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query519
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.68
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.56
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.29
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 94.63
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.6
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.34
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.19
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.04
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.88
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.74
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.7
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.7
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 92.6
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 92.01
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.91
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.84
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 91.57
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 91.53
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.21
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 90.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 90.31
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 89.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.41
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 89.25
d1tbga_340 beta1-subunit of the signal-transducing G protein 88.67
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 88.43
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 88.22
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 87.76
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 87.65
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 87.47
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 87.08
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 86.2
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 82.98
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 82.45
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 81.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 81.82
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 81.65
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 81.62
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 80.63
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-40  Score=324.27  Aligned_cols=274  Identities=18%  Similarity=0.254  Sum_probs=243.2

Q ss_pred             cEEEEEcCcCCCccCCcEEEEEcCCCcEEeeeecCCCCCCCCCCCCcceeEEEEeCCeEEEEccccC----CcCCCcEEE
Q 010034           31 SKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFG----SRRLGDFWV  106 (519)
Q Consensus        31 ~~lyv~GG~~~~~~~~~~~~yd~~~~~W~~l~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~GG~~~----~~~~~dv~~  106 (519)
                      +.||||||.. ...++++++||+.+++|+.++         ++|.+|.+|++++++++|||+||...    ...++++++
T Consensus         5 ~~iyv~GG~~-~~~~~~~~~yd~~t~~W~~~~---------~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~   74 (288)
T d1zgka1           5 RLIYTAGGYF-RQSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDC   74 (288)
T ss_dssp             CCEEEECCBS-SSBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEE
T ss_pred             CEEEEECCcC-CCCCceEEEEECCCCeEEECC---------CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhh
Confidence            5899999986 467899999999999999985         57999999999999999999999753    345789999


Q ss_pred             EECCCCeEEEEeeCCCCCCCCCccEEEEECCcEEEEEecCCCCcCCCcEEEEECCCCcEEEeccCCCCCCcccCeeEEEe
Q 010034          107 LDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMV  186 (519)
Q Consensus       107 yd~~t~~W~~~~~~g~~P~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~l~~~~~~p~~r~~~~~~~~  186 (519)
                      ||+.+++|++++   ++|.+|..|+++++++ ++|++||..+....++.+.||+.+++|....   .++.+|.+|+++.+
T Consensus        75 yd~~~~~w~~~~---~~p~~r~~~~~~~~~~-~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~~  147 (288)
T d1zgka1          75 YNPMTNQWSPCA---PMSVPRNRIGVGVIDG-HIYAVGGSHGCIHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAVL  147 (288)
T ss_dssp             EETTTTEEEECC---CCSSCCBTCEEEEETT-EEEEECCEETTEECCCEEEEETTTTEEEECC---CCSSCCBSCEEEEE
T ss_pred             cccccccccccc---cccceecceeccccce-eeEEecceecccccceeeeeccccCcccccc---ccccccccceeeee
Confidence            999999999988   6999999999999965 9999999988888999999999999999987   88899999999999


Q ss_pred             CCEEEEEcccCCCCCcccccccccccccccCCCCceEEecCCCCCCCCcceeEEEEeCCEEEEEeccCCCCCccccccee
Q 010034          187 EKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY  266 (519)
Q Consensus       187 ~~~lyv~GG~~~~~~~~~d~~~l~~v~~Yd~~t~~W~~i~~~g~~P~~r~~~s~~~~~~~iyv~GG~~~~~~~~~~~~~~  266 (519)
                      ++++|++||.....       .++.++.||+.+++|....   ..+.++..++++..+++|+++||.....       ..
T Consensus       148 ~~~~~~~GG~~~~~-------~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~i~i~GG~~~~~-------~~  210 (288)
T d1zgka1         148 NRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQD-------QL  210 (288)
T ss_dssp             TTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSSS-------BC
T ss_pred             eecceEecCccccc-------ccceEEEeecccccccccc---ccccccccccccceeeeEEEecCccccc-------cc
Confidence            99999999986544       3567888999999999988   6788889999999999999999987654       77


Q ss_pred             CcEEEEEcCCCeEEEcccCCCCCCCCcceEEEEeCCEEEEEccCCCCCCccceEEecCCCcccccccccCCCCCCCCCC
Q 010034          267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENK  345 (519)
Q Consensus       267 ~~v~~yd~~t~~W~~v~~~~~~p~~R~~~~~v~~~~~iyv~GG~~~~~~~~D~w~l~~~~d~~~~~w~~~~~~~~p~~~  345 (519)
                      ++.++||+.+++|..++.   .|.+|..|+++.++++|||+||.++...++++|+    ||+.+++|+..+++|.++..
T Consensus       211 ~~~~~~~~~~~~~~~~~~---~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~----yd~~~~~W~~~~~~p~~R~~  282 (288)
T d1zgka1         211 NSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVEC----YDPDTDTWSEVTRMTSGRSG  282 (288)
T ss_dssp             CCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEE----EETTTTEEEEEEECSSCCBS
T ss_pred             cceeeeeecceeeecccC---ccCcccceEEEEECCEEEEEecCCCCeecceEEE----EECCCCEEEECCCCCCCcEe
Confidence            899999999999999986   4679999999999999999999998888899775    46667889999877777644
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure