Citrus Sinensis ID: 010087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MVLHKVQIRNLLYRKLLMLQQSALRQILKLPSLRRKNIETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP
cccccHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHcHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccEEEEEEEccccccccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccccccccccccccccEEEEEcccccccHHcHHHHHHHHHHHcccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHcccHHHcccHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEccccccccEEEEEEEEEcccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHccEEEEEEccccEEHHHHHHHHHccccEccccEcccccEEEEccHHHccccHHHHHHHHHHHHHHccccccccccccc
MVLHKVQIRNLLYRKLLMLQQSALRQILklpslrrknietdsnlagtedsphesgskfderpieEEAVLSYQRKVTVLYELLSACLadipqhdkkctrqrtgydsRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASkeeeatsseskwakwkrggiigaaaltggTLMAITGGLAAPAIAAGFSalaptlgtlipvigaSGFAAAASAAGTVAGSVAVAASfgaagagltgskmarrigsvdefefkaigenqnqGRLAVEILISgvvfdqedfvrpwegqndnmERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLidskwtiavdRSDKAGKLLAEVLMQGlqgyrpvtligYSLGARVIFKCLENLAENECNAGIVERVVLLgapisikdQNWEAVRKMVAGRFIncyatndwTLAIAFRASLLSQglagiqpinglgienidvthlieghsSYLWASQLILERLeldtyypvfrrap
MVLHKVQIRNLLYRKLLMLQQSALRqilklpslrrknietdsnlagtedsphesgskfderpiEEEAVLSYQRKVTVLYELLSACladipqhdkkctrqrtgydsrhrVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEAskeeeatsseskwakwkrGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP
MVLHKVQIRNLLYRKLLMLQQSALRQILKLPSLRRKNIETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKmeavemmvassamavRkaeaskeeeatsseskwakWKRggiigaaaltggtlmaitgglaaPAIAAGFSALAPTLGTLIPVIgasgfaaaasaagtvagsvavaasfgaagagltgsKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVlktllaalawpatlVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP
***HKVQIRNLLYRKLLMLQQSALRQILKL************************************AVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVA***********************WAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVF****
**********************************************************************YQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVAS******************************IIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYP*F*R**
MVLHKVQIRNLLYRKLLMLQQSALRQILKLPSLRRKNIETDS*****************ERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVAS***********************AKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP
*VLHKVQIRNLLYRKLLMLQQSALRQILKLPS*********************************EAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRR**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLHKVQIRNLLYRKLLMLQQSALRQILKLPSLRRKNIETDSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q91WU4 631 Transmembrane and coiled- yes no 0.544 0.446 0.408 1e-56
Q20035617 Uncharacterized membrane yes no 0.723 0.607 0.355 2e-56
Q5TGY1 634 Transmembrane and coiled- yes no 0.722 0.589 0.371 1e-54
Q499U8 631 Transmembrane and coiled- yes no 0.573 0.470 0.388 2e-54
O14244778 Uncharacterized membrane yes no 0.737 0.491 0.342 2e-46
P43564 1073 Uncharacterized membrane yes no 0.808 0.390 0.300 3e-43
Q9US10579 Uncharacterized membrane no no 0.611 0.547 0.341 1e-38
>sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 120/294 (40%), Positives = 184/294 (62%), Gaps = 12/294 (4%)

Query: 205 VIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQ 264
           +IG++G    A+A G+VAG   + + FGAAGAGLTG KM +R+G+++EF F  + E +  
Sbjct: 219 IIGSAG----AAALGSVAGIAVMTSLFGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGR-- 272

Query: 265 GRLAVEILISGVVFD--QEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIA 322
            +L + I I+G +       F  PW     + E+Y L WE+K L+ +  A++  L S +A
Sbjct: 273 -QLHITIAITGWLGSGRYRTFNAPWMALARSQEQYCLAWEAKYLMELGNALETIL-SGLA 330

Query: 323 MELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQ 382
             + ++    TVL  ++AAL WPA+L+  A++ID+ W + + RS + GK LA +L+   Q
Sbjct: 331 NMVAQEALKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQ 390

Query: 383 GYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAG 442
           G RPVTLIG+SLGARVI+ CL+ +A+ +   GI+E VVLLGAP+    ++WE  R +V+G
Sbjct: 391 GRRPVTLIGFSLGARVIYFCLQEMAQEQDCQGIIEDVVLLGAPVEGDPKHWEPFRNVVSG 450

Query: 443 RFINCYATNDWTLAIAFRASLLSQGLAGIQPI--NGLGIENIDVTHLIEGHSSY 494
           R IN Y   DW L+  +R S +   +AG+QP+      +EN+D+T ++ GH  Y
Sbjct: 451 RIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDRRMENVDLTSVVNGHLDY 504

Mus musculus (taxid: 10090)
>sp|Q20035|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2 Back     alignment and function description
>sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 Back     alignment and function description
>sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 Back     alignment and function description
>sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 Back     alignment and function description
>sp|P43564|YFD4_YEAST Uncharacterized membrane protein YFL034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL034W PE=1 SV=2 Back     alignment and function description
>sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
225431211 662 PREDICTED: transmembrane and coiled-coil 0.922 0.722 0.780 0.0
224097118 681 predicted protein [Populus trichocarpa] 0.915 0.696 0.789 0.0
147790173 670 hypothetical protein VITISV_012480 [Viti 0.888 0.686 0.716 0.0
449457502 673 PREDICTED: transmembrane and coiled-coil 0.878 0.676 0.804 0.0
449515253 673 PREDICTED: transmembrane and coiled-coil 0.878 0.676 0.804 0.0
297802312550 hypothetical protein ARALYDRAFT_912740 [ 0.955 0.9 0.712 0.0
255586316 713 conserved hypothetical protein [Ricinus 0.888 0.645 0.798 0.0
145361370550 uncharacterized protein [Arabidopsis tha 0.955 0.9 0.703 0.0
186516803 672 uncharacterized protein [Arabidopsis tha 0.955 0.736 0.703 0.0
42569121 656 uncharacterized protein [Arabidopsis tha 0.920 0.727 0.738 0.0
>gi|225431211|ref|XP_002272351.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4 [Vitis vinifera] gi|297735050|emb|CBI17412.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/478 (78%), Positives = 425/478 (88%)

Query: 41  DSNLAGTEDSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQR 100
           + N    E +P+ S SKFDE+P+EE A+L+Y RKVTVLYELLSACL D P+ +KK TR+R
Sbjct: 180 NCNELSIEQTPYGSSSKFDEKPVEEVAMLNYPRKVTVLYELLSACLTDTPEDNKKSTRKR 239

Query: 101 TGYDSRHRVALRLLATWLDIKWIKMEAVEMMVASSAMAVRKAEASKEEEATSSESKWAKW 160
            GYD+RHRVALRLLATWLDI+W K+EA+E+MVA SAMA+ K +ASKEEE  S +S+W KW
Sbjct: 240 KGYDARHRVALRLLATWLDIQWKKVEAMEIMVACSAMALSKEQASKEEETQSPKSQWTKW 299

Query: 161 KRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAAGT 220
           KRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGT+IPVIGASGFAAAASAAGT
Sbjct: 300 KRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGASGFAAAASAAGT 359

Query: 221 VAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQ 280
           VAGSVA+AASFGAAGAGLTGSKMARR GSVDEFEFKAIGEN NQGRLAVEIL+SG VF +
Sbjct: 360 VAGSVAIAASFGAAGAGLTGSKMARRTGSVDEFEFKAIGENHNQGRLAVEILVSGFVFQE 419

Query: 281 EDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLA 340
           EDF+ PWEGQN+N+ERY LQWESKNLIAVSTAIQDWLTS IA+ +MKQGAM+TVL TL+ 
Sbjct: 420 EDFISPWEGQNNNLERYALQWESKNLIAVSTAIQDWLTSSIALSMMKQGAMLTVLSTLMT 479

Query: 341 ALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIF 400
           ALAWPATL+ A D IDSKWTIA+DRSDKAGKLLAEVL +GLQG RPVTL+GYSLGARVIF
Sbjct: 480 ALAWPATLLAATDFIDSKWTIALDRSDKAGKLLAEVLQKGLQGNRPVTLVGYSLGARVIF 539

Query: 401 KCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFR 460
           KCL+ LAE E NA +VERVVLLGAPIS +D+NWE  RKMVAGRF+N ++TNDWTL +AFR
Sbjct: 540 KCLQYLAETEQNAELVERVVLLGAPISFRDENWEVARKMVAGRFVNAFSTNDWTLGVAFR 599

Query: 461 ASLLSQGLAGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRAP 518
           A+LL++GLAGIQP++  GIEN+DVT LIEGHSSYLW ++ IL+RLELDTYYPVFR +P
Sbjct: 600 ANLLTKGLAGIQPVDVPGIENVDVTELIEGHSSYLWVTEDILDRLELDTYYPVFRGSP 657

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224097118|ref|XP_002310840.1| predicted protein [Populus trichocarpa] gi|222853743|gb|EEE91290.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147790173|emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457502|ref|XP_004146487.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515253|ref|XP_004164664.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297802312|ref|XP_002869040.1| hypothetical protein ARALYDRAFT_912740 [Arabidopsis lyrata subsp. lyrata] gi|297314876|gb|EFH45299.1| hypothetical protein ARALYDRAFT_912740 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255586316|ref|XP_002533809.1| conserved hypothetical protein [Ricinus communis] gi|223526263|gb|EEF28578.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|145361370|ref|NP_849505.2| uncharacterized protein [Arabidopsis thaliana] gi|332661233|gb|AEE86633.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186516803|ref|NP_001078500.2| uncharacterized protein [Arabidopsis thaliana] gi|332661235|gb|AEE86635.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42569121|ref|NP_179401.2| uncharacterized protein [Arabidopsis thaliana] gi|330251632|gb|AEC06726.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
TAIR|locus:2122269672 AT4G36210 "AT4G36210" [Arabido 0.901 0.694 0.586 8.9e-141
TAIR|locus:2053154656 AT2G18100 "AT2G18100" [Arabido 0.920 0.727 0.560 2.2e-137
UNIPROTKB|Q5TGY1 634 TMCO4 "Transmembrane and coile 0.507 0.414 0.355 4e-42
MGI|MGI:1924306 631 Tmco4 "transmembrane and coile 0.507 0.416 0.358 9.5e-41
RGD|1566357 631 Tmco4 "transmembrane and coile 0.507 0.416 0.351 3.8e-40
WB|WBGene00018044617 F35D11.3 [Caenorhabditis elega 0.480 0.403 0.326 1.3e-39
ZFIN|ZDB-GENE-041008-216 688 tmco4 "transmembrane and coile 0.503 0.379 0.352 1.8e-39
ASPGD|ASPL0000008810873 AN6268 [Emericella nidulans (t 0.465 0.276 0.364 2e-37
ASPGD|ASPL0000016428 1144 AN4028 [Emericella nidulans (t 0.490 0.222 0.352 1.6e-35
CGD|CAL0002523 906 orf19.2574 [Candida albicans ( 0.494 0.282 0.348 4.7e-34
TAIR|locus:2122269 AT4G36210 "AT4G36210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1377 (489.8 bits), Expect = 8.9e-141, P = 8.9e-141
 Identities = 274/467 (58%), Positives = 313/467 (67%)

Query:    49 DSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHR 108
             D  H+     +E+ +EE  +LS+QRK+ VLYELLSACL+D    DKKC R R GYD+RHR
Sbjct:   203 DGSHKPEVLENEKSVEEVTLLSHQRKINVLYELLSACLSDKHHEDKKCKRCRKGYDARHR 262

Query:   109 VALRLLATWLDIKWIKXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXWKRXXXXXX 168
             VALRLLATW +I+WIK               +                   WKR      
Sbjct:   263 VALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMKGEDNLTPTTSWAKWKRGGIIGA 322

Query:   169 XXXXXXXXXXXXXXXXXPAIAAGFSALAPTLGTLIPVIXXXXXXXXXXXXXXXXXXXXXX 228
                              PAIAAGF ALAPTLGT+IPVI                      
Sbjct:   323 AAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAGGFAAAASAAGTVAGSVAVA 382

Query:   229 XXXXXXXXXXXXXKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQEDFVRPWE 288
                          KMARRIG +DEFEFKAIGEN NQGRLAVE+L++GVVF++EDFV+PWE
Sbjct:   383 ASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEVLVAGVVFEEEDFVKPWE 442

Query:   289 GQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVXXXXXXXXXXXXXX 348
             G   N+ERY LQWESKNLI VSTAIQDWLTSR+AMELMKQGAM TV              
Sbjct:   443 GLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAMHTVLASLLMALAWPATI 502

Query:   349 VFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAE 408
             + AAD IDSKW+IA+DRSDKAG+LLAEVL +GLQG RP+TL+G+SLGARVIFKCL+ LAE
Sbjct:   503 LVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQALAE 562

Query:   409 NECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGL 468
              E NA +VERVVLLGAPISI  +NW  VRKMVAGRFIN YATNDWTL IAFRASL+SQGL
Sbjct:   563 TEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFINVYATNDWTLGIAFRASLISQGL 622

Query:   469 AGIQPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFR 515
             AGIQPI   GIEN+DVT ++EGHSSYLW +Q ILERLE+DTYYPVFR
Sbjct:   623 AGIQPICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVFR 669
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2053154 AT2G18100 "AT2G18100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TGY1 TMCO4 "Transmembrane and coiled-coil domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1924306 Tmco4 "transmembrane and coiled-coil domains 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1566357 Tmco4 "transmembrane and coiled-coil domains 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00018044 F35D11.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-216 tmco4 "transmembrane and coiled-coil domains 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008810 AN6268 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000016428 AN4028 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0002523 orf19.2574 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036836001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (662 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
pfam05277345 pfam05277, DUF726, Protein of unknown function (DU 6e-87
COG0730258 COG0730, COG0730, Predicted permeases [General fun 6e-04
pfam01988209 pfam01988, VIT1, VIT family 0.001
PRK13875440 PRK13875, PRK13875, conjugal transfer protein TrbL 0.004
>gnl|CDD|218533 pfam05277, DUF726, Protein of unknown function (DUF726) Back     alignment and domain information 
 Score =  271 bits (694), Expect = 6e-87
 Identities = 140/357 (39%), Positives = 209/357 (58%), Gaps = 20/357 (5%)

Query: 159 KWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGASGFAAAASAA 218
           K KR  +IG A L GG L+ +TGGLAAP +AAG       LG L   IG  G   +A+  
Sbjct: 2   KIKRYLLIGLAGLGGGLLIGLTGGLAAPLVAAG-------LGALFTTIGLGG---SAAFL 51

Query: 219 GTVAGSVAV-AASFGAAGAGLTGSKMARRIGSVDEFEFKAIGEN-QNQGRLAVEILISGV 276
            +  GS  V  A FGA+GAG+TG KM++R+G++  FEF  + EN +  GRL V +     
Sbjct: 52  ASTGGSAEVITALFGASGAGITGYKMSKRVGAIKTFEFIPLHENRRLSGRLIVTVSGWMR 111

Query: 277 VFDQEDFVRPWE--GQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTV 334
           + D +D   PW         + Y L+WE + L  +  A+    ++  +M L +Q    T+
Sbjct: 112 LGDYDDVRHPWRTLDPVLG-DLYSLRWEPEMLKELGQALTILASAAFSMSL-QQILGYTI 169

Query: 335 LKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSL 394
           L +L++AL WP  L+    ++D+ W ++++R+ KAGK+LA+ L+    G RPVTLIG+SL
Sbjct: 170 LASLVSALQWPLALLKVGYILDNPWNVSLERAAKAGKILADALLSRNLGVRPVTLIGFSL 229

Query: 395 GARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWT 454
           GARVI+ CL  LA+ +   G++E V+LLGAP +   + WE  R +V+GRF+N Y+ NDW 
Sbjct: 230 GARVIYYCLLELAKRKA-YGLIENVILLGAPATTDAKVWEKARSVVSGRFVNGYSKNDWL 288

Query: 455 LAIAFRASLLSQGLAGIQPI---NGLGIENIDVTHLIEGHSSYLWASQLILERLELD 508
           L   +R +     +AG  PI   +  G+EN+DV+ L+ GH  Y      IL+R+ ++
Sbjct: 289 LGFLYRTASGQSRVAGAGPIDLEDVPGVENVDVSDLVSGHLDYRKLMPKILKRIGVE 345

This family consists of several uncharacterized eukaryotic proteins. Length = 345
>gnl|CDD|223802 COG0730, COG0730, Predicted permeases [General function prediction only] Back     alignment and domain information
>gnl|CDD|216831 pfam01988, VIT1, VIT family Back     alignment and domain information
>gnl|CDD|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
KOG2385633 consensus Uncharacterized conserved protein [Funct 100.0
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 100.0
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 99.32
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.94
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.59
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 97.33
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.27
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 97.1
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.66
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.51
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 96.46
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.37
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.29
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 96.02
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 95.53
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 95.5
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 95.42
PLN02408365 phospholipase A1 95.37
KOG2385633 consensus Uncharacterized conserved protein [Funct 95.25
PLN02454414 triacylglycerol lipase 95.19
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 95.14
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 95.13
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 95.05
PLN02965255 Probable pheophorbidase 94.97
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.73
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 94.54
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 94.49
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 94.32
PLN02571413 triacylglycerol lipase 94.19
PRK10673255 acyl-CoA esterase; Provisional 94.1
COG3208244 GrsT Predicted thioesterase involved in non-riboso 94.07
PLN02324415 triacylglycerol lipase 94.03
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 94.03
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 93.84
PLN02802509 triacylglycerol lipase 93.77
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 93.74
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 93.57
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 93.53
COG3319257 Thioesterase domains of type I polyketide synthase 93.42
PRK10349256 carboxylesterase BioH; Provisional 93.26
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 93.24
COG1075336 LipA Predicted acetyltransferases and hydrolases w 93.24
PLN02211273 methyl indole-3-acetate methyltransferase 93.19
PRK00870302 haloalkane dehalogenase; Provisional 93.1
PLN03037525 lipase class 3 family protein; Provisional 92.9
PLN02162475 triacylglycerol lipase 92.8
PLN02824294 hydrolase, alpha/beta fold family protein 92.79
PRK11071190 esterase YqiA; Provisional 92.76
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 92.57
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 92.37
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 92.32
PLN02310405 triacylglycerol lipase 92.29
PRK03592295 haloalkane dehalogenase; Provisional 92.17
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 92.15
PLN02679360 hydrolase, alpha/beta fold family protein 91.66
PLN00413479 triacylglycerol lipase 91.62
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 91.04
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 90.92
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 90.54
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 90.41
PLN02753531 triacylglycerol lipase 90.31
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 90.13
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 90.13
PLN02934515 triacylglycerol lipase 90.05
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 89.78
PRK10985324 putative hydrolase; Provisional 89.7
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 89.58
PHA02857276 monoglyceride lipase; Provisional 89.09
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 88.87
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 88.83
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 88.72
PRK08775343 homoserine O-acetyltransferase; Provisional 88.64
PLN02719518 triacylglycerol lipase 88.63
PRK03204286 haloalkane dehalogenase; Provisional 88.63
PLN02578354 hydrolase 88.51
PLN02761527 lipase class 3 family protein 88.49
PLN02298330 hydrolase, alpha/beta fold family protein 88.45
PRK11460232 putative hydrolase; Provisional 88.42
cd07311150 terB_like_1 tellurium resistance terB-like protein 88.41
PLN02894402 hydrolase, alpha/beta fold family protein 88.39
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 88.34
PLN02511388 hydrolase 88.16
PRK10749330 lysophospholipase L2; Provisional 87.98
TIGR03611257 RutD pyrimidine utilization protein D. This protei 87.01
PRK10566249 esterase; Provisional 86.63
PLN02385349 hydrolase; alpha/beta fold family protein 86.56
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 86.55
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 86.44
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 86.28
COG2267298 PldB Lysophospholipase [Lipid metabolism] 85.9
PF05099140 TerB: Tellurite resistance protein TerB; InterPro: 85.88
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 85.48
PRK07581339 hypothetical protein; Validated 84.66
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 83.59
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 83.43
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 83.41
PRK06489360 hypothetical protein; Provisional 83.11
TIGR01849 406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 83.1
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 82.09
PRK07868 994 acyl-CoA synthetase; Validated 80.66
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 80.22
KOG4569336 consensus Predicted lipase [Lipid transport and me 80.1
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=4.7e-124  Score=980.93  Aligned_cols=454  Identities=49%  Similarity=0.791  Sum_probs=430.6

Q ss_pred             CCCCCCCCccCCCchhhhhhccccchhHHHHHHHHHHhccCCCccccccccCCCcchhHHHHHHHHHHhcCCCHHHHHHH
Q 010087           49 DSPHESGSKFDERPIEEEAVLSYQRKVTVLYELLSACLADIPQHDKKCTRQRTGYDSRHRVALRLLATWLDIKWIKMEAV  128 (518)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~vl~~l~~~~i~d~~~~~~~~~~~~~~YDARsRvlL~~la~~L~v~~~~~~~~  128 (518)
                      |+.........+.+++|++.++.++...|++.|+.+|+.+...|+..+.+++++||+|+||++++++.++++.|.+++..
T Consensus       119 d~~~k~~is~~~~~V~Ev~~~~~~~st~vl~el~ia~l~~~~~~~~~~~~~~~~YD~RsRva~~L~~t~~~v~~~e~~vv  198 (633)
T KOG2385|consen  119 DDLCKLDISTHEKQVEEVTLLSSESSTPVLYELLIACLWTKICDLFLCCRQRGNYDSRSRVALRLLATWFDVGWFEIEVV  198 (633)
T ss_pred             cccccccccccccchhhhhhhhhccccchHHHHHHHHHHHHHhhhHHHHHhhcCCChHHHHHHHHHHHHhhheeeeeeeh
Confidence            44445555578888999999999999999999999999998889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhHHHhhchhhhhhhhhhhhhhhhhhhcchhhHhhhhhhhhHHHhhhhcccccccCcccccccc
Q 010087          129 EMMVASSAMAVRKAEASKEEEATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGA  208 (518)
Q Consensus       129 E~~va~~l~~~~~~~~~~~e~~~~~~~k~~k~kR~~~iG~A~v~GG~liglTGGLAAP~IaAglgal~~~~G~~~~~~G~  208 (518)
                      |.+.+++.|+.+..++.+.++.+.++++|+|||||.+||+|+++||++||+|||||||+||||+|+++++       +|+
T Consensus       199 et~~~~ssmelq~~~~~~se~~m~~~~~~~k~Kr~~~~GlAg~~GG~ligLTGGLaAP~IaAG~Gt~~~~-------iG~  271 (633)
T KOG2385|consen  199 ETMLACSSMELQKSSSMKSEDVMYPRRRWKKRKRYIIMGLAGLGGGLLIGLTGGLAAPAIAAGIGTLFPT-------IGL  271 (633)
T ss_pred             hHHhhhhHHHHHhhhhhchhhhhchhhhHHHHHHhhhhhhhhcccceeeeecccchhhHHhhchhhheec-------ccc
Confidence            9999999999988888888889999999999999999999999999999999999999999999987765       456


Q ss_pred             chHHHHHHhhhhhhhhHHHHHHhhhcccchhH-HhHHhhhcCCcceEEeecccccCCCceeEEEEEeccccCCc----cc
Q 010087          209 SGFAAAASAAGTVAGSVAVAASFGAAGAGLTG-SKMARRIGSVDEFEFKAIGENQNQGRLAVEILISGVVFDQE----DF  283 (518)
Q Consensus       209 ~G~~aaa~~lGt~ag~~~vg~lFGa~Gagl~G-~~m~rr~~~v~~F~f~pl~~~~~~~rl~v~I~VSGwl~~~~----D~  283 (518)
                      +||  +|+++||++|++++++.||++||+.+| ++|.+|+++++||||+||+   +|+|++++++|||||-++.    +|
T Consensus       272 ~g~--aat~~~T~aGsaav~ta~gaa~ga~~G~~kMa~R~g~l~eFEF~pL~---en~~~~~~ltVsgw~~~~vd~~~~~  346 (633)
T KOG2385|consen  272 GGF--AATGLGTGAGSAAVITAFGAAGGALTGMTKMAKRSGDLEEFEFRPLS---ENRRLNVILTVSGWMAGYVDDVRLF  346 (633)
T ss_pred             chh--hHhhHhhccchhHHHHhhccccchhcchhhHhhhcCCcceEEEEEcc---ccccCCeEEEEEEeeccccchhhhc
Confidence            787  466788999999999999999999999 9999999999999999995   4559999999999998753    57


Q ss_pred             cccccccCCccceeeeeecchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHhhhhcchhHHHHH
Q 010087          284 VRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQGAMMTVLKTLLAALAWPATLVFAADLIDSKWTIAV  363 (518)
Q Consensus       284 ~~pW~~l~~~~e~Y~L~WE~~~L~~lg~ai~~~l~s~~a~~~~~q~~~~TvLs~L~aAl~wP~~Llk~a~~IDNpW~~a~  363 (518)
                      +.||..+..+.|+|+|+|||++|.++|++|+ |++|+++++.++|++++|+|++|++|++||++|++++++|||||++|.
T Consensus       347 v~~~d~l~~~~d~Ytl~wE~e~L~~lg~ai~-iL~S~~~~~~lqQ~l~~TvLasL~~A~~WP~aLlk~g~ilDnpWnia~  425 (633)
T KOG2385|consen  347 VKTWDPLTGNLDIYTLQWESEMLISLGQAIS-ILASEVVTESLQQVLGRTVLASLLSALQWPLALLKVGYILDNPWNIAL  425 (633)
T ss_pred             cccccccccccceeEEEecHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhcCchHHHh
Confidence            8899999999999999999999999999999 999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhcCCCCceEEEEechhHHHHHHHHHHhHhccccCCccceEEEecccccCChhhHHHHhhcccce
Q 010087          364 DRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQNWEAVRKMVAGR  443 (518)
Q Consensus       364 ~RA~~aG~~LA~~L~~~~~G~RpVtLVG~SLGARVI~~cL~eLa~~~~~~giVe~VvL~Gapv~~~~~~W~~~r~vVsGR  443 (518)
                      |||+++|+.||++|+.|.||+||||||||||||||||+||.+|+++++. ++||||||||+|++.+++.|.++|+|||||
T Consensus       426 dRa~kaG~lLAe~L~~r~qG~RPVTLVGFSLGARvIf~CL~~Lakkke~-~iIEnViL~GaPv~~k~~~w~k~r~vVsGR  504 (633)
T KOG2385|consen  426 DRADKAGELLAEALCKRSQGNRPVTLVGFSLGARVIFECLLELAKKKEV-GIIENVILFGAPVPTKAKLWLKARSVVSGR  504 (633)
T ss_pred             hHHHHHHHHHHHHHHHhccCCCceeEeeeccchHHHHHHHHHHhhcccc-cceeeeeeccCCccCCHHHHHHHHhheecc
Confidence            9999999999999999999999999999999999999999999998776 999999999999999999999999999999


Q ss_pred             EEEEecCChhHHHHHHHhcccCCc-cccc-cccCCCCceeecCCCCcCCchhHHHHHHHHHHHcCCCccccccCC
Q 010087          444 FINCYATNDWTLAIAFRASLLSQG-LAGI-QPINGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRR  516 (518)
Q Consensus       444 ~vN~YS~nD~vL~~lyR~~~~~~g-vAGl-~pV~~~giENvDvS~lV~GH~~Y~~~m~~IL~~ig~~~~~~~~~~  516 (518)
                      |||+||.|||+|+|+||+++.+.| +||+ +|+++||||||||||+|.||++|+++||+||+++|++++||.|+.
T Consensus       505 FVNgYs~nDW~L~~lfRa~s~~~~avaGi~~~~~i~giEnvdvtd~VeGHl~Yrw~~~kiL~rlg~d~~~~~f~~  579 (633)
T KOG2385|consen  505 FVNGYSTNDWTLGYLFRASSAQFGAVAGIPQPICIPGIENVDVTDLVEGHLSYRWSMPKILKRLGIDVLSEEFRQ  579 (633)
T ss_pred             eeeeeecchHHHHHHHHHhhcccccccCCCccccCCCccccchhhhhhhHHHHHHHHHHHHHHhCccccCHHHHH
Confidence            999999999999999999999998 9999 999999999999999999999999999999999999999999874

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>cd07311 terB_like_1 tellurium resistance terB-like protein, subgroup 1 Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF05099 TerB: Tellurite resistance protein TerB; InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 4e-04
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
 Score = 40.5 bits (95), Expect = 4e-04
 Identities = 20/94 (21%), Positives = 37/94 (39%), Gaps = 7/94 (7%)

Query: 332 MTVLKTLLAALAWPATLVFAADLIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIG 391
              +K+ L +  W    ++A D  D   T   +      + + +VL +   G + V ++ 
Sbjct: 19  FAGIKSYLVSQGWSRDKLYAVDFWDKTGTNY-NNGPVLSRFVQKVLDET--GAKKVDIVA 75

Query: 392 YSLGARVIFKCLENLAENECNAGIVERVVLLGAP 425
           +S+G       ++NL         V  VV LG  
Sbjct: 76  HSMGGANTLYYIKNLD----GGNKVANVVTLGGA 105

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
3lp5_A250 Putative cell surface hydrolase; structural genom 97.09
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 96.88
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.85
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.79
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.78
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.77
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 96.63
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 96.62
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.53
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.52
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 96.46
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.41
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 96.06
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 95.99
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 95.93
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 95.91
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.83
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 95.74
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.7
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 95.7
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 95.66
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 95.6
3tej_A329 Enterobactin synthase component F; nonribosomal pe 95.51
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.47
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 95.47
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.44
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.39
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 95.36
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.33
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 95.31
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.3
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 95.29
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.27
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 95.27
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.24
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.2
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.15
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.14
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 95.12
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.1
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.08
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 95.05
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.04
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 94.98
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 94.97
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 94.93
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 94.93
1iup_A282 META-cleavage product hydrolase; aromatic compound 94.83
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 94.8
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.79
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 94.78
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 94.76
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 94.75
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 94.74
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 94.74
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.74
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 94.74
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 94.56
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 94.56
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 94.52
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 94.52
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.5
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 94.48
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 94.48
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.48
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 94.47
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.46
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 94.46
1kez_A300 Erythronolide synthase; polyketide synthase, modul 94.45
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.42
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 94.41
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 94.37
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.37
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 94.36
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 94.35
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 94.34
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 94.32
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.32
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.31
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.3
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 94.28
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 94.28
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 94.28
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.28
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.27
3llc_A270 Putative hydrolase; structural genomics, joint cen 94.25
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 94.22
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 94.22
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 94.19
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 94.17
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 94.17
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 94.11
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 94.1
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.1
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 94.03
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 93.95
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 93.93
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 93.93
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 93.9
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 93.89
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 93.82
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 93.82
3h04_A275 Uncharacterized protein; protein with unknown func 93.82
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 93.81
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.77
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 93.77
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 93.69
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 93.68
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 93.68
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 93.68
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 93.67
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.63
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 93.58
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.57
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 93.52
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 93.51
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 93.29
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 93.29
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 93.24
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 93.23
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.22
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 93.21
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 93.17
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 93.13
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 93.03
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 92.89
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 92.85
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.83
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 92.82
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 92.8
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 92.72
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 92.55
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 92.54
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 92.42
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 92.32
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 92.3
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 92.28
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 92.22
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 92.16
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 92.08
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 91.99
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 91.18
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 91.88
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 91.75
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 91.5
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 91.1
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 90.65
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 90.61
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 90.6
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 90.56
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 90.3
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 90.24
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 89.92
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 89.8
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 89.53
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 89.51
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 89.04
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 89.41
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 89.33
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 88.82
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 88.77
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 88.45
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 88.04
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 87.59
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 87.39
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 87.34
1vkh_A273 Putative serine hydrolase; structural genomics, jo 87.14
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 86.83
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 86.7
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 86.7
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 86.66
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 86.58
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 86.34
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 86.31
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 85.85
4fle_A202 Esterase; structural genomics, PSI-biology, northe 85.6
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 85.53
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 85.49
2ou3_A161 Tellurite resistance protein of COG3793; structura 85.46
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 85.23
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 85.21
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 85.21
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 85.09
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 83.88
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 83.18
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 83.05
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 81.12
3ain_A323 303AA long hypothetical esterase; carboxylesterase 81.04
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 80.51
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 80.04
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
Probab=97.09  E-value=0.0025  Score=62.14  Aligned_cols=74  Identities=14%  Similarity=0.169  Sum_probs=50.2

Q ss_pred             cCCCCceEEEEechhHHHHHHHHHHhHhccccCCccceEEEecccccCCh-------hhHHHHh---hcc--cceEEEEe
Q 010087          381 LQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKD-------QNWEAVR---KMV--AGRFINCY  448 (518)
Q Consensus       381 ~~G~RpVtLVG~SLGARVI~~cL~eLa~~~~~~giVe~VvL~Gapv~~~~-------~~W~~~r---~vV--sGR~vN~Y  448 (518)
                      ..+.++++|||||||+.+....+..-..... ...|+.++++|+|.....       ..+..+.   ...  .=.+.++|
T Consensus        94 ~~~~~~~~lvGHSmGg~~a~~~~~~~~~~~~-~~~v~~lv~l~~p~~g~~~~~~~~~~~~~~l~~~~~~lp~~vpvl~I~  172 (250)
T 3lp5_A           94 TYHFNHFYALGHSNGGLIWTLFLERYLKESP-KVHIDRLMTIASPYNMESTSTTAKTSMFKELYRYRTGLPESLTVYSIA  172 (250)
T ss_dssp             TSCCSEEEEEEETHHHHHHHHHHHHTGGGST-TCEEEEEEEESCCTTTTCCCSSCCCHHHHHHHHTGGGSCTTCEEEEEE
T ss_pred             HcCCCCeEEEEECHhHHHHHHHHHHcccccc-chhhCEEEEECCCCCcccccccccCHHHHHHHhccccCCCCceEEEEE
Confidence            4477999999999999999887765543321 257999999999986432       2233332   211  22688888


Q ss_pred             cC----ChhHH
Q 010087          449 AT----NDWTL  455 (518)
Q Consensus       449 S~----nD~vL  455 (518)
                      +.    +|.+.
T Consensus       173 G~~~~~~Dg~V  183 (250)
T 3lp5_A          173 GTENYTSDGTV  183 (250)
T ss_dssp             CCCCCCTTTBC
T ss_pred             ecCCCCCCcee
Confidence            87    66554
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2ou3_A Tellurite resistance protein of COG3793; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE I3A; 1.85A {Nostoc punctiforme} SCOP: a.287.1.1 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 97.62
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.4
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.14
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 96.54
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 96.51
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 96.25
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.16
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 95.93
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.76
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.68
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.63
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 95.61
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 95.59
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.51
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 95.48
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 95.46
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 95.45
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 95.32
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.26
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 95.22
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 94.94
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 94.63
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.55
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 94.53
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 94.38
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 94.36
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 94.16
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 93.7
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.62
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 93.57
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 93.52
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 93.47
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.4
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 93.32
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 93.22
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 92.85
d2ou3a1160 Tellurite resistance protein of COG3793 {Nostoc pu 92.8
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 92.32
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 92.22
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 91.63
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 91.18
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 90.71
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 90.28
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 90.04
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 89.84
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 89.65
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 85.86
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 85.07
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 83.62
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 82.13
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 81.95
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 80.85
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Yeast (Candida antarctica), form b [TaxId: 34362]

Probab=97.62  E-value=5.6e-05  Score=74.52  Aligned_cols=116  Identities=12%  Similarity=0.102  Sum_probs=74.7

Q ss_pred             HHHHHHHHHh--hcCCCCceEEEEechhHHHHHHHHHHhHhccccCCccceEEEecccccCChh----------------
Q 010087          370 GKLLAEVLMQ--GLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGAPISIKDQ----------------  431 (518)
Q Consensus       370 G~~LA~~L~~--~~~G~RpVtLVG~SLGARVI~~cL~eLa~~~~~~giVe~VvL~Gapv~~~~~----------------  431 (518)
                      .+.||+.|..  ...|.++|.|||||+|+-+..+.|+.+....   ..|.+++.+|+|.....-                
T Consensus        80 ae~la~~i~~v~~~~g~~kV~lVGhS~GG~~a~~~l~~~p~~~---~~V~~~v~i~~~~~Gt~~a~~~~~~~~~~pa~~q  156 (317)
T d1tcaa_          80 TEYMVNAITALYAGSGNNKLPVLTWSQGGLVAQWGLTFFPSIR---SKVDRLMAFAPDYKGTVLAGPLDALAVSAPSVWQ  156 (317)
T ss_dssp             HHHHHHHHHHHHHHTTSCCEEEEEETHHHHHHHHHHHHCGGGT---TTEEEEEEESCCTTCBGGGHHHHHTTCBCHHHHH
T ss_pred             HHHHHHHHHHHHHhccCCceEEEEeCchHHHHHHHHHHCCCcc---hheeEEEEeCCCCCCcccccchhhhhccCchhhh
Confidence            3456666544  3568899999999999999999998876542   469999999999754321                


Q ss_pred             -----hHHHH-hh---cccc-eEEEEecCChhHHHHHHHhcccCCccccccccCCCCceeecCCCCc-----CCchhHH
Q 010087          432 -----NWEAV-RK---MVAG-RFINCYATNDWTLAIAFRASLLSQGLAGIQPINGLGIENIDVTHLI-----EGHSSYL  495 (518)
Q Consensus       432 -----~W~~~-r~---vVsG-R~vN~YS~nD~vL~~lyR~~~~~~gvAGl~pV~~~giENvDvS~lV-----~GH~~Y~  495 (518)
                           .|.+. +.   ...+ +..++||+.|.|..- |.      +-.-.+....++++|+.|-+.+     .+|....
T Consensus       157 ~~~~s~fl~~L~~~~~~~~~V~~t~I~s~~D~iV~P-~~------~~~~~~~~~~~~~~Ni~vq~~c~~~~~~~H~~l~  228 (317)
T d1tcaa_         157 QTTGSALTTALRNAGGLTQIVPTTNLYSATDEIVQP-QV------SNSPLDSSYLFNGKNVQAQAVCGPLFVIDHAGSL  228 (317)
T ss_dssp             TBTTCHHHHHHHHTTTTBCSSCEEEEECTTCSSSCC-CC------SSSTTSTTCCBTSEEEEHHHHHCTTCCCCTTHHH
T ss_pred             hcCCcHHHHHHHhCCCCCCCCCEEEEecCCCcccCc-cc------cchhccccCCCCceeEEeecccCCCCcCCccccc
Confidence                 12111 11   1122 577888988875532 11      1111223346789999986544     5895543
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2ou3a1 a.287.1.1 (A:1-160) Tellurite resistance protein of COG3793 {Nostoc punctiforme pcc 73102 [TaxId: 63737]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure