Citrus Sinensis ID: 010115

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLLTVCDYIFILII
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEcccccccccccEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEccccccccccccccccccEEEEEEccEEEEEccccccccccEEEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEEcccccccccccEEEEEcccccEEEEEccccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEcccccccccccEEEEEcccccEEEEEcccccccccccccEEEEEEEccccEEEEEccccccccccEEEEEccccccccccccccccccccccEEEEEccccccEEEccccccccccccHHccccHHHHHHccccccccccccccccccccccccccccccccHHcHHHHHccccccccccccccccccccccccccEEEEEEc
cccccccccccccEEccccHHHHccccccccccccccccccccEEEEcccEEEEcccccccccccccccccccccEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEcccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEccccccEEEEcccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEccccccccccccccEEEEEEEEcccEEEEEEcccccccccEEEEccccccccEccccccccccccEEEEEEEEccEEEEEccccccccccccccEcccccccccccccccccccEEEEccccccccccccHHHcccHHHHcHHHccccccccccccEEEEcccccEEEEccEEEEEEc
mfgfsrrrmklgrvkkvqlsdsaqairspirppkrnsnpnsecvapssnhaddrdcectiagpevsngtsgnsenWMVLSIagdkpiprfnHAAAVIGNKMIVvggesgngllddvqvlnfdrfswtaassklylspsslplkipacrghslisWGKKVLLvggktdsgsdrvsvWTFDTETECWSVveakgdipvarsghtVVRASSVLIlfggedgkrrklndlhmfdlksltwlplhctgtgpsprsnhvaalyddknllifggssksktlndlysLDFETMIWTRIkirgfhpspragccgvlcgtkwyiagggsrkkrHAETLIFDILKgewsvaitspsssvtsnkgFTLVLVQHKEKDFLVAfggikkepsnqvEVLSIeknessmgrrstpnakgpgqllfekrssstglacqlgngapqrsvDSVARQNLASAIEQhgsgrkslsefalvdpnpisgnvslgkqfqneeEYSTAVKMeknsedetsfVQVSFRGYNLLTVCDYIFILII
mfgfsrrrmklgrvkkvqlsdsaqairspirppkrnsnpnseCVAPSSNHADDRDCECTIAGpevsngtsgnseNWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGgktdsgsdrvsvWTFDTETECWSVVEAKgdipvarsghtvvrassvlilfggedgkrrkLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYiagggsrkkrHAETLIFDILKGEWSVAItspsssvtsnkGFTLVLVQHKEKDFLVAfggikkepsnqvevlsieknessmgrrstpnakgpgQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSfvqvsfrgynlltvCDYIFILII
MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAAssklylspsslplkIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLLTVCDYIFILII
**************************************************************************NWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPS*SVTSNKGFTLVLVQHKEKDFLVAFGGIK*************************************************************************************************************************FVQVSFRGYNLLTVCDYIFILI*
*****************************************************RDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSP*S*PLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSV*************GFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNES********************RSSSTGLACQLGNGAPQRSVDSVA**********************************************************************LLTVCDYIFILII
MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRP********************DRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEK*************KGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLLTVCDYIFILII
**********LGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLLTVCDYIFILII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLLTVCDYIFILII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q9MA55668 Acyl-CoA-binding domain-c no no 0.638 0.495 0.367 1e-63
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.598 0.478 0.371 2e-62
Q5EA50372 Rab9 effector protein wit yes no 0.517 0.720 0.278 1e-23
P51611 2090 Host cell factor 1 OS=Mes N/A no 0.442 0.109 0.297 2e-21
Q7Z6M1372 Rab9 effector protein wit yes no 0.505 0.704 0.276 2e-21
Q61191 2045 Host cell factor 1 OS=Mus yes no 0.442 0.111 0.297 2e-21
P51610 2035 Host cell factor 1 OS=Hom no no 0.442 0.112 0.293 6e-21
Q8VCH5380 Rab9 effector protein wit no no 0.442 0.602 0.294 1e-20
Q8H4D4 1043 tRNA wybutosine-synthesiz no no 0.428 0.212 0.309 2e-20
P87061 1147 Tip elongation aberrant p yes no 0.432 0.195 0.302 2e-20
>sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 Back     alignment and function desciption
 Score =  244 bits (622), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/335 (36%), Positives = 188/335 (56%), Gaps = 4/335 (1%)

Query: 75  NWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLY 134
            W     +G +P  R+ H AAVI +KM + GG      L D+ VL+   ++W+   +K+ 
Sbjct: 170 QWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVA 229

Query: 135 L--SPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKG 192
                +S P  +  C GHSLI+W  K+L +GG T   S+ + V  FD  T  WS+++  G
Sbjct: 230 TESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYG 289

Query: 193 DIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNH 252
             PV+R G +V      L++FGG+D KR  LNDLH+ DL ++TW  +   G  PSPRS+H
Sbjct: 290 KPPVSRGGQSVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDH 349

Query: 253 VAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKW 312
            AA++ ++ LLIFGG S +   +DL+ LD +TM W+R   +G  P+PRAG  GV  G  W
Sbjct: 350 AAAVHAERFLLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENW 409

Query: 313 YIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGG 372
           +I GGG  K   +E+++ ++    WSV  +       +++G +LV+  +  +D LVAFGG
Sbjct: 410 FIVGGGDNKSGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGG 469

Query: 373 IKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQL 407
                +N++ +L  + +  S  +  T  A  PG L
Sbjct: 470 YNGRYNNEINLL--KPSHKSTLQTKTLEAPLPGSL 502
Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 Back     alignment and function description
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function description
>sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=2 SV=2 Back     alignment and function description
>sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
224130424 707 predicted protein [Populus trichocarpa] 0.953 0.698 0.792 0.0
255551677 713 acyl-CoA binding protein, putative [Rici 0.940 0.683 0.797 0.0
224110584 663 predicted protein [Populus trichocarpa] 0.942 0.736 0.776 0.0
225432358 706 PREDICTED: uncharacterized protein LOC10 0.959 0.703 0.776 0.0
359477427 717 PREDICTED: uncharacterized protein LOC10 0.959 0.693 0.774 0.0
356563867 708 PREDICTED: acyl-CoA-binding domain-conta 0.938 0.686 0.768 0.0
356519992 711 PREDICTED: acyl-CoA-binding domain-conta 0.934 0.680 0.760 0.0
449432819 678 PREDICTED: acyl-CoA-binding domain-conta 0.920 0.703 0.714 0.0
357447383 764 Acyl-CoA-binding domain-containing prote 0.947 0.642 0.701 0.0
357478643 735 Acyl-CoA-binding domain-containing prote 0.945 0.666 0.699 0.0
>gi|224130424|ref|XP_002328605.1| predicted protein [Populus trichocarpa] gi|222838587|gb|EEE76952.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/500 (79%), Positives = 439/500 (87%), Gaps = 6/500 (1%)

Query: 1   MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKR---NSNPNSECVAPSSNHADDRDCE 57
           MFGFS+RRMKLGRVKKVQLSDS+  IRSPIRPPKR   N+N NSE VA +++++DD D  
Sbjct: 1   MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEGVALTASNSDDLDYH 60

Query: 58  CTIAGPEV-SNGTSGN-SENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDD 115
           C+ + P V S+ T+GN +ENWMVLSI+GDKP PRFNHAA VIGNKMIVVGGESG+GLLDD
Sbjct: 61  CSSSAPPVISSSTAGNNAENWMVLSISGDKPNPRFNHAATVIGNKMIVVGGESGSGLLDD 120

Query: 116 VQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSV 175
           VQVL FD+F+WT+ SSKLYLSPSSLPLKIPACRGH L+SWGKK LL+GGKTD  SDR+SV
Sbjct: 121 VQVLKFDQFTWTSISSKLYLSPSSLPLKIPACRGHCLVSWGKKALLIGGKTDPASDRISV 180

Query: 176 WTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLT 235
           W FDTETECWS+VEAKGDIP+AR+GHTVVRASSVLILFGGED KR+KLNDLHMFDLKS T
Sbjct: 181 WAFDTETECWSLVEAKGDIPIARNGHTVVRASSVLILFGGEDAKRKKLNDLHMFDLKSFT 240

Query: 236 WLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGF 295
           WLPLHCTGTGPSPRSNHVAALYDDKNLLIFGG+SKS+TLNDLYSLDFETM+W+R KIRGF
Sbjct: 241 WLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGTSKSRTLNDLYSLDFETMVWSRTKIRGF 300

Query: 296 HPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFT 355
           HPSPRAGCCGVLCGTKWYIAGGGSRKKRH+ETLI+DILK EWSVA  SP SS+T+NKGF+
Sbjct: 301 HPSPRAGCCGVLCGTKWYIAGGGSRKKRHSETLIYDILKMEWSVAFASPPSSITTNKGFS 360

Query: 356 LVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSS 415
           LVLVQHKEKDFLVAFGG KKEPSNQVEV+ IEKNESS GR S   +KGPG+LLFEKRSSS
Sbjct: 361 LVLVQHKEKDFLVAFGGSKKEPSNQVEVMGIEKNESSTGRHSAL-SKGPGRLLFEKRSSS 419

Query: 416 TGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQ 475
           T LA QLG G+ QRS DSVARQNLASAIEQHGSGRKSLS+  LVDPN  S NVS  K+F 
Sbjct: 420 TVLAAQLGTGSSQRSADSVARQNLASAIEQHGSGRKSLSDSLLVDPNSASRNVSHRKEFH 479

Query: 476 NEEEYSTAVKMEKNSEDETS 495
           +EEE   A K  +N ED+ S
Sbjct: 480 HEEENRIAAKTARNLEDDNS 499

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255551677|ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis] gi|223543972|gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110584|ref|XP_002315566.1| predicted protein [Populus trichocarpa] gi|222864606|gb|EEF01737.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432358|ref|XP_002275331.1| PREDICTED: uncharacterized protein LOC100264848 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477427|ref|XP_003631976.1| PREDICTED: uncharacterized protein LOC100264848 isoform 2 [Vitis vinifera] gi|297736898|emb|CBI26099.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356563867|ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356519992|ref|XP_003528652.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449432819|ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi|449529842|ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357447383|ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi|355483015|gb|AES64218.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357478643|ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi|355510662|gb|AES91804.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
TAIR|locus:2183008 708 AT5G18590 [Arabidopsis thalian 0.936 0.685 0.666 7.7e-174
TAIR|locus:2143676648 ACBP5 "acyl-CoA binding protei 0.610 0.487 0.364 4.2e-56
TAIR|locus:2184352514 AT5G04420 [Arabidopsis thalian 0.615 0.620 0.338 1.2e-51
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.474 0.661 0.290 1.6e-24
MGI|MGI:2139530380 Rabepk "Rab9 effector protein 0.474 0.647 0.294 5.9e-24
RGD|1310612372 Rabepk "Rab9 effector protein 0.474 0.661 0.290 2.7e-23
UNIPROTKB|F1SKQ3370 RABEPK "Uncharacterized protei 0.474 0.664 0.283 4.8e-22
UNIPROTKB|Q7Z6M1372 RABEPK "Rab9 effector protein 0.474 0.661 0.283 1.6e-21
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.467 0.498 0.287 2.3e-21
TAIR|locus:2077502329 AT3G07720 "AT3G07720" [Arabido 0.418 0.659 0.303 4.1e-20
TAIR|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1689 (599.6 bits), Expect = 7.7e-174, P = 7.7e-174
 Identities = 333/500 (66%), Positives = 392/500 (78%)

Query:     1 MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI 60
             MF FS+RRM+LGRVKKVQLSDS Q  +SP+R  KR  + ++E    +++++D+ D +   
Sbjct:     1 MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQ--- 57

Query:    61 AGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLN 120
               P     +SGNSENWMVLS+ G+KP PRFNHAAA IGNKMIVVGGESG+GLLDDVQVLN
Sbjct:    58 --P-----SSGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQVLN 110

Query:   121 FDRFSWTAAXXXXXXXXXXXXXXIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDT 180
             FD  +W+ A              IPA +GH L+SWGKKVLLVGGKTD  SDRVSVW FDT
Sbjct:   111 FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT 170

Query:   181 ETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLH 240
             ++ECWS+++AKGD+PV+RSGHTVVRASSVLILFGGED K+RKLNDLHMFDLKS TWLPL+
Sbjct:   171 DSECWSLMDAKGDLPVSRSGHTVVRASSVLILFGGEDSKKRKLNDLHMFDLKSSTWLPLN 230

Query:   241 CTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPR 300
             CTGT P  RS+HVA L+DDK L +FGGS K+KTLNDLYSLDFETM+W+RIKIRGFHPSPR
Sbjct:   231 CTGTRPCARSHHVATLFDDKILFVFGGSGKNKTLNDLYSLDFETMVWSRIKIRGFHPSPR 290

Query:   301 AGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQ 360
             AG CGVLCGTKWYI GGGSRKKRHAETL+FDILK EWSVA  S  SSVTSNKGF+LVL+Q
Sbjct:   291 AGSCGVLCGTKWYITGGGSRKKRHAETLVFDILKVEWSVASISSQSSVTSNKGFSLVLLQ 350

Query:   361 HKEKDFLVAFGGIKKEPSNQVEVLSIEKNES-SMGRRSTPNAKGPGQLLFEKRSSSTGLA 419
             HK+KDFLVAFGG KK+PSNQV+  +I+KN+S S     T + K PG+LLF KRSSS+ + 
Sbjct:   351 HKDKDFLVAFGGTKKDPSNQVDAFTIDKNKSESPTHPQTTSKKNPGRLLFGKRSSSSAVL 410

Query:   420 C--QLGNGAPQRSVDSVARQNLASAIEQHG-SGRKSLSEFALVDP-NPISGNVSLGKQFQ 475
                +    + QR +DSVARQ LASAIE+HG SGR+SLSE A  D  NP SGNVSL KQF 
Sbjct:   411 TSDESVKASSQRLIDSVARQKLASAIEEHGGSGRRSLSEIAFGDHRNPPSGNVSLRKQFS 470

Query:   476 NEEEYSTAVKMEKNSEDETS 495
              EEEY   ++  K SE++ S
Sbjct:   471 TEEEYRAVIEPAKCSEEDIS 490
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
TAIR|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2139530 Rabepk "Rab9 effector protein with kelch motifs" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310612 Rabepk "Rab9 effector protein with kelch motifs" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z6M1 RABEPK "Rab9 effector protein with kelch motifs" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2077502 AT3G07720 "AT3G07720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_770001
hypothetical protein (707 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 4e-12
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 3e-09
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-08
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 8e-08
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-07
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-06
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 3e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 8e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 1e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-04
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 5e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 8e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 8e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.002
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 0.003
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.003
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 0.003
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information 
 Score = 68.1 bits (166), Expect = 4e-12
 Identities = 60/247 (24%), Positives = 110/247 (44%), Gaps = 17/247 (6%)

Query: 75  NWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGE-SGNGLLDD-VQVLNFDRFSWTAASSK 132
            W+ +   G+ P  R +H  A +GNK+   GGE + N  +D  + V + +  +W+     
Sbjct: 152 KWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWS----- 206

Query: 133 LYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKG 192
             +SP++  +   +C G  ++S G  + + GG+ D+       ++FDT T  W ++    
Sbjct: 207 --ISPATGDVPHLSCLGVRMVSIGSTLYVFGGR-DASRQYNGFYSFDTTTNEWKLLTPVE 263

Query: 193 DIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNH 252
           + P  RS H++      + +FGG      +L  L  +++    W   HC+  G S     
Sbjct: 264 EGPTPRSFHSMAADEENVYVFGGV-SATARLKTLDSYNIVDKKW--FHCSTPGDSFSIRG 320

Query: 253 VAAL--YDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGT 310
            A L     K  +++G +     ++D++  D     WT+++  G  PS R+       G 
Sbjct: 321 GAGLEVVQGKVWVVYGFNGCE--VDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGK 378

Query: 311 KWYIAGG 317
              I GG
Sbjct: 379 HIVIFGG 385

Length = 470
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA03098534 kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.81
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.78
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.69
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.67
PF1396450 Kelch_6: Kelch motif 99.12
PF1396450 Kelch_6: Kelch motif 99.1
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.98
PLN02772398 guanylate kinase 98.92
PF1341549 Kelch_3: Galactose oxidase, central domain 98.9
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.85
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.84
PF1341549 Kelch_3: Galactose oxidase, central domain 98.82
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.82
PLN02772398 guanylate kinase 98.77
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.74
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.7
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.7
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.69
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.65
PF1385442 Kelch_5: Kelch motif 98.58
PF1385442 Kelch_5: Kelch motif 98.57
smart0061247 Kelch Kelch domain. 98.45
smart0061247 Kelch Kelch domain. 98.35
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.19
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.15
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.04
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.77
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.48
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.34
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.07
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.06
PRK13684334 Ycf48-like protein; Provisional 96.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.64
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.63
PF12768281 Rax2: Cortical protein marker for cell polarity 96.57
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.27
PF12768281 Rax2: Cortical protein marker for cell polarity 96.25
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.17
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.15
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.09
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.83
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.74
KOG2055514 consensus WD40 repeat protein [General function pr 95.74
KOG2055514 consensus WD40 repeat protein [General function pr 95.62
PRK13684334 Ycf48-like protein; Provisional 95.49
PRK04792448 tolB translocation protein TolB; Provisional 95.48
smart00284255 OLF Olfactomedin-like domains. 95.18
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.32
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.15
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.95
PRK05137435 tolB translocation protein TolB; Provisional 93.88
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.83
KOG0310487 consensus Conserved WD40 repeat-containing protein 93.74
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.68
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.27
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.18
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.07
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.88
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 92.87
PLN00033398 photosystem II stability/assembly factor; Provisio 92.67
PRK00178430 tolB translocation protein TolB; Provisional 92.43
PRK11028330 6-phosphogluconolactonase; Provisional 92.38
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 91.84
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.82
PRK04922433 tolB translocation protein TolB; Provisional 91.27
PRK00178430 tolB translocation protein TolB; Provisional 91.22
PRK11028330 6-phosphogluconolactonase; Provisional 90.98
PRK05137435 tolB translocation protein TolB; Provisional 90.88
PRK04792448 tolB translocation protein TolB; Provisional 90.78
PRK04922433 tolB translocation protein TolB; Provisional 90.75
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.7
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 90.6
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.43
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.39
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 90.29
PF12217367 End_beta_propel: Catalytic beta propeller domain o 90.27
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 89.71
PTZ00421493 coronin; Provisional 89.27
PLN00033398 photosystem II stability/assembly factor; Provisio 89.04
COG1520370 FOG: WD40-like repeat [Function unknown] 88.93
PLN00181793 protein SPA1-RELATED; Provisional 88.08
PTZ00421493 coronin; Provisional 87.41
PRK04043419 tolB translocation protein TolB; Provisional 86.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 86.91
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 86.46
KOG0310487 consensus Conserved WD40 repeat-containing protein 84.72
PLN00181793 protein SPA1-RELATED; Provisional 84.43
PRK04043419 tolB translocation protein TolB; Provisional 83.68
PRK02889427 tolB translocation protein TolB; Provisional 83.61
KOG2048691 consensus WD40 repeat protein [General function pr 81.97
PRK03629429 tolB translocation protein TolB; Provisional 80.67
PRK02889427 tolB translocation protein TolB; Provisional 80.14
>PLN02193 nitrile-specifier protein Back     alignment and domain information 
Probab=100.00  E-value=8.7e-45  Score=380.50  Aligned_cols=336  Identities=20%  Similarity=0.300  Sum_probs=266.0

Q ss_pred             CCCceEeccCCCCCCcceecccccccccCCCCCCCCeEEeccCCCCCCCccceEEEEECCEEEEEcCcCC-C-CCCCcEE
Q 010115           40 NSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESG-N-GLLDDVQ  117 (518)
Q Consensus        40 ~~~~i~~~GG~~~~~~~~~~~~~~~~~~~~~~~~~~W~~l~~~~~~p~~R~~~~~~~~~~~lyv~GG~~~-~-~~~~~v~  117 (518)
                      .+.+|+.|+|+..+....  ..+|..........++|..++..+.+|.+|.+|++++++++|||+||... . ...+++|
T Consensus       119 ~~~~ivgf~G~~~~~~~~--ig~y~~~~~~~~~~~~W~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~v~  196 (470)
T PLN02193        119 QGGKIVGFHGRSTDVLHS--LGAYISLPSTPKLLGKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLY  196 (470)
T ss_pred             cCCeEEEEeccCCCcEEe--eEEEEecCCChhhhceEEEcccCCCCCCCccccEEEEECCEEEEECCcCCCCCCeeCcEE
Confidence            466699999977654222  22232211101124899999876678999999999999999999999753 2 2347899


Q ss_pred             EEEcCCCcEEEcccccccCCCCCCCCCCCccceEEEEECCEEEEEcCcCCCCCCceeEEEEECCCCcEEEeeecCCCCCC
Q 010115          118 VLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVA  197 (518)
Q Consensus       118 ~yd~~~~~W~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~p~~  197 (518)
                      +||+.+++|+.++.+..       .|.++|.+|++++++++|||+||.... ...+++|+||+.+++|+.+++.+..|.+
T Consensus       197 ~yD~~~~~W~~~~~~g~-------~P~~~~~~~~~v~~~~~lYvfGG~~~~-~~~ndv~~yD~~t~~W~~l~~~~~~P~~  268 (470)
T PLN02193        197 VFDLETRTWSISPATGD-------VPHLSCLGVRMVSIGSTLYVFGGRDAS-RQYNGFYSFDTTTNEWKLLTPVEEGPTP  268 (470)
T ss_pred             EEECCCCEEEeCCCCCC-------CCCCcccceEEEEECCEEEEECCCCCC-CCCccEEEEECCCCEEEEcCcCCCCCCC
Confidence            99999999998765321       222346789999999999999998653 3568999999999999999874445899


Q ss_pred             CcceEEEEECCEEEEEcccCCCCcccCcEEEEEcCCCcEEEeecCCCCCCCCCCcEEEEECCcEEEEEcCCCCCCCCCcE
Q 010115          198 RSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDL  277 (518)
Q Consensus       198 r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~~lyv~GG~~~~~~~~~v  277 (518)
                      |+.|++++.+++|||+||.+.. ..++++++||+.+++|+.++..+.+|.+|..|++++++++ ||++||.++. ..+++
T Consensus       269 R~~h~~~~~~~~iYv~GG~~~~-~~~~~~~~yd~~t~~W~~~~~~~~~~~~R~~~~~~~~~gk-iyviGG~~g~-~~~dv  345 (470)
T PLN02193        269 RSFHSMAADEENVYVFGGVSAT-ARLKTLDSYNIVDKKWFHCSTPGDSFSIRGGAGLEVVQGK-VWVVYGFNGC-EVDDV  345 (470)
T ss_pred             ccceEEEEECCEEEEECCCCCC-CCcceEEEEECCCCEEEeCCCCCCCCCCCCCcEEEEECCc-EEEEECCCCC-ccCce
Confidence            9999999999999999999765 4578999999999999999866668899999999999998 9999998654 36899


Q ss_pred             EEEEcCCCeEEEeecCCCCCCCCcceEEEEECCEEEEEcccCC---------CCCcCeEEEEECCCCceEEeecCCC--C
Q 010115          278 YSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSR---------KKRHAETLIFDILKGEWSVAITSPS--S  346 (518)
Q Consensus       278 ~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~---------~~~~~~v~~yd~~~~~W~~~~~~~~--~  346 (518)
                      ++||+++++|+++..++..|.+|..|++++++++|||+||...         ....+++++||+.+++|+.+...+.  .
T Consensus       346 ~~yD~~t~~W~~~~~~g~~P~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~~~~~~~~  425 (470)
T PLN02193        346 HYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEE  425 (470)
T ss_pred             EEEECCCCEEEEeccCCCCCCCcceeEEEEECCEEEEECCccCCccccccCccceeccEEEEEcCcCEEEEcccCCCCCC
Confidence            9999999999999988778999999999999999999999753         1245789999999999999875432  3


Q ss_pred             CCCCCCCceEEEEeeCCccEEEEEcCCCC--CCCCcEEEEEccc
Q 010115          347 SVTSNKGFTLVLVQHKEKDFLVAFGGIKK--EPSNQVEVLSIEK  388 (518)
Q Consensus       347 ~~~~r~~~s~~~~~~~~~~~l~v~GG~~~--~~~~~v~~yd~~~  388 (518)
                      .|.+|..++++.....+++.|++|||...  +.++|+|+|++++
T Consensus       426 ~P~~R~~~~~~~~~~~~~~~~~~fGG~~~~~~~~~D~~~~~~~~  469 (470)
T PLN02193        426 TPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS  469 (470)
T ss_pred             CCCCCccccceeeEEcCCceEEEEcCCCCccccccceEEEecCC
Confidence            45666666554333334566999999964  3489999998764

>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-04
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 4e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 85/202 (42%), Gaps = 25/202 (12%)
Query: 93  AAAVIGNKMIVVGGESGNGLLDDVQVLNF----DRFSWTAAXXXXXXXXXXXXXXIPACR 148
           A+  + +++ V+GG  G   L  V+ L++    D   ++ A                  R
Sbjct: 57  ASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVR-------------R 103
Query: 149 GHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASS 208
           G +  +    ++ V G  D      S+  +D   + WS++   GD+  AR G  +V AS 
Sbjct: 104 GLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSML---GDMQTAREGAGLVVASG 160
Query: 209 VLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGS 268
           V+   GG DG    LN +  +D  +  W  +    T    RS    AL +D ++ + GG 
Sbjct: 161 VIYCLGGYDGL-NILNSVEKYDPHTGHWTNVTPMAT---KRSGAGVALLND-HIYVVGGF 215
Query: 269 SKSKTLNDLYSLDFETMIWTRI 290
             +  L+ + + +  T  WT +
Sbjct: 216 DGTAHLSSVEAYNIRTDSWTTV 237
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-40
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-39
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-26
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-31
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-19
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-15
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-31
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-31
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-13
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-31
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-24
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-25
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-27
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-24
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-13
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 3e-07
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  154 bits (391), Expect = 1e-40
 Identities = 50/275 (18%), Positives = 87/275 (31%), Gaps = 35/275 (12%)

Query: 65  VSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIG--NKMIVVGGESGNG-LLDDVQVLNF 121
             +      +   +   + + P+ R  H    I   N+++++GG       L D  + + 
Sbjct: 416 QLSIHYDKIDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDM 475

Query: 122 DRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGK-KVLLVGGKTDSGSDRVSVWTFDT 180
               W+           SL         HS  S     VL++GG T+  +    +  ++ 
Sbjct: 476 KTREWS--------MIKSLS---HTRFRHSACSLPDGNVLILGGVTEGPA----MLLYNV 520

Query: 181 ETECWSVVEAKGDIPVARSGHTVV----RASSVLILFGGEDGKRRKLNDLHMFDLK---- 232
             E +  V  K +          +     +   +IL GG   +    +   +F       
Sbjct: 521 TEEIFKDVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENA 580

Query: 233 SLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTL---NDLYSLDFETMIWTR 289
           +     +         R          + LLI GG+S S      N + SLD  +   T 
Sbjct: 581 TEPITVIKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTS 640

Query: 290 IKI----RGFHPSPRAG-CCGVLCGTKWYIAGGGS 319
           I I       H    AG           +I GGG+
Sbjct: 641 IPISRRIWEDHSLMLAGFSLVSTSMGTIHIIGGGA 675
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.34
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.04
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.96
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.78
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.67
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.64
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.59
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.57
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.43
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.33
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.33
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.31
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.3
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.29
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.29
3jrp_A379 Fusion protein of protein transport protein SEC13 97.2
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.19
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.14
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.13
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.12
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.11
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.11
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.1
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.05
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.05
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.79
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.78
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.77
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.72
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.69
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.65
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.62
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.61
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.59
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.59
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.55
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.49
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.48
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.43
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.4
3jro_A 753 Fusion protein of protein transport protein SEC13 96.37
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.35
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.34
3jrp_A379 Fusion protein of protein transport protein SEC13 96.33
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.32
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.32
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.28
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.26
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.26
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.25
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.23
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.21
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.18
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.17
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.07
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.05
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.04
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.01
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.9
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.9
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.84
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.76
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.72
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.72
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.68
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.66
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.65
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.64
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.63
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.6
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.54
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.51
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.44
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.39
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.38
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.37
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.35
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.33
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.29
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.28
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.25
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.24
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.23
3jro_A 753 Fusion protein of protein transport protein SEC13 95.23
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.22
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.16
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.16
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.15
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.11
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.08
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.07
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.04
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.0
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.98
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.91
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 94.88
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.88
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.81
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.8
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.8
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.77
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.72
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.69
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.69
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.65
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.63
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.61
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 94.59
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.57
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.56
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.55
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.55
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.54
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.52
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.42
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.38
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.37
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.33
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 94.31
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.25
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 94.23
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.18
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.02
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 93.92
2pm7_B297 Protein transport protein SEC13, protein transport 93.88
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.8
2pm7_B297 Protein transport protein SEC13, protein transport 93.8
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.77
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.77
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.7
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.6
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.59
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.58
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 93.55
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.54
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.54
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.53
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 93.5
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 93.43
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.38
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.24
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.24
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.21
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.09
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.09
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.08
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 92.99
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 92.92
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 92.91
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 92.87
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 92.86
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 92.65
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.65
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.59
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.58
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.43
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.4
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 92.36
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.35
3ott_A758 Two-component system sensor histidine kinase; beta 92.28
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.01
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.65
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.48
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 91.48
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.3
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 91.25
2ymu_A577 WD-40 repeat protein; unknown function, two domain 91.19
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 90.62
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 90.59
1itv_A195 MMP9; adaptive molecular recognition, beta propell 90.56
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.54
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 90.23
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 90.14
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 90.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 89.74
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.65
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.59
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 89.48
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 89.32
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.27
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 89.04
2fp8_A322 Strictosidine synthase; six bladed beta propeller 88.99
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 88.96
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 88.8
2xyi_A430 Probable histone-binding protein CAF1; transcripti 88.76
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 88.55
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 88.37
3ott_A 758 Two-component system sensor histidine kinase; beta 88.27
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 88.06
1itv_A195 MMP9; adaptive molecular recognition, beta propell 87.88
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 87.31
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 87.06
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 87.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 86.97
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 86.92
2cn3_A 737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 86.74
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.71
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 86.61
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 86.53
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.02
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 85.15
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 84.54
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 83.24
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 83.1
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 82.29
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 80.61
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 80.03
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.4e-45  Score=363.72  Aligned_cols=292  Identities=16%  Similarity=0.211  Sum_probs=248.6

Q ss_pred             CCCccCCCCCceEeccCCCCCCcceecccccccccCCCCCCCCeEEeccCCCCCCCccceEEEEECCEEEEEcCcCCCCC
Q 010115           33 PKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGL  112 (518)
Q Consensus        33 ~~r~~~~~~~~i~~~GG~~~~~~~~~~~~~~~~~~~~~~~~~~W~~l~~~~~~p~~R~~~~~~~~~~~lyv~GG~~~~~~  112 (518)
                      .+|..+..++.||++||.....  ......|++      .+++|..++   ++|.+|.+|++++++++|||+||......
T Consensus         7 ~~r~~~~~~~~i~v~GG~~~~~--~~~~~~~d~------~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~~~~   75 (302)
T 2xn4_A            7 RLRTPMNLPKLMVVVGGQAPKA--IRSVECYDF------KEERWHQVA---ELPSRRCRAGMVYMAGLVFAVGGFNGSLR   75 (302)
T ss_dssp             --------CEEEEEECCBSSSB--CCCEEEEET------TTTEEEEEC---CCSSCCBSCEEEEETTEEEEESCBCSSSB
T ss_pred             cCCcccCCCCEEEEECCCCCCC--CCcEEEEcC------cCCcEeEcc---cCCcccccceEEEECCEEEEEeCcCCCcc
Confidence            4566777788899999965421  112223444      888999997   89999999999999999999999987778


Q ss_pred             CCcEEEEEcCCCcEEEcccccccCCCCCCCCCCCccceEEEEECCEEEEEcCcCCCCCCceeEEEEECCCCcEEEeeecC
Q 010115          113 LDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKG  192 (518)
Q Consensus       113 ~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~~  192 (518)
                      .+++++||+.+++|+.++++           +.+|..|++++++++||++||... ....+++|+||+.+++|+.+++  
T Consensus        76 ~~~~~~~d~~~~~W~~~~~~-----------p~~r~~~~~~~~~~~iyv~GG~~~-~~~~~~~~~~d~~~~~W~~~~~--  141 (302)
T 2xn4_A           76 VRTVDSYDPVKDQWTSVANM-----------RDRRSTLGAAVLNGLLYAVGGFDG-STGLSSVEAYNIKSNEWFHVAP--  141 (302)
T ss_dssp             CCCEEEEETTTTEEEEECCC-----------SSCCBSCEEEEETTEEEEEEEECS-SCEEEEEEEEETTTTEEEEECC--
T ss_pred             ccceEEECCCCCceeeCCCC-----------CccccceEEEEECCEEEEEcCCCC-CccCceEEEEeCCCCeEeecCC--
Confidence            89999999999999999863           346788999999999999999865 3456899999999999999986  


Q ss_pred             CCCCCCcceEEEEECCEEEEEcccCCCC-cccCcEEEEEcCCCcEEEeecCCCCCCCCCCcEEEEECCcEEEEEcCCCCC
Q 010115          193 DIPVARSGHTVVRASSVLILFGGEDGKR-RKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKS  271 (518)
Q Consensus       193 ~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~~lyv~GG~~~~  271 (518)
                       +|.+|.+|++++++++||++||.+... ..++++++||+.+++|+.+.   ++|.+|..|++++++++ |||+||.+..
T Consensus       142 -~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~-iyv~GG~~~~  216 (302)
T 2xn4_A          142 -MNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIA---EMSTRRSGAGVGVLNNL-LYAVGGHDGP  216 (302)
T ss_dssp             -CSSCCBSCEEEEETTEEEEECCEETTTTEECCCEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTE-EEEECCBSSS
T ss_pred             -CCCcccCceEEEECCEEEEEeCCCCCCCccccEEEEEeCCCCcEEECC---CCccccccccEEEECCE-EEEECCCCCC
Confidence             999999999999999999999997653 45889999999999999997   89999999999999988 9999999877


Q ss_pred             CCCCcEEEEEcCCCeEEEeecCCCCCCCCcceEEEEECCEEEEEcccCCCCCcCeEEEEECCCCceEEeecCCCCCCCCC
Q 010115          272 KTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSN  351 (518)
Q Consensus       272 ~~~~~v~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~r  351 (518)
                      ...+++++||+++++|+.+..+   |.+|..|+++.++++|||+||.+.....+++++||+++++|+.++   ..++.+|
T Consensus       217 ~~~~~~~~yd~~~~~W~~~~~~---~~~r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~yd~~~~~W~~~~---~~~~~~r  290 (302)
T 2xn4_A          217 LVRKSVEVYDPTTNAWRQVADM---NMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVS---SCMSTGR  290 (302)
T ss_dssp             SBCCCEEEEETTTTEEEEECCC---SSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECS---SCCSSCC
T ss_pred             cccceEEEEeCCCCCEeeCCCC---CCccccCeEEEECCEEEEECCcCCCcccccEEEEcCCCCeEEECC---cccCccc
Confidence            7789999999999999999765   889999999999999999999887777889999999999999975   2346788


Q ss_pred             CCceEEEEe
Q 010115          352 KGFTLVLVQ  360 (518)
Q Consensus       352 ~~~s~~~~~  360 (518)
                      .+|+++++.
T Consensus       291 ~~~~~~~~~  299 (302)
T 2xn4_A          291 SYAGVTVID  299 (302)
T ss_dssp             BSCEEEEEE
T ss_pred             ccceEEEec
Confidence            999999886
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-14
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-07
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.001
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.9 bits (169), Expect = 8e-14
 Identities = 47/264 (17%), Positives = 78/264 (29%), Gaps = 22/264 (8%)

Query: 76  WMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYL 135
           W+ L+   D  +PR   A  V+G  +  VGG + +   +            T   S    
Sbjct: 31  WLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA- 86

Query: 136 SPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIP 195
                   +   R    +      +   G +       SV  ++ E + W +      + 
Sbjct: 87  -------PMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHL---VAPML 136

Query: 196 VARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAA 255
             R G  V   + +L   GG D    +LN    +  +   W  +    T  S        
Sbjct: 137 TRRIGVGVAVLNRLLYAVGGFD-GTNRLNSAECYYPERNEWRMITAMNTIRSGAGVC--- 192

Query: 256 LYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIA 315
                 +   GG      LN +   D ET  WT +         R+     +   + Y+ 
Sbjct: 193 -VLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA---PMKHRRSALGITVHQGRIYVL 248

Query: 316 GGGSRKKRHAETLIFDILKGEWSV 339
           GG            +D     WS 
Sbjct: 249 GGYDGHTFLDSVECYDPDTDTWSE 272
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.56
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.49
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.41
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.35
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.22
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.86
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.76
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.33
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.13
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.96
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.19
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.74
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.52
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.45
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.42
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.4
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.24
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.21
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 92.91
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.52
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.94
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 91.93
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 91.6
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.58
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.5
d1tbga_340 beta1-subunit of the signal-transducing G protein 91.1
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.73
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 90.36
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 90.16
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.61
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.53
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.12
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.54
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.36
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 88.11
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 87.87
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.74
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 86.84
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 86.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 83.75
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 82.8
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 82.02
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-39  Score=316.44  Aligned_cols=281  Identities=19%  Similarity=0.269  Sum_probs=244.4

Q ss_pred             CCCceEeccCCCCCCcceecccccccccCCCCCCCCeEEeccCCCCCCCccceEEEEECCEEEEEcCcCC----CCCCCc
Q 010115           40 NSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESG----NGLLDD  115 (518)
Q Consensus        40 ~~~~i~~~GG~~~~~~~~~~~~~~~~~~~~~~~~~~W~~l~~~~~~p~~R~~~~~~~~~~~lyv~GG~~~----~~~~~~  115 (518)
                      +++.||++||..++.  ....+.|++      ++++|+.++   ++|.+|.+|++++++++|||+||...    ...+++
T Consensus         3 ~g~~iyv~GG~~~~~--~~~~~~yd~------~t~~W~~~~---~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~   71 (288)
T d1zgka1           3 VGRLIYTAGGYFRQS--LSYLEAYNP------SNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSA   71 (288)
T ss_dssp             CCCCEEEECCBSSSB--CCCEEEEET------TTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCC
T ss_pred             cCCEEEEECCcCCCC--CceEEEEEC------CCCeEEECC---CCCCccceeEEEEECCEEEEEeCcccCCCCccccch
Confidence            477899999965432  223344655      999999997   89999999999999999999999642    234789


Q ss_pred             EEEEEcCCCcEEEcccccccCCCCCCCCCCCccceEEEEECCEEEEEcCcCCCCCCceeEEEEECCCCcEEEeeecCCCC
Q 010115          116 VQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIP  195 (518)
Q Consensus       116 v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~t~~W~~~~~~~~~p  195 (518)
                      +++||+.+++|+.++++           +.+|..|+++++++++|++||... ....++++.||+.+++|.....   ++
T Consensus        72 ~~~yd~~~~~w~~~~~~-----------p~~r~~~~~~~~~~~i~~~gg~~~-~~~~~~~~~~~~~~~~~~~~~~---~~  136 (288)
T d1zgka1          72 LDCYNPMTNQWSPCAPM-----------SVPRNRIGVGVIDGHIYAVGGSHG-CIHHNSVERYEPERDEWHLVAP---ML  136 (288)
T ss_dssp             EEEEETTTTEEEECCCC-----------SSCCBTCEEEEETTEEEEECCEET-TEECCCEEEEETTTTEEEECCC---CS
T ss_pred             hhhcccccccccccccc-----------cceecceeccccceeeEEecceec-ccccceeeeeccccCccccccc---cc
Confidence            99999999999999873           346789999999999999999864 3446789999999999998875   89


Q ss_pred             CCCcceEEEEECCEEEEEcccCCCCcccCcEEEEEcCCCcEEEeecCCCCCCCCCCcEEEEECCcEEEEEcCCCCCCCCC
Q 010115          196 VARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLN  275 (518)
Q Consensus       196 ~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~t~~W~~~~~~g~~p~~r~~~~~~~~~~~~lyv~GG~~~~~~~~  275 (518)
                      .+|.+|+++..++++|++||.+.. ...++++.||+.+++|....   ..+.++..+++++++++ ++++||.+....++
T Consensus       137 ~~r~~~~~~~~~~~~~~~GG~~~~-~~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~-i~i~GG~~~~~~~~  211 (288)
T d1zgka1         137 TRRIGVGVAVLNRLLYAVGGFDGT-NRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNC-IYAAGGYDGQDQLN  211 (288)
T ss_dssp             SCCBSCEEEEETTEEEEECCBCSS-CBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTE-EEEECCBCSSSBCC
T ss_pred             cccccceeeeeeecceEecCcccc-cccceEEEeecccccccccc---ccccccccccccceeee-EEEecCcccccccc
Confidence            999999999999999999999765 45789999999999999987   78888999999999988 99999998888899


Q ss_pred             cEEEEEcCCCeEEEeecCCCCCCCCcceEEEEECCEEEEEcccCCCCCcCeEEEEECCCCceEEeecCCCCCCCCCCCce
Q 010115          276 DLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFT  355 (518)
Q Consensus       276 ~v~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~r~~~s  355 (518)
                      +.+.||+.+++|+.++..   |.+|..|++++++++|||+||.+.....+++++||+.+++|+.+..+    |.+|.+|+
T Consensus       212 ~~~~~~~~~~~~~~~~~~---p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~----p~~R~~~~  284 (288)
T d1zgka1         212 SVERYDVETETWTFVAPM---KHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRM----TSGRSGVG  284 (288)
T ss_dssp             CEEEEETTTTEEEECCCC---SSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEEC----SSCCBSCE
T ss_pred             ceeeeeecceeeecccCc---cCcccceEEEEECCEEEEEecCCCCeecceEEEEECCCCEEEECCCC----CCCcEeEE
Confidence            999999999999999765   88999999999999999999998888889999999999999999743    56788888


Q ss_pred             EEE
Q 010115          356 LVL  358 (518)
Q Consensus       356 ~~~  358 (518)
                      +++
T Consensus       285 ~~~  287 (288)
T d1zgka1         285 VAV  287 (288)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            764
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure