Citrus Sinensis ID: 010191

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-----
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
cccHHHHHHHHHHHHccEEEcccccccccccccccEEEEEcccccEEEEEccccccccccccEEEEEEEccccccccEEEEEEcccccccccccccccccccccccccEEEEEEEcccccccEEccEEEEEEEEEccccEEEEEEEccccccEEEEEcccccccccccccEEEEEEcccccEEEEEEEccccccccccEEEEEcccccccEEEcccEEEEcccccccccccccccccccEEEEEEcccccccEEEEEEccccccccccccccEEEEEcccccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEcEEEEEEEcccccccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccEEcccccccccc
ccHHHHHHHHHHHHHHHHHHHcccccccccHEEEEEEEEEcccccEEEEcHHHcccccccccEEEEEEcccccccccEEEEEccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEcccccccEEEEEcccccccccccccEEEEEEcccccEEEEEEEcccccccccEEEEEcccccccEEccccEEEEEccccccccccccccccccEEEEEEEcccccccEEEEEEcccccccccccccEEEEEccccccccccEEEEEEEccccccccccccHcccccccHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccEEccccccccccccEEEEEccEEEEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEEccccEEccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccccEEccEcc
MRELRSICLGILLVLGAFRltishedqplskIAIHKAVFalddnayikaspsilgmkgqnsdwltveynspnpsvgdwigvfspsnfssstcpaenprvyppllcsapikfqyanysspqykstgkgslkLQLINQRSDFSFVLftngllnpkVVAVSNkvtftnpnapvyprlaqgkvwNEMTVTWTsgygineaepfvewgpkggdrtyspagtltfgrgsmcgapartvgwrdpgyihtgflrelwpnamytYKLGHRLFNGTYiwsseyqfkaspypgqdslqQVIIFGdmgkdeadgsneynnfqrgslNTTRQLIQDLKNIDIVFHIGDIcyangyisqwDQFTAqiepiastvpymiasgnherdwpgtgsfygnmdsggecgVLVEnmfyvptenrakfwystdygMFRFCIADTEQDWREGTEQYRFIEHCLasvdrqkqpwLIFLAHRVLgyssdlsyavegsfaepmgRESLQKLWQKYKVDIAVFGHvhnyericpiyqwhhv
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVtftnpnapvyprlaqgkvWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICpiyqwhhv
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
****RSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNF****C*AENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDM****************GSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWH**
***LRSICLGILLVLGAFRLT*****QPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSN********ENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
*RELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHHV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query515 2.2.26 [Sep-21-2011]
Q9LMX4613 Probable inactive purple yes no 0.992 0.833 0.755 0.0
Q5MAU8611 Probable inactive purple no no 0.970 0.818 0.686 0.0
Q8H1R2615 Probable inactive purple no no 0.941 0.788 0.661 0.0
Q687E1368 Nucleotide pyrophosphatas N/A no 0.481 0.673 0.697 1e-107
Q9LMG7 656 Probable inactive purple no no 0.840 0.660 0.313 4e-50
Q9ZQ81 651 Probable inactive purple no no 0.831 0.657 0.322 3e-48
Q8BX37438 Iron/zinc purple acid pho no no 0.541 0.636 0.289 8e-19
Q9LXI4437 Purple acid phosphatase 2 no no 0.607 0.716 0.274 1e-18
Q9LXI7427 Probable purple acid phos no no 0.568 0.686 0.248 2e-17
Q6TPH1458 Purple acid phosphatase 2 no no 0.471 0.530 0.267 2e-17
>sp|Q9LMX4|PPA1_ARATH Probable inactive purple acid phosphatase 1 OS=Arabidopsis thaliana GN=PAP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/512 (75%), Positives = 440/512 (85%), Gaps = 1/512 (0%)

Query: 1   MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
           MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct: 1   MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query: 60  NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
           +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct: 61  HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query: 120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
           +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct: 121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query: 180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
           W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct: 181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query: 240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
           IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct: 241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query: 300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
            DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct: 301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query: 360 VPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFC 419
           VPYMIASGNHER WP +GSFY  +DSGGECGV  E MFYVP +NRAK WYS+DYGMFRFC
Sbjct: 361 VPYMIASGNHERVWPNSGSFYEGLDSGGECGVPAETMFYVPAQNRAKVWYSSDYGMFRFC 420

Query: 420 IADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMG 479
           +ADTE DWREGTEQY FIEHCLASVDRQKQPWLIFLAHRVLGYSS   YA EGSFAEPMG
Sbjct: 421 VADTEHDWREGTEQYNFIEHCLASVDRQKQPWLIFLAHRVLGYSSTYFYAEEGSFAEPMG 480

Query: 480 RESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
           RESLQKLWQKYKVDIA++GH HNYER CP+YQ
Sbjct: 481 RESLQKLWQKYKVDIAIYGHAHNYERTCPVYQ 512

Arabidopsis thaliana (taxid: 3702)
>sp|Q5MAU8|PPA27_ARATH Probable inactive purple acid phosphatase 27 OS=Arabidopsis thaliana GN=PAP27 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1R2|PPA24_ARATH Probable inactive purple acid phosphatase 24 OS=Arabidopsis thaliana GN=PAP24 PE=2 SV=1 Back     alignment and function description
>sp|Q687E1|NPP_HORVU Nucleotide pyrophosphatase/phosphodiesterase (Fragments) OS=Hordeum vulgare GN=npp PE=1 SV=2 Back     alignment and function description
>sp|Q9LMG7|PPA2_ARATH Probable inactive purple acid phosphatase 2 OS=Arabidopsis thaliana GN=PAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQ81|PPA9_ARATH Probable inactive purple acid phosphatase 9 OS=Arabidopsis thaliana GN=PAP9 PE=2 SV=1 Back     alignment and function description
>sp|Q8BX37|PAPL_MOUSE Iron/zinc purple acid phosphatase-like protein OS=Mus musculus GN=Papl PE=2 SV=2 Back     alignment and function description
>sp|Q9LXI4|PPA21_ARATH Purple acid phosphatase 21 OS=Arabidopsis thaliana GN=PAP21 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXI7|PPA20_ARATH Probable purple acid phosphatase 20 OS=Arabidopsis thaliana GN=PAP20 PE=2 SV=1 Back     alignment and function description
>sp|Q6TPH1|PPA23_ARATH Purple acid phosphatase 23 OS=Arabidopsis thaliana GN=PAP23 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
297738089 672 unnamed protein product [Vitis vinifera] 0.992 0.760 0.810 0.0
359472541612 PREDICTED: probable inactive purple acid 0.992 0.834 0.810 0.0
224112110614 predicted protein [Populus trichocarpa] 0.992 0.832 0.810 0.0
18075960612 putative metallophosphatase [Lupinus lut 0.992 0.834 0.780 0.0
224098974 621 predicted protein [Populus trichocarpa] 0.992 0.822 0.771 0.0
449452841612 PREDICTED: probable inactive purple acid 0.992 0.834 0.776 0.0
255542026615 hydrolase, putative [Ricinus communis] g 0.949 0.795 0.816 0.0
356567597611 PREDICTED: probable inactive purple acid 0.970 0.818 0.786 0.0
356526862 616 PREDICTED: probable inactive purple acid 0.970 0.811 0.78 0.0
18075958615 diphosphonucleotide phosphatase 1 [Lupin 0.990 0.829 0.771 0.0
>gi|297738089|emb|CBI27290.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/511 (81%), Positives = 457/511 (89%)

Query: 1   MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQN 60
           MR   +  L IL  L      ISH DQPL+KIAIH A FAL D AY+KASP++LG+ GQN
Sbjct: 61  MRVFGASLLAILWALACIEGAISHGDQPLAKIAIHNAKFALHDQAYVKASPTVLGLGGQN 120

Query: 61  SDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQ 120
           ++++TVE++SP+PSV DWIGVFSP+NFS+STC  E+ RV PPLLCSAPIK+QYANY+SP 
Sbjct: 121 TEFVTVEFSSPSPSVDDWIGVFSPANFSASTCLPEDIRVTPPLLCSAPIKYQYANYTSPN 180

Query: 121 YKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVW 180
           YK+TGKGSLKLQLINQRSDFSF LF+ GL+NPK+VAVSN V F NPNAPVYPRLAQGKVW
Sbjct: 181 YKNTGKGSLKLQLINQRSDFSFALFSGGLVNPKLVAVSNSVAFANPNAPVYPRLAQGKVW 240

Query: 181 NEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYI 240
           NEMTVTWTSGYGIN+A PF+EWG KGGD+  SPAGTLTF R SMCGAPA TVGWRDPGYI
Sbjct: 241 NEMTVTWTSGYGINDAAPFIEWGLKGGDKVRSPAGTLTFDRRSMCGAPASTVGWRDPGYI 300

Query: 241 HTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEA 300
           HT FL+ELWPN +Y+YKLGHRLFNGTYIWS +YQF+ASPYPGQ+SLQ+V+IFGDMGKDEA
Sbjct: 301 HTSFLKELWPNLVYSYKLGHRLFNGTYIWSQQYQFRASPYPGQNSLQRVVIFGDMGKDEA 360

Query: 301 DGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTV 360
           DGSNEYN +QRGSLNTT+QLI+DLKNIDIVFHIGDICYANGY+SQWDQFTAQ+E I STV
Sbjct: 361 DGSNEYNQYQRGSLNTTKQLIEDLKNIDIVFHIGDICYANGYLSQWDQFTAQVESITSTV 420

Query: 361 PYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFCI 420
           PYMIASGNHERDWPGTGSFYGN+DSGGECGVL E MFYVP ENRAKFWYSTD+GMFRFCI
Sbjct: 421 PYMIASGNHERDWPGTGSFYGNLDSGGECGVLAETMFYVPAENRAKFWYSTDFGMFRFCI 480

Query: 421 ADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGR 480
           ADTE DWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSS   YA EGSFAEPMGR
Sbjct: 481 ADTEHDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSSSFYAEEGSFAEPMGR 540

Query: 481 ESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
           + LQKLWQKYKVDIA++GHVHNYER CPIYQ
Sbjct: 541 DDLQKLWQKYKVDIAMYGHVHNYERTCPIYQ 571

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359472541|ref|XP_002274118.2| PREDICTED: probable inactive purple acid phosphatase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112110|ref|XP_002316086.1| predicted protein [Populus trichocarpa] gi|222865126|gb|EEF02257.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18075960|emb|CAD12837.1| putative metallophosphatase [Lupinus luteus] Back     alignment and taxonomy information
>gi|224098974|ref|XP_002311341.1| predicted protein [Populus trichocarpa] gi|222851161|gb|EEE88708.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452841|ref|XP_004144167.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255542026|ref|XP_002512077.1| hydrolase, putative [Ricinus communis] gi|223549257|gb|EEF50746.1| hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356567597|ref|XP_003552004.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356526862|ref|XP_003532035.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|18075958|emb|CAD12836.1| diphosphonucleotide phosphatase 1 [Lupinus luteus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
TAIR|locus:2023870613 AT1G13750 [Arabidopsis thalian 0.992 0.833 0.755 2.2e-224
TAIR|locus:2177547611 PAP27 "purple acid phosphatase 0.968 0.816 0.687 7e-196
TAIR|locus:2117353615 PAP24 "purple acid phosphatase 0.974 0.816 0.645 1.1e-188
DICTYBASE|DDB_G0281861594 DDB_G0281861 [Dictyostelium di 0.337 0.292 0.443 1.2e-52
TAIR|locus:2014839 656 PAP2 "AT1G13900" [Arabidopsis 0.846 0.664 0.327 4e-51
TAIR|locus:2063777 651 PAP9 "purple acid phosphatase 0.638 0.505 0.329 5.4e-51
DICTYBASE|DDB_G0268222492 DDB_G0268222 "acid phosphatase 0.586 0.613 0.286 2.2e-22
DICTYBASE|DDB_G0282559431 dduA "N-terminal purple acid p 0.489 0.584 0.292 2.2e-21
DICTYBASE|DDB_G0285351454 DDB_G0285351 [Dictyostelium di 0.570 0.647 0.274 1.9e-18
FB|FBgn0030245458 CG1637 [Drosophila melanogaste 0.466 0.524 0.293 7.2e-18
TAIR|locus:2023870 AT1G13750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2166 (767.5 bits), Expect = 2.2e-224, P = 2.2e-224
 Identities = 387/512 (75%), Positives = 440/512 (85%)

Query:     1 MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
             MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct:     1 MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query:    60 NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
             +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct:    61 HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query:   120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
             +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct:   121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query:   180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
             W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct:   181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query:   240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
             IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct:   241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query:   300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
              DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct:   301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query:   360 VPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENRAKFWYSTDYGMFRFC 419
             VPYMIASGNHER WP +GSFY  +DSGGECGV  E MFYVP +NRAK WYS+DYGMFRFC
Sbjct:   361 VPYMIASGNHERVWPNSGSFYEGLDSGGECGVPAETMFYVPAQNRAKVWYSSDYGMFRFC 420

Query:   420 IADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMG 479
             +ADTE DWREGTEQY FIEHCLASVDRQKQPWLIFLAHRVLGYSS   YA EGSFAEPMG
Sbjct:   421 VADTEHDWREGTEQYNFIEHCLASVDRQKQPWLIFLAHRVLGYSSTYFYAEEGSFAEPMG 480

Query:   480 RESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
             RESLQKLWQKYKVDIA++GH HNYER CP+YQ
Sbjct:   481 RESLQKLWQKYKVDIAIYGHAHNYERTCPVYQ 512
GO:0003993 "acid phosphatase activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2177547 PAP27 "purple acid phosphatase 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117353 PAP24 "purple acid phosphatase 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281861 DDB_G0281861 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2014839 PAP2 "AT1G13900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063777 PAP9 "purple acid phosphatase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268222 DDB_G0268222 "acid phosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282559 dduA "N-terminal purple acid phosphatase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285351 DDB_G0285351 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0030245 CG1637 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LMX4PPA1_ARATHNo assigned EC number0.75580.99220.8336yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
cd00839294 cd00839, MPP_PAPs, purple acid phosphatases of the 4e-65
PLN02533427 PLN02533, PLN02533, probable purple acid phosphata 1e-19
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 2e-14
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 0.004
>gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information 
 Score =  212 bits (542), Expect = 4e-65
 Identities = 81/230 (35%), Positives = 117/230 (50%), Gaps = 26/230 (11%)

Query: 287 QQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQ- 345
            +  +FGDMG++  +           S NT   L ++L N D + H+GD+ YA+GY +  
Sbjct: 5   FKFAVFGDMGQNTNN-----------STNTLDHLEKELGNYDAILHVGDLAYADGYNNGS 53

Query: 346 -WDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTENR 404
            WD F  QIEP+AS VPYM+  GNHE D+  +                     + P+ + 
Sbjct: 54  RWDTFMRQIEPLASYVPYMVTPGNHEADYNFSFYKIKAFFP-------RFRFPHSPSGST 106

Query: 405 AKFWYSTDYGMFRFCIADTEQDWR---EGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLG 461
           +  WYS D G   F    TE D+     G+ QY ++E  LA VDR K PW+I + HR + 
Sbjct: 107 SNLWYSFDVGPVHFVSLSTEVDFYGDGPGSPQYDWLEADLAKVDRSKTPWIIVMGHRPM- 165

Query: 462 YSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
           Y S+  +       +   R +L+ L+ KY VD+ + GHVH YER CP+Y 
Sbjct: 166 YCSNTDHDDCIEGEK--MRAALEDLFYKYGVDLVLSGHVHAYERTCPVYN 213

Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 294
>gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 515
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 100.0
PLN02533427 probable purple acid phosphatase 100.0
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 100.0
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.93
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.92
PTZ00422 394 glideosome-associated protein 50; Provisional 99.91
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.88
PF09423453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 99.87
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.86
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.85
COG3540522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 99.84
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.83
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.8
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 99.8
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.72
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.7
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.68
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.68
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.62
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 99.59
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.53
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.5
COG1409301 Icc Predicted phosphohydrolases [General function 99.48
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 99.47
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.4
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.38
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.36
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.35
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.35
PRK11340271 phosphodiesterase YaeI; Provisional 99.16
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 99.16
cd00838131 MPP_superfamily metallophosphatase superfamily, me 99.14
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.95
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.93
COG1408284 Predicted phosphohydrolases [General function pred 98.9
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.84
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 98.83
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.8
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 98.77
COG1768230 Predicted phosphohydrolase [General function predi 98.73
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 98.71
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.7
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 98.67
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 98.63
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 98.6
COG2129226 Predicted phosphoesterases, related to the Icc pro 98.58
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.57
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.55
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.54
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 98.46
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 98.46
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.38
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.3
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 98.3
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.29
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 98.29
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 98.21
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.15
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 98.07
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 98.04
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.03
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 98.0
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 97.99
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 97.9
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 97.89
KOG3662 410 consensus Cell division control protein/predicted 97.86
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 97.86
PHA02546 340 47 endonuclease subunit; Provisional 97.84
PRK10966 407 exonuclease subunit SbcD; Provisional 97.82
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 97.79
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 97.77
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 97.77
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.67
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 97.6
COG2908237 Uncharacterized protein conserved in bacteria [Fun 97.51
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 97.42
PRK09453182 phosphodiesterase; Provisional 97.42
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 97.35
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.28
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.22
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.17
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 97.17
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 97.12
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 97.12
PRK04036504 DNA polymerase II small subunit; Validated 97.11
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.07
PHA02239235 putative protein phosphatase 97.07
COG0622172 Predicted phosphoesterase [General function predic 97.01
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 97.0
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 96.99
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 96.97
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 96.88
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.87
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 96.84
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 96.72
PRK09968218 serine/threonine-specific protein phosphatase 2; P 96.64
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 96.49
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 96.47
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase 96.44
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.41
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 96.2
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.17
cd07381239 MPP_CapA CapA and related proteins, metallophospha 96.16
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 96.13
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 96.0
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 95.84
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 95.67
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 95.66
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 95.31
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 95.0
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 94.83
COG1407235 Predicted ICC-like phosphoesterases [General funct 94.81
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 94.57
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 94.57
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 94.53
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 93.8
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 93.79
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 93.69
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 93.59
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 93.25
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 93.22
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 93.19
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 92.95
cd0006393 FN3 Fibronectin type 3 domain; One of three types 92.95
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 92.73
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 92.67
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 92.66
COG1692266 Calcineurin-like phosphoesterase [General function 92.61
PTZ00480320 serine/threonine-protein phosphatase; Provisional 92.25
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 92.02
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.23
KOG4419 602 consensus 5' nucleotidase [Nucleotide transport an 88.13
smart0006083 FN3 Fibronectin type 3 domain. One of three types 86.17
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 85.72
KOG3947305 consensus Phosphoesterases [General function predi 84.16
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-64  Score=519.62  Aligned_cols=306  Identities=44%  Similarity=0.758  Sum_probs=250.5

Q ss_pred             CCCCcceeeecCCCCeEEEEEEeCCCCCCCccEEEEccCCCCcceecCcceEEeccccCCCCCccccccCCCeEEEEEec
Q 010191          167 NAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLR  246 (515)
Q Consensus       167 ~~P~~~~La~~~~~~~m~V~W~t~~~~~~~~~~V~yg~~~~~~~~~~~~~~t~~~~~mc~~pa~t~g~~~~g~~h~a~l~  246 (515)
                      ++|+|+||++++..++|+|+|.|.+.   ....|+||...+......+   ......+|+....  +|+..|++|+|+|+
T Consensus        43 ~~peQvhlS~~~~~~~m~VswvT~~~---~~~~V~Yg~~~~~~~~~~~---~~~~~~~~~~y~~--~~~~sg~ih~~~~~  114 (452)
T KOG1378|consen   43 NSPEQVHLSFTDNLNEMRVSWVTGDG---EENVVRYGEVKDKLDNSAA---RGMTEAWTDGYAN--GWRDSGYIHDAVMK  114 (452)
T ss_pred             CCCCeEEEeccCCCCcEEEEEeCCCC---CCceEEEeecCCCcccccc---ccceEEEeccccc--ccceeeeEeeeeec
Confidence            67999999999998899999999964   3489999976444222111   1111112332222  56789999999999


Q ss_pred             CCCCCCEEEEEeceecCCCcccccceEEEEcCCCCCCCCceEEEEEeecCCCCCCCCCcccccccCcHHHHHHHHHhcCC
Q 010191          247 ELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKN  326 (515)
Q Consensus       247 gL~Pgt~Y~Yrv~~~~~dg~~~wS~~~~F~T~p~~~~~~~~rf~v~gD~g~~~~~g~~~y~~~~~~~~~~~~~l~~~~~~  326 (515)
                      +|+|+|+|+||||++     ..||++|+|+|+|  ++..+.+|+++||||......             ++.....+..+
T Consensus       115 ~L~~~t~YyY~~Gs~-----~~wS~~f~F~t~p--~~~~~~~~~i~GDlG~~~~~~-------------s~~~~~~~~~k  174 (452)
T KOG1378|consen  115 NLEPNTRYYYQVGSD-----LKWSEIFSFKTPP--GQDSPTRAAIFGDMGCTEPYT-------------STLRNQEENLK  174 (452)
T ss_pred             CCCCCceEEEEeCCC-----CCcccceEeECCC--CccCceeEEEEcccccccccc-------------chHhHHhcccC
Confidence            999999999999986     3499999999998  455679999999999876422             23333343357


Q ss_pred             CCEEEEcCccccCCCch-hHHHHHHHHHhhhhcCCCEEEccCCCCCCCCCCCCCCCCCCCCCcccccccceeccCCCC--
Q 010191          327 IDIVFHIGDICYANGYI-SQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTEN--  403 (515)
Q Consensus       327 pDfVl~~GDi~y~~g~~-~~wd~f~~~i~~l~~~vP~~~v~GNHE~~~~~~g~~y~~~dsgge~g~~~~~~f~~P~~~--  403 (515)
                      +|+|||+|||+|++++. .+||+|++++|++++.+|+|++.||||++++...           |+.+|..||.||.+.  
T Consensus       175 ~d~vlhiGDlsYa~~~~n~~wD~f~r~vEp~As~vPymv~~GNHE~d~~~~~-----------~F~~y~~Rf~mP~~~s~  243 (452)
T KOG1378|consen  175 PDAVLHIGDLSYAMGYSNWQWDEFGRQVEPIASYVPYMVCSGNHEIDWPPQP-----------CFVPYSARFNMPGNSSE  243 (452)
T ss_pred             CcEEEEecchhhcCCCCccchHHHHhhhhhhhccCceEEecccccccCCCcc-----------cccccceeeccCCCcCC
Confidence            99999999999999998 6999999999999999999999999999976553           557899999999643  


Q ss_pred             -CCceEEEEEeCCEEEEEEcCCCCc--CCCHHHHHHHHHHHhcccCCCCCEEEEEeccCCcCCCCCC-CccCCCCCchhh
Q 010191          404 -RAKFWYSTDYGMFRFCIADTEQDW--REGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLS-YAVEGSFAEPMG  479 (515)
Q Consensus       404 -~~~~~Ysfd~G~v~fi~Ldt~~~~--~~g~~Q~~WL~~~La~~~r~~~pwiIv~~H~P~~yss~~~-~~~~~~~~~~~~  479 (515)
                       ..++||||++|+||||+|+|+.++  ..+.+|++||+++|++++|+++||+||++|+|+ |+|... +..++.. +.+ 
T Consensus       244 s~~~l~YSfd~G~vhfv~lsse~~~~~~~~~~QY~WL~~dL~~v~r~~tPWlIv~~HrP~-Y~S~~~~~~reG~~-~~~-  320 (452)
T KOG1378|consen  244 SDSNLYYSFDVGGVHFVVLSTETYYNFLKGTAQYQWLERDLASVDRKKTPWLIVQGHRPM-YCSSNDAHYREGEF-ESM-  320 (452)
T ss_pred             CCCceeEEEeeccEEEEEEeccccccccccchHHHHHHHHHHHhcccCCCeEEEEecccc-eecCCchhhccCcc-hhh-
Confidence             356999999999999999999985  456899999999999999877999999999999 777542 3444433 244 


Q ss_pred             HHHHHHHHHhcCCeEEEeCccccccccccccCCcc
Q 010191          480 RESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHH  514 (515)
Q Consensus       480 r~~l~~Ll~k~~VdlvlsGH~H~YeRt~p~~~~~c  514 (515)
                      |..||+||.+|+||+||+||+|+|||+||+||.+|
T Consensus       321 ~~~LE~l~~~~~VDvvf~GHvH~YER~~piyn~~~  355 (452)
T KOG1378|consen  321 REGLEPLFVKYKVDVVFWGHVHRYERFCPIYNNTC  355 (452)
T ss_pred             HHHHHHHHHHhceeEEEeccceehhccchhhccee
Confidence            88999999999999999999999999999999998

>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG4419 consensus 5' nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
2qfp_A424 Crystal Structure Of Red Kidney Bean Purple Acid Ph 2e-15
4dsy_A426 Crystal Structure Of Red Kidney Bean Purple Acid Ph 2e-15
1kbp_A432 Kidney Bean Purple Acid Phosphatase Length = 432 2e-15
1xzw_A426 Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL 7e-14
>pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 118/276 (42%), Gaps = 39/276 (14%)
Query: 238 GYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGK 297
           G+IH   +R+L  N  Y Y++G R  N T      + F   P  G D      + GD+G 
Sbjct: 77  GFIHHTTIRKLKYNTKYYYEVGLR--NTT----RRFSFITPPQTGLDVPYTFGLIGDLG- 129
Query: 298 DEADGSNEYNNFQRGSLNTTRQLIQ-DLKNIDIVFHIGDICYANGYIS----QWDQFTAQ 352
                       Q    NTT    +   K    V  +GD+ YA+ Y +    +WD +   
Sbjct: 130 ------------QSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRF 177
Query: 353 IEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTE---NRAKFWY 409
            E   +  P++  +GNHE +       +    +  E        ++VP E   + + FWY
Sbjct: 178 TERSVAYQPWIWTAGNHEIE-------FAPEINETEPFKPFSYRYHVPYEASQSTSPFWY 230
Query: 410 STDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYA 469
           S         +  +   +  GT QY +++  L  V R + PWLI L H  L Y+S   + 
Sbjct: 231 SIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPL-YNSYNHHF 289
Query: 470 VEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYER 505
           +EG   E M R   +  + KYKVD+   GHVH YER
Sbjct: 290 MEG---EAM-RTKFEAWFVKYKVDVVFAGHVHAYER 321
>pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Maybridge Fragment Cc24201 Length = 426 Back     alignment and structure
>pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 Back     alignment and structure
>pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 2e-80
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 3e-78
1ute_A313 Protein (II purple acid phosphatase); tartrate res 6e-27
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 2e-14
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 2e-08
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 2e-06
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 7e-05
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
 Score =  256 bits (654), Expect = 2e-80
 Identities = 79/355 (22%), Positives = 129/355 (36%), Gaps = 49/355 (13%)

Query: 165 NPNAPVYPRLAQGKVW-NEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGS 223
             NAP    + QG      + ++WT+ Y    A     W      +  +    +T+   +
Sbjct: 21  GYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSENSKSQKRAMGTVVTYKYYN 80

Query: 224 MCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQ 283
                          +IH   +++L  +  Y Y+LG            ++ F   P PG 
Sbjct: 81  YTS-----------AFIHHCTIKDLEYDTKYYYRLGFGD------AKRQFWFVTPPKPGP 123

Query: 284 DSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYI 343
           D      + GD+G+               S  T     Q+      V  +GD+ Y+N + 
Sbjct: 124 DVPYVFGLIGDIGQTHD------------SNTTLTHYEQNSAKGQAVLFMGDLSYSNRWP 171

Query: 344 ----SQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYV 399
               ++WD +    E   +  P++  +GNHE D       Y       +  V   N +  
Sbjct: 172 NHDNNRWDTWGRFSERSVAYQPWIWTAGNHEID-------YAPDIGEYQPFVPFTNRYPT 224

Query: 400 PTENRA---KFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLA 456
           P E        WY+         +  +   + + + QY++    L  V+R + PWLI L 
Sbjct: 225 PHEASGSGDPLWYAIKRASAHIIVLSSYSGFVKYSPQYKWFTSELEKVNRSETPWLIVLV 284

Query: 457 HRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
           H  L  S +  Y       E M R   +  +  YKVDI   GHVH+YER   +  
Sbjct: 285 HAPLYNSYEAHYME----GEAM-RAIFEPYFVYYKVDIVFSGHVHSYERSERVSN 334
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Length = 342 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 100.0
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 100.0
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 100.0
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 99.92
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.89
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.84
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.83
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.82
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.73
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.41
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.35
2q8u_A336 Exonuclease, putative; structural genomics, joint 99.18
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.09
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 98.97
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.94
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.92
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 98.79
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.78
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.78
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 98.77
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.76
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.73
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.66
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 98.55
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.24
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.23
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 98.22
3qfk_A 527 Uncharacterized protein; structural genomics, cent 98.11
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 97.98
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 97.97
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 97.93
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 97.91
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 97.87
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 97.86
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 97.84
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 97.69
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 97.66
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 97.6
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 97.57
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 97.37
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 97.32
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 97.26
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 97.25
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 97.24
1x5x_A109 Fibronectin type-III domain containing protein 3A; 97.22
2crz_A110 Fibronectin type-III domain containing protein 3A; 97.2
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 97.2
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 97.17
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 97.15
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 97.1
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 97.09
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 97.08
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 97.06
1x4x_A106 Fibronectin type-III domain containing protein 3A; 97.04
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 97.04
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 97.03
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 97.01
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 96.99
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 96.98
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 96.98
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 96.97
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 96.95
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 96.95
2crm_A120 Fibronectin type-III domain containing protein 3A; 96.94
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 96.92
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 96.85
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 96.82
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 96.81
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 96.78
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 96.76
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 96.75
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 96.75
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 96.74
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 96.73
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 96.71
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 96.68
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 96.68
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 96.65
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 96.62
1x3d_A118 Fibronectin type-III domain containing protein 3A; 96.61
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 96.57
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 96.53
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 96.51
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 96.47
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 96.43
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 96.37
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 96.34
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 96.33
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 96.32
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 96.32
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 96.31
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 96.29
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 96.29
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 96.28
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 96.28
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 96.28
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 96.25
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 96.19
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 96.18
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 96.18
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 96.16
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 96.11
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 96.1
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 96.1
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 96.04
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 95.99
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 95.96
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 95.88
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 95.88
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 95.88
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 95.81
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 95.81
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 95.79
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 95.71
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 95.68
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 95.65
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 95.62
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 95.62
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 95.61
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 95.59
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 95.59
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 95.57
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 95.55
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 95.53
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 95.52
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 95.51
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 95.49
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 95.48
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 95.45
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 95.39
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 95.37
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 95.36
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 95.36
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 95.33
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 95.33
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 95.32
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 95.3
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 95.29
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 95.27
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 95.23
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 95.22
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 95.22
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 95.1
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 95.09
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 95.04
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 95.0
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 94.96
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 94.89
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 94.86
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 94.82
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 94.77
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 94.7
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 94.56
1eer_B227 Epobp, erythropoietin receptor; signal transductio 94.49
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 94.48
3k2m_C101 Monobody HA4; engineered binding protein, antibody 94.34
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 94.29
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 94.14
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 94.11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 94.11
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 94.06
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 93.99
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 93.69
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 93.67
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 93.3
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 93.22
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 93.2
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 93.18
3t04_D103 Monobody 7C12; engineered binding protein, antibod 93.17
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 93.14
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 93.12
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 93.08
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 92.98
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 92.75
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 92.63
1oww_A98 FN, fibronectin first type III module, CIG; fibron 92.62
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 92.42
2lfe_A138 E3 ubiquitin-protein ligase HECW2; structural geno 91.93
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 91.84
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 91.78
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 90.85
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 90.44
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 90.07
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 89.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 89.71
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 89.34
2erj_C247 Cytokine receptor common gamma chain; immune syste 89.0
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 88.68
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 88.67
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 88.67
2gys_A419 Cytokine receptor common beta chain; dimer of inte 88.38
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 88.35
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 88.05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 87.12
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 86.34
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 85.44
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 85.39
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 85.2
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 84.46
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 83.73
2gys_A419 Cytokine receptor common beta chain; dimer of inte 83.25
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 83.2
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 82.52
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 80.04
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
Probab=100.00  E-value=6.1e-51  Score=432.01  Aligned_cols=306  Identities=25%  Similarity=0.417  Sum_probs=244.9

Q ss_pred             CCCCCCcceeeecCC-CCeEEEEEEeC-CCCCCCccEEEEccCCCCcceecC-cceEEeccccCCCCCccccccCCCeEE
Q 010191          165 NPNAPVYPRLAQGKV-WNEMTVTWTSG-YGINEAEPFVEWGPKGGDRTYSPA-GTLTFGRGSMCGAPARTVGWRDPGYIH  241 (515)
Q Consensus       165 ~~~~P~~~~La~~~~-~~~m~V~W~t~-~~~~~~~~~V~yg~~~~~~~~~~~-~~~t~~~~~mc~~pa~t~g~~~~g~~h  241 (515)
                      ++++|.|+||+++++ .++|+|+|+|. ..  ++.++|+|++.++.....+. .+.+|...+           ..++++|
T Consensus        21 ~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~--~~~~~V~y~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~   87 (426)
T 1xzw_A           21 GYNAPQQVHITQGDYEGRGVIISWTTPYDK--AGANKVFYWSENSKSQKRAMGTVVTYKYYN-----------YTSAFIH   87 (426)
T ss_dssp             STTCCEEEEEEECSSSSSCEEEEEEESSCC--TTTTEEEEEETTCCCCEEEECEEECCEETT-----------EECCEEE
T ss_pred             CCCCCceEEEEECCCCCCeEEEEEEeCCCC--CCCCEEEEecCCCCCceEEEEEEEEEEecC-----------CcCCEEE
Confidence            567899999999988 49999999998 42  46789999987665443332 223343210           2478999


Q ss_pred             EEEecCCCCCCEEEEEeceecCCCcccccceEEEEcCCCCCCCCceEEEEEeecCCCCCCCCCcccccccCcHHHHHHHH
Q 010191          242 TGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLI  321 (515)
Q Consensus       242 ~a~l~gL~Pgt~Y~Yrv~~~~~dg~~~wS~~~~F~T~p~~~~~~~~rf~v~gD~g~~~~~g~~~y~~~~~~~~~~~~~l~  321 (515)
                      +|+|+||+|||+|+|||+.+      .||+.++|+|+|.+++...+||+++||+|...            ....+++++.
T Consensus        88 ~v~l~gL~p~t~Y~Yrv~~g------~~s~~~~f~T~p~~~~~~~~~f~~~gD~~~~~------------~~~~~l~~i~  149 (426)
T 1xzw_A           88 HCTIKDLEYDTKYYYRLGFG------DAKRQFWFVTPPKPGPDVPYVFGLIGDIGQTH------------DSNTTLTHYE  149 (426)
T ss_dssp             EEEECCCCTTCEEEEEECCG------GGCEEEEEECCCCCCTTCCEEEEEECSCTTBH------------HHHHHHHHHH
T ss_pred             EEEECCCCCCCEEEEEECCC------CccceeEEECCCCCCCCCCeEEEEEEeCCCCC------------chHHHHHHHH
Confidence            99999999999999999862      48999999999988777889999999998642            1245677776


Q ss_pred             HhcCCCCEEEEcCccccCCCc----hhHHHHHHHHHhhhhcCCCEEEccCCCCCCCCCCCCCCCCCCCCCccccccccee
Q 010191          322 QDLKNIDIVFHIGDICYANGY----ISQWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMF  397 (515)
Q Consensus       322 ~~~~~pDfVl~~GDi~y~~g~----~~~wd~f~~~i~~l~~~vP~~~v~GNHE~~~~~~g~~y~~~dsgge~g~~~~~~f  397 (515)
                      +...++|||||+||++|+++.    ..+|+.|.+.++++.+.+|+|+++||||+.+...   .    ...++...+..+|
T Consensus       150 ~~~~~~D~vl~~GD~~y~~~~~~~~~~~~~~~~~~l~~l~~~~P~~~v~GNHD~~~~~~---~----~~~~~~~~~~~~f  222 (426)
T 1xzw_A          150 QNSAKGQAVLFMGDLSYSNRWPNHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDYAPD---I----GEYQPFVPFTNRY  222 (426)
T ss_dssp             HCTTCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEECCCCGGGCCCBGG---G----TBCSTTHHHHHHS
T ss_pred             hCCCCCCEEEeCCChhhcccCCcccchHHHHHHHHHHHHHhcCCEEEeccccccccCCc---c----ccccCChhheEEE
Confidence            533489999999999998765    5689999999999989999999999999864210   0    0012234567778


Q ss_pred             ccCCC---CCCceEEEEEeCCEEEEEEcCCCCcCCCHHHHHHHHHHHhcccCCCCCEEEEEeccCCcCCCCCCCccCCCC
Q 010191          398 YVPTE---NRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSF  474 (515)
Q Consensus       398 ~~P~~---~~~~~~Ysfd~G~v~fi~Ldt~~~~~~g~~Q~~WL~~~La~~~r~~~pwiIv~~H~P~~yss~~~~~~~~~~  474 (515)
                      .||.+   ...+.||+|++|+++||+||++.++..+.+|++||+++|++++|++++|+||++|+|+ |++..++..++  
T Consensus       223 ~~p~~~~~~~~~~~ys~~~g~~~~i~Ldt~~~~~~~~~Q~~WL~~~L~~~~~~~~~w~Iv~~H~P~-~~~~~~~~~~~--  299 (426)
T 1xzw_A          223 PTPHEASGSGDPLWYAIKRASAHIIVLSSYSGFVKYSPQYKWFTSELEKVNRSETPWLIVLVHAPL-YNSYEAHYMEG--  299 (426)
T ss_dssp             CCCCGGGTCSSTTSEEEEETTEEEEECCTTSCCSTTSHHHHHHHHHHHHCCTTTCCEEEEECSSCS-SCCBSTTTTTT--
T ss_pred             eCCcccCCCCCCCeEEEEECCEEEEEeeCcccCCCCHHHHHHHHHHHHhhhhcCCCEEEEEeccCc-eeCCCcccCCC--
Confidence            88863   2357899999999999999999877778999999999999988778999999999999 87654332222  


Q ss_pred             CchhhHHHHHHHHHhcCCeEEEeCccccccccccccCCc
Q 010191          475 AEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWH  513 (515)
Q Consensus       475 ~~~~~r~~l~~Ll~k~~VdlvlsGH~H~YeRt~p~~~~~  513 (515)
                       +.+ |+.|+++|.+++||++|+||+|.|+|++|+++++
T Consensus       300 -~~~-r~~l~~ll~~~~VdlvlsGH~H~~~r~~p~~~~~  336 (426)
T 1xzw_A          300 -EAM-RAIFEPYFVYYKVDIVFSGHVHSYERSERVSNVA  336 (426)
T ss_dssp             -HHH-HHHHHHHHHHTTCSEEEECSSSSEEEECSEECCC
T ss_pred             -HHH-HHHHHHHHHHhCCCEEEEcChhhheeeeeecCcc
Confidence             344 9999999999999999999999999999999876
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2lfe_A E3 ubiquitin-protein ligase HECW2; structural genomics, northeast structural genomics consortiu SGC; NMR {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 515
d2qfra2312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 3e-33
d1utea_302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 1e-17
d2qfra1112 b.1.12.1 (A:9-120) Purple acid phosphatase, N-term 2e-16
d1xzwa1119 b.1.12.1 (A:1-119) Purple acid phosphatase, N-term 3e-16
d2nxfa1320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 4e-06
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 1e-05
d3d03a1271 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ 7e-04
d2yvta1257 d.159.1.6 (A:4-260) Uncharacterized protein Aq_195 0.002
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  126 bits (317), Expect = 3e-33
 Identities = 55/235 (23%), Positives = 90/235 (38%), Gaps = 25/235 (10%)

Query: 281 PGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYAN 340
            G D      + GD+G+               S  T        K    V  +GD+ YA+
Sbjct: 2   TGLDVPYTFGLIGDLGQSFD------------SNTTLSHYELSPKKGQTVLFVGDLSYAD 49

Query: 341 GYIS----QWDQFTAQIEPIASTVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENM 396
            Y +    +WD +    E   +  P++  +GNHE ++    +                ++
Sbjct: 50  RYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSY----RYHV 105

Query: 397 FYVPTENRAKFWYSTDYGMFRFCIADTEQDWREGTEQYRFIEHCLASVDRQKQPWLIFLA 456
            Y  +++ + FWYS         +  +   +  GT QY +++  L  V R + PWLI L 
Sbjct: 106 PYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLM 165

Query: 457 HRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQ 511
           H  L  S +  +           R   +  + KYKVD+   GHVH YER   +  
Sbjct: 166 HSPLYNSYNHHF-----MEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSN 215
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Length = 271 Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 100.0
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.92
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.85
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.82
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 99.81
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 99.79
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.77
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.54
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.52
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.79
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 98.66
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.6
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.53
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 98.51
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.43
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 98.36
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.97
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.88
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 97.85
d1x5xa196 Fibronectin type-III domain containing protein 3a, 97.73
d1x4xa193 Fibronectin type-III domain containing protein 3a, 97.73
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.43
d2crza197 Fibronectin type-III domain containing protein 3a, 97.41
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 97.4
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.39
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 97.38
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 97.35
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.33
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.32
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.3
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.26
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 97.24
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.17
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.16
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.1
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.09
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.07
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1va9a1109 Down syndrome cell adhesion molecule-like protein 97.05
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.04
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 97.04
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 96.98
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 96.97
d1x3da1105 Fibronectin type-III domain containing protein 3a, 96.95
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 96.93
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 96.92
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.92
d2crma1107 Fibronectin type-III domain containing protein 3a, 96.9
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 96.82
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.79
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.76
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.75
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 96.71
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.69
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 96.66
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 96.64
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 96.58
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.56
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 96.54
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.53
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 96.53
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 96.53
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 96.51
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 96.47
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.46
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.46
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.43
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 96.4
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 96.34
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 96.28
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 96.26
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 96.26
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 96.2
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.19
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 96.18
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 96.12
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 96.08
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 96.04
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.03
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 96.02
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 95.99
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 95.98
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 95.96
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 95.86
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 95.82
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.61
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 95.46
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 95.42
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 95.38
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 95.25
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 95.22
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 95.2
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 94.51
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 94.38
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 93.95
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 93.88
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 93.2
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 93.01
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 92.14
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 91.85
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 91.04
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 90.75
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 90.48
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 89.57
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 88.23
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 86.11
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 82.41
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3.2e-42  Score=348.50  Aligned_cols=209  Identities=30%  Similarity=0.473  Sum_probs=172.3

Q ss_pred             CCCCceEEEEEeecCCCCCCCCCcccccccCcHHHHHHHHHhcCCCCEEEEcCccccCCCc----hhHHHHHHHHHhhhh
Q 010191          282 GQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGY----ISQWDQFTAQIEPIA  357 (515)
Q Consensus       282 ~~~~~~rf~v~gD~g~~~~~g~~~y~~~~~~~~~~~~~l~~~~~~pDfVl~~GDi~y~~g~----~~~wd~f~~~i~~l~  357 (515)
                      |++.++||+++||+|...            ...+++..+.....+||||||+||++|+++.    ..+||+|++.++++.
T Consensus         3 g~~~p~~F~v~GD~g~~~------------~~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~wd~~~~~~~~~~   70 (312)
T d2qfra2           3 GLDVPYTFGLIGDLGQSF------------DSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSV   70 (312)
T ss_dssp             CSSCCEEEEEECSCCSBH------------HHHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEEeeCCCCC------------chHHHHHHHHHcCCCCCEEEECCCCCcCCCCcccchHHHHHHHHHHHHHh
Confidence            446789999999997642            1345566655555789999999999997653    568999999999999


Q ss_pred             cCCCEEEccCCCCCCCCCCCCCCCCCCCCCcccccccceeccCCC---CCCceEEEEEeCCEEEEEEcCCCCcCCCHHHH
Q 010191          358 STVPYMIASGNHERDWPGTGSFYGNMDSGGECGVLVENMFYVPTE---NRAKFWYSTDYGMFRFCIADTEQDWREGTEQY  434 (515)
Q Consensus       358 ~~vP~~~v~GNHE~~~~~~g~~y~~~dsgge~g~~~~~~f~~P~~---~~~~~~Ysfd~G~v~fi~Ldt~~~~~~g~~Q~  434 (515)
                      +.+|+|+++||||+++..       .....++..++..+|.||.+   ...+.||+|++|++|||+||++..+..+++|+
T Consensus        71 ~~~P~~~~~GNHD~~~~~-------~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~~~~~~~Q~  143 (312)
T d2qfra2          71 AYQPWIWTAGNHEIEFAP-------EINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQY  143 (312)
T ss_dssp             TTSCEEECCCGGGTCCBG-------GGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSCCSTTSHHH
T ss_pred             hcceEEEecccccccccc-------cccccccccchhhhccCCccccCCCCCceEEEEECCEEEEEeeccccccchHHHH
Confidence            999999999999986422       11223556677888999864   34577999999999999999999888899999


Q ss_pred             HHHHHHHhcccCCCCCEEEEEeccCCcCCCCCCCccCCCCCchhhHHHHHHHHHhcCCeEEEeCccccccccccccCCcc
Q 010191          435 RFIEHCLASVDRQKQPWLIFLAHRVLGYSSDLSYAVEGSFAEPMGRESLQKLWQKYKVDIAVFGHVHNYERICPIYQWHH  514 (515)
Q Consensus       435 ~WL~~~La~~~r~~~pwiIv~~H~P~~yss~~~~~~~~~~~~~~~r~~l~~Ll~k~~VdlvlsGH~H~YeRt~p~~~~~c  514 (515)
                      +||+++|++++|+++||+||++|+|+ |++...+..+   .+.+ |+.|++||.+|+||++|+||+|.|||+|||++++|
T Consensus       144 ~WL~~~L~~~~~~~~~w~iv~~H~P~-y~~~~~~~~~---~~~~-r~~l~~l~~~~~Vdlv~~GH~H~YeRt~p~~~~~~  218 (312)
T d2qfra2         144 TWLKKELRKVKRSETPWLIVLMHSPL-YNSYNHHFME---GEAM-RTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAY  218 (312)
T ss_dssp             HHHHHHHHTCCTTTCCEEEEECSSCS-SCCBSTTTTT---THHH-HHHHHHHHHHTTCSEEEECSSSSEEEECSEECCCC
T ss_pred             HHHHHHHHHHhhcCCCEEEEEccccc-cccCCCCccc---chhH-HHHHHHHHHHcCcEEEEEccCcceEEEeeccCCcc
Confidence            99999999998889999999999999 8875432211   2344 89999999999999999999999999999999886
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure