Citrus Sinensis ID: 010200
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 515 | ||||||
| 255554178 | 515 | monoxygenase, putative [Ricinus communis | 0.988 | 0.988 | 0.748 | 0.0 | |
| 359494703 | 525 | PREDICTED: ubiquinone biosynthesis monoo | 0.945 | 0.927 | 0.737 | 0.0 | |
| 449524910 | 510 | PREDICTED: ubiquinone biosynthesis monoo | 0.986 | 0.996 | 0.736 | 0.0 | |
| 449457604 | 510 | PREDICTED: ubiquinone biosynthesis monoo | 0.986 | 0.996 | 0.734 | 0.0 | |
| 79416711 | 505 | ubiquinone biosynthesis monooxygenase Co | 0.976 | 0.996 | 0.703 | 0.0 | |
| 297831190 | 505 | monooxygenase [Arabidopsis lyrata subsp. | 0.976 | 0.996 | 0.695 | 0.0 | |
| 51968852 | 505 | monooxygenase, putatve [Arabidopsis thal | 0.976 | 0.996 | 0.701 | 0.0 | |
| 79313357 | 507 | ubiquinone biosynthesis monooxygenase Co | 0.974 | 0.990 | 0.700 | 0.0 | |
| 224057583 | 447 | predicted protein [Populus trichocarpa] | 0.864 | 0.995 | 0.817 | 0.0 | |
| 357450969 | 509 | Ubiquinone biosynthesis monooxygenase CO | 0.984 | 0.996 | 0.687 | 0.0 |
| >gi|255554178|ref|XP_002518129.1| monoxygenase, putative [Ricinus communis] gi|223542725|gb|EEF44262.1| monoxygenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 799 bits (2063), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 384/513 (74%), Positives = 432/513 (84%), Gaps = 4/513 (0%)
Query: 1 MNRIIVGRLSV----NVSGLRVLQRSFCSSVAEKASSSNSGQPSSESEVKQSFTNNDDQY 56
MNR+I + S N +V R+FCS A + S+ ++E + KQS T+ Y
Sbjct: 1 MNRVIARKASAAAKDNAFKSKVPLRNFCSGAAAVNTPSSHNNNNNEDKDKQSSTHTVQPY 60
Query: 57 DVAVVGGGMVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPA 116
D+A+VGGGMVGMA CSLA+ PLTKHL+VAIIDSNPALG I +ED PDPRVSTVTPA
Sbjct: 61 DIAIVGGGMVGMAFTCSLATTPLTKHLNVAIIDSNPALGSKFSINREDSPDPRVSTVTPA 120
Query: 117 TISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSS 176
TISFFK+IGAWQYVQQHRHAYFDKMQVWDYTGLGYTKY+ARD NK+ LGCVVENKVLHSS
Sbjct: 121 TISFFKDIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYSARDANKDNLGCVVENKVLHSS 180
Query: 177 LLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSDGTSLY 236
LLS +++T+FQKTIYPSRLT+M+L SSSS VDST SA L+ KG LAKL+LS G+SLY
Sbjct: 181 LLSRVEDTDFQKTIYPSRLTTMSLHQSSSSTEVDSTSSAEALYIKGRLAKLELSAGSSLY 240
Query: 237 AKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPI 296
AKLVVGADGGKS+VRELAGFKTTGW+YSQNA+ICTVEH+ EN CAWQRFLP+GPIALLPI
Sbjct: 241 AKLVVGADGGKSQVRELAGFKTTGWNYSQNAVICTVEHSVENRCAWQRFLPSGPIALLPI 300
Query: 297 GDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGD 356
GD FSNIVWTMNPK++SDCKSMNEDDFVK +NHALD+GYGPHPKS +MF+W G+
Sbjct: 301 GDKFSNIVWTMNPKESSDCKSMNEDDFVKAVNHALDHGYGPHPKSSLFDGANMFTWLSGN 360
Query: 357 ATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNL 416
+ +SA E FEVPP+VVKLAS R+ FPLSL HA NY SKR+ LIGDAAHTVHPLAGQGVNL
Sbjct: 361 SVVSANESFEVPPKVVKLASARLAFPLSLMHAKNYTSKRIALIGDAAHTVHPLAGQGVNL 420
Query: 417 GFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPL 476
GFGDA LSRIIAEGIAVG DIGE SLLKKYEAERKPAN+ MMA+LDGFQKAYSVD GPL
Sbjct: 421 GFGDAFALSRIIAEGIAVGTDIGEVSLLKKYEAERKPANVTMMAILDGFQKAYSVDLGPL 480
Query: 477 NILRAAAFHGAQYISPLKRNIISYASGEQRLPL 509
NILRAAAFHGA +ISPLKR+IISYASGEQRLPL
Sbjct: 481 NILRAAAFHGAHHISPLKRSIISYASGEQRLPL 513
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359494703|ref|XP_002269379.2| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449524910|ref|XP_004169464.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449457604|ref|XP_004146538.1| PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|79416711|ref|NP_189062.3| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643350|gb|AEE76871.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297831190|ref|XP_002883477.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] gi|297329317|gb|EFH59736.1| monooxygenase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|51968852|dbj|BAD43118.1| monooxygenase, putatve [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79313357|ref|NP_001030758.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] gi|332643351|gb|AEE76872.1| ubiquinone biosynthesis monooxygenase Coq6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224057583|ref|XP_002299279.1| predicted protein [Populus trichocarpa] gi|222846537|gb|EEE84084.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357450969|ref|XP_003595761.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] gi|355484809|gb|AES66012.1| Ubiquinone biosynthesis monooxygenase COQ6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 515 | ||||||
| TAIR|locus:2093731 | 507 | AT3G24200 "AT3G24200" [Arabido | 0.974 | 0.990 | 0.649 | 5.3e-175 | |
| UNIPROTKB|F1PBF7 | 469 | COQ6 "Uncharacterized protein" | 0.833 | 0.914 | 0.333 | 4.3e-61 | |
| MGI|MGI:1924408 | 476 | Coq6 "coenzyme Q6 homolog (yea | 0.833 | 0.901 | 0.333 | 2.4e-60 | |
| UNIPROTKB|Q9Y2Z9 | 468 | COQ6 "Ubiquinone biosynthesis | 0.842 | 0.927 | 0.327 | 6.4e-60 | |
| RGD|1311149 | 476 | Coq6 "coenzyme Q6 homolog, mon | 0.838 | 0.907 | 0.328 | 6.4e-60 | |
| UNIPROTKB|F1S3H4 | 476 | COQ6 "Uncharacterized protein" | 0.836 | 0.905 | 0.323 | 1.7e-59 | |
| UNIPROTKB|Q2KIL4 | 469 | COQ6 "Ubiquinone biosynthesis | 0.833 | 0.914 | 0.331 | 9.3e-59 | |
| ZFIN|ZDB-GENE-060825-297 | 484 | coq6 "coenzyme Q6 homolog, mon | 0.852 | 0.907 | 0.297 | 4.6e-57 | |
| DICTYBASE|DDB_G0291440 | 495 | coq6 "monooxygenase" [Dictyost | 0.856 | 0.890 | 0.315 | 1.9e-53 | |
| UNIPROTKB|F1NBR7 | 470 | COQ6 "Uncharacterized protein" | 0.846 | 0.927 | 0.306 | 1.7e-52 |
| TAIR|locus:2093731 AT3G24200 "AT3G24200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1700 (603.5 bits), Expect = 5.3e-175, P = 5.3e-175
Identities = 330/508 (64%), Positives = 382/508 (75%)
Query: 2 NRIIVGRLSVNVSGLRVLQRXXXXXXXXXXXXXXXXXXXXXXEVKQSFTNNDDQYDXXXX 61
+R++ L +V G R+LQR + T++ Q+D
Sbjct: 4 DRVLARNLRTSVCGTRILQRTCSTVVTHDVSTSCSNESNAL----NNSTDDGPQHDIAIV 59
Query: 62 XXXXXXXXLACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFF 121
LA SLAS PLTKHL+VAIID+NP LG+ N I+K PDPRVSTVTPATISF
Sbjct: 60 GGGMVGIALAASLASKPLTKHLNVAIIDNNPLLGRRNIIEKGHQPDPRVSTVTPATISFL 119
Query: 122 KEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCM 181
K+IGAW+Y++Q RHAYFDKMQVWDYTGLGYT+YNA DV++++LGCVVENKVL SS LSC+
Sbjct: 120 KDIGAWKYIEQQRHAYFDKMQVWDYTGLGYTRYNANDVHQDVLGCVVENKVLQSSQLSCV 179
Query: 182 QNTEFQKTIYPSRXXXXXXXXXXXXXXXXXXXXXXTLFTKGHLAKLDLSDGTSLYAKLVV 241
Q ++ QKT+YP+R LF +G LAKL+LSDG +YAKLVV
Sbjct: 180 QESDLQKTVYPARLNAMDMLPSSSLTGLGEVPSTTDLFMRGRLAKLELSDGNRVYAKLVV 239
Query: 242 GADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAGPIALLPIGDNFS 301
GADG KSRVRELAG KTTGW+YSQNAIICTVEH ENY AWQRFLP GPIALLPIGD FS
Sbjct: 240 GADGSKSRVRELAGIKTTGWNYSQNAIICTVEHTAENYTAWQRFLPNGPIALLPIGDKFS 299
Query: 302 NIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSA 361
NIVWTM+PK+ASD K MNEDDF+K +N ALD GYGP+P++ SS D SW GDAT+SA
Sbjct: 300 NIVWTMDPKEASDRKLMNEDDFIKAVNDALDSGYGPNPETTSSR--DSLSWLTGDATISA 357
Query: 362 KECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDA 421
KE FE PP+VVKL+SERM+FPLSL+HA +YVSKRV L+GD+AHTVHPLAGQGVNLGF DA
Sbjct: 358 KERFETPPKVVKLSSERMMFPLSLRHAKDYVSKRVALVGDSAHTVHPLAGQGVNLGFADA 417
Query: 422 STLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRA 481
LS+ IAEGIA+G DIGEA+LLK+YEAERKPANI MMAVLDG QK YS+DFGPLN LRA
Sbjct: 418 CALSKAIAEGIALGTDIGEANLLKRYEAERKPANIAMMAVLDGIQKMYSLDFGPLNALRA 477
Query: 482 AAFHGAQYISPLKRNIISYASGEQRLPL 509
AAFHGA YISPLK+ IISYASGEQ LPL
Sbjct: 478 AAFHGAHYISPLKKRIISYASGEQSLPL 505
|
|
| UNIPROTKB|F1PBF7 COQ6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1924408 Coq6 "coenzyme Q6 homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y2Z9 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1311149 Coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3H4 COQ6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KIL4 COQ6 "Ubiquinone biosynthesis monooxygenase COQ6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060825-297 coq6 "coenzyme Q6 homolog, monooxygenase (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291440 coq6 "monooxygenase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBR7 COQ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 515 | |||
| TIGR01989 | 437 | TIGR01989, COQ6, ubiquinone biosynthesis monooxyge | 1e-171 | |
| TIGR01988 | 387 | TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd | 1e-145 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 1e-79 | |
| PRK08020 | 391 | PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1, | 4e-78 | |
| TIGR01984 | 382 | TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy | 1e-76 | |
| PRK08850 | 405 | PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol h | 1e-76 | |
| PRK05714 | 405 | PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methox | 1e-75 | |
| PRK07364 | 415 | PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h | 6e-74 | |
| PRK08849 | 384 | PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methox | 2e-70 | |
| PRK07333 | 403 | PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h | 5e-70 | |
| PRK07608 | 388 | PRK07608, PRK07608, ubiquinone biosynthesis hydrox | 2e-67 | |
| PRK08013 | 400 | PRK08013, PRK08013, oxidoreductase; Provisional | 3e-67 | |
| PRK08773 | 392 | PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methox | 8e-65 | |
| PRK05732 | 395 | PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h | 6e-60 | |
| PRK09126 | 392 | PRK09126, PRK09126, hypothetical protein; Provisio | 5e-45 | |
| PRK07494 | 388 | PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h | 5e-44 | |
| PRK06996 | 398 | PRK06996, PRK06996, hypothetical protein; Provisio | 5e-37 | |
| PRK06617 | 374 | PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl h | 3e-29 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 1e-16 | |
| PRK06834 | 488 | PRK06834, PRK06834, hypothetical protein; Provisio | 2e-15 | |
| PRK06126 | 545 | PRK06126, PRK06126, hypothetical protein; Provisio | 5e-14 | |
| PRK06184 | 502 | PRK06184, PRK06184, hypothetical protein; Provisio | 1e-10 | |
| PRK07045 | 388 | PRK07045, PRK07045, putative monooxygenase; Review | 3e-10 | |
| PRK06183 | 500 | PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr | 3e-09 | |
| PRK08244 | 493 | PRK08244, PRK08244, hypothetical protein; Provisio | 1e-08 | |
| PRK06185 | 407 | PRK06185, PRK06185, hypothetical protein; Provisio | 3e-08 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 1e-07 | |
| PRK08255 | 765 | PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R | 3e-07 | |
| TIGR03219 | 414 | TIGR03219, salicylate_mono, salicylate 1-monooxyge | 7e-07 | |
| PRK07236 | 386 | PRK07236, PRK07236, hypothetical protein; Provisio | 5e-06 | |
| PRK07538 | 413 | PRK07538, PRK07538, hypothetical protein; Provisio | 1e-05 | |
| PRK07190 | 487 | PRK07190, PRK07190, hypothetical protein; Provisio | 4e-05 | |
| PRK06475 | 400 | PRK06475, PRK06475, salicylate hydroxylase; Provis | 9e-05 | |
| PTZ00367 | 567 | PTZ00367, PTZ00367, squalene epoxidase; Provisiona | 2e-04 | |
| TIGR02023 | 388 | TIGR02023, BchP-ChlP, geranylgeranyl reductase | 2e-04 | |
| PRK06753 | 373 | PRK06753, PRK06753, hypothetical protein; Provisio | 5e-04 | |
| TIGR02028 | 398 | TIGR02028, ChlP, geranylgeranyl reductase | 6e-04 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 6e-04 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 6e-04 | |
| PRK08294 | 634 | PRK08294, PRK08294, phenol 2-monooxygenase; Provis | 7e-04 | |
| PRK08243 | 392 | PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen | 0.001 | |
| PRK06185 | 407 | PRK06185, PRK06185, hypothetical protein; Provisio | 0.003 | |
| pfam08491 | 276 | pfam08491, SE, Squalene epoxidase | 0.003 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 0.003 | |
| TIGR03364 | 365 | TIGR03364, HpnW_proposed, FAD dependent oxidoreduc | 0.003 | |
| PRK06481 | 506 | PRK06481, PRK06481, fumarate reductase flavoprotei | 0.003 |
| >gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 | Back alignment and domain information |
|---|
Score = 489 bits (1260), Expect = e-171
Identities = 202/451 (44%), Positives = 280/451 (62%), Gaps = 22/451 (4%)
Query: 56 YDVAVVGGGMVGMALACSLASMPLTKHLSVAIIDS--NPALGKSNFIKKEDPPDPRVSTV 113
+DV +VGGG VG+ALA +L + PLTK L V ++D+ NP L N+ K + P RVS++
Sbjct: 1 FDVVIVGGGPVGLALAAALGNNPLTKDLKVLLLDAVDNPKLKSRNYEKPDGPYSNRVSSI 60
Query: 114 TPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVL 173
TPA+ISFFK+IGAW ++Q R F +MQVWD L ++ RD KE + C++EN +
Sbjct: 61 TPASISFFKKIGAWDHIQSDRIQPFGRMQVWDGCSLALIRF-DRDNGKEDMACIIENDNI 119
Query: 174 HSSLLSCMQ--NTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSD 231
+SL + +Q N + K + P+RL S+ + PS + + LSD
Sbjct: 120 QNSLYNRLQEYNGDNVKILNPARLISVTI-PSKYPNDNSN------------WVHITLSD 166
Query: 232 GTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEH--NKENYCAWQRFLPAG 289
G LY KL++GADG S VR+ A TTGW+Y+Q+A++ T++ EN AWQRFLP G
Sbjct: 167 GQVLYTKLLIGADGSNSNVRKAANIDTTGWNYNQHAVVATLKLEEATENDVAWQRFLPTG 226
Query: 290 PIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSG-SVD 348
PIALLP+ DN S +VW+ +P++A S+ +DFV LN A D GY HP S +++
Sbjct: 227 PIALLPLPDNNSTLVWSTSPEEALRLLSLPPEDFVDALNAAFDLGYSDHPYSYLLDYAME 286
Query: 349 MFSWFRGDATLSAKECFEVPPRVVKLASE-RMVFPLSLKHANNYVSKRVVLIGDAAHTVH 407
+ G T +K CF+VPPRV+ + + R FPL L HA+ YV+KRV L+GDAAH VH
Sbjct: 287 KLNEDIGFRTEGSKSCFQVPPRVIGVVDKSRAAFPLGLGHADEYVTKRVALVGDAAHRVH 346
Query: 408 PLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQK 467
PLAGQGVNLGFGD ++L + +AE ++VGADIG S LK YE ER N+V++ ++D K
Sbjct: 347 PLAGQGVNLGFGDVASLVKALAEAVSVGADIGSISSLKPYERERYAKNVVLLGLVDKLHK 406
Query: 468 AYSVDFGPLNILRAAAFHGAQYISPLKRNII 498
Y+ DF P+ LR + YI PLK I+
Sbjct: 407 LYATDFPPVVALRTFGLNLTNYIGPLKNFIM 437
|
This model represents the monooxygenase responsible for the 4-hydroxylateion of the phenol ring in the aerobic biosynthesis of ubiquinone. Length = 437 |
| >gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|236341 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235905 PRK06996, PRK06996, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235870 PRK06834, PRK06834, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236199 PRK08244, PRK08244, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235955 PRK07190, PRK07190, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233689 TIGR02023, BchP-ChlP, geranylgeranyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131083 TIGR02028, ChlP, geranylgeranyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236223 PRK08294, PRK08294, phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219864 pfam08491, SE, Squalene epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| PRK08013 | 400 | oxidoreductase; Provisional | 100.0 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 100.0 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 100.0 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 100.0 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 100.0 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 100.0 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 100.0 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 100.0 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 100.0 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 100.0 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 100.0 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 100.0 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 100.0 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 100.0 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 100.0 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 100.0 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 100.0 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 100.0 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 100.0 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 100.0 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 100.0 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 100.0 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 100.0 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 100.0 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 100.0 | |
| PLN02985 | 514 | squalene monooxygenase | 100.0 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 100.0 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 100.0 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 100.0 | |
| PRK05868 | 372 | hypothetical protein; Validated | 100.0 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 100.0 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 100.0 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 100.0 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 100.0 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 100.0 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 100.0 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 100.0 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 100.0 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 100.0 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 100.0 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 100.0 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 100.0 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 99.98 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 99.97 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 99.97 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 99.97 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 99.97 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 99.97 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 99.96 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 99.95 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 99.94 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 99.93 | |
| PLN02463 | 447 | lycopene beta cyclase | 99.91 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 99.88 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 99.85 | |
| PF08491 | 276 | SE: Squalene epoxidase; InterPro: IPR013698 This d | 99.81 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 99.8 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.59 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 99.55 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 99.54 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 99.5 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 99.45 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 99.43 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 99.42 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 99.38 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 99.37 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 99.36 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 99.36 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 99.36 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 99.35 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 99.34 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 99.31 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 99.28 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 99.23 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 99.21 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 99.21 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.2 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 99.2 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 99.17 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 99.16 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 99.16 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 99.16 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 99.15 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 99.14 | |
| PLN02661 | 357 | Putative thiazole synthesis | 99.14 | |
| PLN02612 | 567 | phytoene desaturase | 99.13 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 99.13 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 99.1 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.1 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 99.09 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.07 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 99.07 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 99.07 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 99.07 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.07 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 99.06 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 99.05 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 99.04 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 99.02 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.02 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 99.0 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 98.98 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 98.98 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 98.97 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 98.97 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 98.97 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 98.96 | |
| PRK07121 | 492 | hypothetical protein; Validated | 98.95 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 98.93 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.93 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 98.93 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 98.91 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 98.9 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 98.9 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 98.9 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.86 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 98.86 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 98.86 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.86 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 98.84 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.84 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 98.83 | |
| PLN02268 | 435 | probable polyamine oxidase | 98.82 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 98.82 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.81 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 98.81 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 98.81 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 98.8 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 98.8 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 98.8 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.8 | |
| PLN02487 | 569 | zeta-carotene desaturase | 98.79 | |
| PLN02815 | 594 | L-aspartate oxidase | 98.78 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 98.78 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 98.77 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 98.77 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 98.77 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 98.76 | |
| PLN02568 | 539 | polyamine oxidase | 98.76 | |
| PLN02676 | 487 | polyamine oxidase | 98.76 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.75 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.75 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 98.75 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.74 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 98.74 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 98.74 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 98.74 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.73 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.73 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 98.72 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.72 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.72 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 98.72 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 98.71 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 98.71 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.7 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 98.69 | |
| PRK06116 | 450 | glutathione reductase; Validated | 98.69 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 98.68 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 98.68 | |
| PRK06370 | 463 | mercuric reductase; Validated | 98.68 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 98.67 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 98.66 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.66 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 98.65 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 98.65 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.65 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 98.64 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.64 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 98.63 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.62 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 98.62 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.61 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 98.6 | |
| PLN02976 | 1713 | amine oxidase | 98.59 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.59 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.59 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 98.59 | |
| PLN02507 | 499 | glutathione reductase | 98.58 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 98.58 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 98.57 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 98.57 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 98.57 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 98.57 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 98.57 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 98.57 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 98.56 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 98.55 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.55 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 98.55 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 98.54 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 98.54 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 98.53 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 98.52 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 98.51 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 98.5 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 98.49 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 98.49 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 98.47 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 98.46 | |
| PLN02546 | 558 | glutathione reductase | 98.46 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 98.45 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 98.45 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 98.44 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 98.43 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 98.42 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 98.4 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 98.39 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 98.39 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 98.38 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 98.36 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 98.36 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 98.33 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 98.31 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 98.31 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 98.3 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 98.29 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 98.29 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 98.29 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 98.28 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 98.24 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 98.24 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 98.24 | |
| PLN03000 | 881 | amine oxidase | 98.23 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 98.21 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 98.21 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 98.18 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 98.18 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 98.18 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 98.17 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 98.16 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 98.16 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 98.16 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 98.15 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 98.14 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 98.14 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 98.14 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 98.12 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 98.12 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 98.12 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 98.12 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 98.1 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 98.1 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 98.09 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 98.09 | |
| PRK06116 | 450 | glutathione reductase; Validated | 98.09 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 98.08 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 98.08 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 98.08 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 98.07 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 98.06 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 98.04 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 98.03 | |
| PLN02507 | 499 | glutathione reductase | 98.01 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 98.0 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 97.99 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 97.99 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 97.99 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 97.99 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.98 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 97.98 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.96 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 97.96 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 97.95 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 97.95 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 97.93 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 97.93 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 97.92 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 97.91 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 97.91 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 97.91 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.9 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 97.89 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 97.89 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.88 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 97.87 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 97.87 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.83 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 97.83 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 97.83 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 97.81 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.81 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 97.8 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 97.78 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 97.76 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 97.75 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 97.74 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.74 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 97.74 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 97.73 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.72 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 97.71 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 97.7 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 97.68 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 97.68 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 97.68 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 97.68 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.65 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 97.64 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.63 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 97.63 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 97.62 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 97.62 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.61 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 97.61 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 97.6 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.56 | |
| PLN02546 | 558 | glutathione reductase | 97.54 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 97.48 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 97.48 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 97.47 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 97.46 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 97.45 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 97.45 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.44 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 97.44 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 97.38 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.31 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 97.3 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 97.25 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 97.22 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.21 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.14 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 97.13 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 97.12 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 97.09 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 97.09 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.07 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 97.05 | |
| PLN02785 | 587 | Protein HOTHEAD | 97.04 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 97.04 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 97.01 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 97.0 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 96.98 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 96.96 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 96.83 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 96.82 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 96.8 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 96.79 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 96.68 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 96.66 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 96.63 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 96.56 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 96.5 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 96.45 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 96.35 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 96.23 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 96.08 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 95.91 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 95.84 | |
| KOG3851 | 446 | consensus Sulfide:quinone oxidoreductase/flavo-bin | 95.69 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 95.64 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 95.63 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 95.49 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 95.44 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 95.43 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.38 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 95.28 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 95.21 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 95.15 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 94.92 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 94.92 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 94.7 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 94.54 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 94.53 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 94.44 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 94.42 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 94.24 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.23 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 94.13 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.02 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 93.8 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 93.68 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 93.67 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 93.42 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 93.41 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 93.31 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 93.29 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 93.07 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 92.99 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 92.97 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 92.79 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 92.76 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.66 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 92.65 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 92.63 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.55 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 92.5 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.4 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 92.25 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.16 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.08 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.07 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.83 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 91.82 | |
| KOG2755 | 334 | consensus Oxidoreductase [General function predict | 91.78 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 91.77 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 91.7 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 91.66 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.6 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 91.57 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 91.49 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 91.47 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 91.37 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 91.36 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 91.29 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 91.19 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 91.09 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 90.93 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 90.85 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 90.63 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.54 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 90.53 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 90.49 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 90.48 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 90.36 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 90.27 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 90.02 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 89.94 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 89.94 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 89.83 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 89.69 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 89.66 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 89.59 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.56 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 89.54 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 89.32 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 89.26 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 89.23 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 89.0 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 88.98 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 88.95 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 88.91 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 88.9 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 88.74 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 88.61 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 88.58 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 88.45 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 88.26 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 88.25 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 88.19 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 87.98 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 87.95 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 87.89 | |
| PLN02256 | 304 | arogenate dehydrogenase | 87.73 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 87.68 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 87.52 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 87.5 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 87.4 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 87.19 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 87.13 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 86.94 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 86.9 | |
| KOG4405 | 547 | consensus GDP dissociation inhibitor [Signal trans | 86.87 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 86.83 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 86.68 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 86.59 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 86.52 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 86.48 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 86.32 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 86.27 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.1 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 86.02 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 85.91 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.88 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 85.69 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 85.56 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 85.5 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 85.45 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 85.45 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 85.22 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 85.03 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 84.89 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 84.84 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.82 | |
| PLN02494 | 477 | adenosylhomocysteinase | 84.73 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 84.72 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 84.71 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 84.62 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.61 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 84.61 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 84.57 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 84.57 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 84.38 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 84.34 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 84.2 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 83.84 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 83.66 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 83.51 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 83.5 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 83.46 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 83.4 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 83.39 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 83.27 |
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-52 Score=424.95 Aligned_cols=395 Identities=34% Similarity=0.582 Sum_probs=317.3
Q ss_pred CCccEEEECCCHHHHHHHHHHhcCCCCCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEEeCHhHHHHHHHcCCchhhhhh
Q 010200 54 DQYDVAVVGGGMVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQYVQQH 133 (515)
Q Consensus 54 ~~~dVvIVGgG~aGl~~A~~L~~~~~~~G~~V~v~E~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~lgl~~~~~~~ 133 (515)
+++||+||||||+|+++|+.|++. |++|+|+||.+.+.... +.....++..++++++++|+++|+++.+.+.
T Consensus 2 ~~~dV~IvGaGpaGl~~A~~La~~----G~~v~viE~~~~~~~~~----g~~~~~r~~~l~~~s~~~L~~lGl~~~~~~~ 73 (400)
T PRK08013 2 QSVDVVIAGGGMVGLAVACGLQGS----GLRVAVLEQRVPEPLAA----DAPPALRVSAINAASEKLLTRLGVWQDILAR 73 (400)
T ss_pred CcCCEEEECcCHHHHHHHHHHhhC----CCEEEEEeCCCCccccc----CCCCCceeeecchhHHHHHHHcCCchhhhhh
Confidence 358999999999999999999996 99999999998753210 1122457788999999999999999999876
Q ss_pred hccccceEEEEeCCCccceeeecccCCCCcceEEechHHHHHHHHHHHhcCCCceEEcCCeeEEEEeCCCCCCcccCCCC
Q 010200 134 RHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTP 213 (515)
Q Consensus 134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~g~v~i~~~~~v~~i~~~~~~~~~~~~~~~ 213 (515)
...+...+.+++......+.+..........++.++|..|.+.|.+.+.+.++++++++++|++++.
T Consensus 74 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~~v~i~~~~~v~~i~~------------- 140 (400)
T PRK08013 74 RASCYHGMEVWDKDSFGRIAFDDQSMGYSHLGHIIENSVIHYALWQKAQQSSDITLLAPAELQQVAW------------- 140 (400)
T ss_pred cCccccEEEEEeCCCCceEEEcccccCCCccEEEEEhHHHHHHHHHHHhcCCCcEEEcCCeeEEEEe-------------
Confidence 5557788888876543344444333333445689999999999999999875599999999999976
Q ss_pred CcccccccCCeeEEEcCCCcEEEeeEEEEecCCCchhhhhcCCccccccCCceEEEEEEEeecCC-ceEEEEecCCCcEE
Q 010200 214 SATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKEN-YCAWQRFLPAGPIA 292 (515)
Q Consensus 214 ~~~~~~~~~~~~~v~~~~g~~~~ad~vV~AdG~~S~vr~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~g~~~ 292 (515)
++..+++++.+|+++++|+||+|||.+|.||+.+++......|...++++.++...+. ...++.+.++++++
T Consensus 141 -------~~~~v~v~~~~g~~i~a~lvVgADG~~S~vR~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~g~~~ 213 (400)
T PRK08013 141 -------GENEAFLTLKDGSMLTARLVVGADGANSWLRNKADIPLTFWDYQHHALVATIRTEEPHDAVARQVFHGDGILA 213 (400)
T ss_pred -------cCCeEEEEEcCCCEEEeeEEEEeCCCCcHHHHHcCCCccccccCcEEEEEEEeccCCCCCEEEEEEcCCCCEE
Confidence 3355888888999999999999999999999999988888888888888888766544 34567788889999
Q ss_pred EEecCCCc-eEEEEEcCCCChHHhhcCCHHHHHHHHHHhhcCCCCCCCCCCCCCcccchhccccCccccccccccCCcce
Q 010200 293 LLPIGDNF-SNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKECFEVPPRV 371 (515)
Q Consensus 293 ~~p~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~ 371 (515)
++|+.++. .+++|..+.+........+.+.|.+.+...++ +. ++ .
T Consensus 214 ~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~----~~---------------l~-------------~-- 259 (400)
T PRK08013 214 FLPLSDPHLCSIVWSLSPEEAQRMQQAPEEEFNRALAIAFD----NR---------------LG-------------L-- 259 (400)
T ss_pred EEECCCCCeEEEEEEcCHHHHHHHHcCCHHHHHHHHHHHHh----Hh---------------hC-------------c--
Confidence 99998754 67888876655444445566777777765332 00 00 0
Q ss_pred EEeccceeeeccccccccccccCcEEEEcccccccCCccccchhhcHHHHHHHHHHHHHhHhcCCCcchHHHHHHHHHHh
Q 010200 372 VKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAER 451 (515)
Q Consensus 372 ~~~~~~~~~~p~~~~~~~~~~~~~v~lvGDAAh~~~P~~G~G~n~al~da~~La~~l~~~~~~~~~~~~~~al~~Y~~~r 451 (515)
..+......||+....+++|..+||+|+|||||.++|+.|||+|+||+||..|+++|...+..+.+.....+|+.|+++|
T Consensus 260 ~~~~~~~~~~~l~~~~~~~~~~grv~LiGDAAH~~~P~~GQG~n~gi~Da~~La~~L~~~~~~~~~~~~~~~L~~Y~~~R 339 (400)
T PRK08013 260 CELESERQVFPLTGRYARQFAAHRLALVGDAAHTIHPLAGQGVNLGFMDAAELIAELRRLHRQGKDIGQHLYLRRYERSR 339 (400)
T ss_pred eEecCCccEEecceeecccccCCcEEEEechhhcCCccccCchhhhHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHHH
Confidence 11122233577777778999999999999999999999999999999999999999998776554444456899999999
Q ss_pred hHHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHhcccChhHHHHHHHHhhcCCCCCCC
Q 010200 452 KPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLP 510 (515)
Q Consensus 452 ~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~ 510 (515)
+++...++..++.+.++|+..+++..++|+.++.+++.+|++++.++++++|+...|-.
T Consensus 340 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~R~~~l~~~~~~~~~~~~~~~~~~g~~~~~~~ 398 (400)
T PRK08013 340 KHSAALMLAGMQGFRDLFAGNNPAKKLLRDIGLKLADTLPGVKPQLIRQAMGLNDLPEW 398 (400)
T ss_pred HHHHHHHHHHHHHHHHHHcCCchHHHHHHHHHHHHHhhCHHHHHHHHHHHccCcCCccc
Confidence 99999999999999999999999999999999999999999999999999997656543
|
|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG2755 consensus Oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 515 | ||||
| 2r0c_A | 549 | Structure Of The Substrate-Free Form Of The Rebecca | 4e-08 | ||
| 4eip_A | 549 | Native And K252c Bound Rebc-10x Length = 549 | 4e-08 | ||
| 2qa2_A | 499 | Crystal Structure Of Cabe, An Aromatic Hydroxylase | 1e-07 | ||
| 3all_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 8e-07 | ||
| 3fmw_A | 570 | The Crystal Structure Of Mtmoiv, A Baeyer-Villiger | 9e-07 | ||
| 3alk_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 1e-06 | ||
| 3alh_A | 379 | Higher Resolution And Native Structure Of 2-Methyl- | 1e-06 | ||
| 3gmc_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 2e-06 | ||
| 3gmb_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 2e-05 | ||
| 3v3n_A | 378 | Crystal Structure Of Tetx2 T280a: An Adaptive Mutan | 7e-05 | ||
| 2y6r_A | 398 | Structure Of The Tetx Monooxygenase In Complex With | 7e-05 | ||
| 4a6n_A | 398 | Structure Of The Tetracycline Degrading Monooxygena | 7e-05 | ||
| 2xdo_A | 398 | Structure Of The Tetracycline Degrading Monooxygena | 7e-05 | ||
| 1pn0_A | 665 | Phenol Hydroxylase From Trichosporon Cutaneum Lengt | 1e-04 | ||
| 2x3n_A | 399 | Crystal Structure Of Pqsl, A Probable Fad-Dependent | 1e-04 | ||
| 3p9u_A | 378 | Crystal Structure Of Tetx2 From Bacteroides Thetaio | 3e-04 | ||
| 2xyo_A | 399 | Structural Basis For A New Tetracycline Resistance | 4e-04 | ||
| 2qa1_A | 500 | Crystal Structure Of Pgae, An Aromatic Hydroxylase | 4e-04 | ||
| 1bgn_A | 394 | P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cy | 6e-04 |
| >pdb|2R0C|A Chain A, Structure Of The Substrate-Free Form Of The Rebeccamycin Biosynthetic Enzyme Rebc Length = 549 | Back alignment and structure |
|
| >pdb|4EIP|A Chain A, Native And K252c Bound Rebc-10x Length = 549 | Back alignment and structure |
| >pdb|2QA2|A Chain A, Crystal Structure Of Cabe, An Aromatic Hydroxylase From Angucycline Biosynthesis, Determined To 2.7 A Resolution Length = 499 | Back alignment and structure |
| >pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 | Back alignment and structure |
| >pdb|3FMW|A Chain A, The Crystal Structure Of Mtmoiv, A Baeyer-Villiger Monooxygenase From The Mithramycin Biosynthetic Pathway In Streptomyces Argillaceus. Length = 570 | Back alignment and structure |
| >pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 | Back alignment and structure |
| >pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 | Back alignment and structure |
| >pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 | Back alignment and structure |
| >pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 | Back alignment and structure |
| >pdb|3V3N|A Chain A, Crystal Structure Of Tetx2 T280a: An Adaptive Mutant In Complex With Minocycline Length = 378 | Back alignment and structure |
| >pdb|2Y6R|A Chain A, Structure Of The Tetx Monooxygenase In Complex With The Substrate 7-Chlortetracycline Length = 398 | Back alignment and structure |
| >pdb|4A6N|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx In Complex With Tigecycline Length = 398 | Back alignment and structure |
| >pdb|2XDO|A Chain A, Structure Of The Tetracycline Degrading Monooxygenase Tetx2 From Bacteroides Thetaiotaomicron Length = 398 | Back alignment and structure |
| >pdb|1PN0|A Chain A, Phenol Hydroxylase From Trichosporon Cutaneum Length = 665 | Back alignment and structure |
| >pdb|2X3N|A Chain A, Crystal Structure Of Pqsl, A Probable Fad-Dependent Monooxygenase From Pseudomonas Aeruginosa Length = 399 | Back alignment and structure |
| >pdb|3P9U|A Chain A, Crystal Structure Of Tetx2 From Bacteroides Thetaiotaomicron With Substrate Analogue Length = 378 | Back alignment and structure |
| >pdb|2XYO|A Chain A, Structural Basis For A New Tetracycline Resistance Mechanism Relying On The Tetx Monooxygenase Length = 399 | Back alignment and structure |
| >pdb|2QA1|A Chain A, Crystal Structure Of Pgae, An Aromatic Hydroxylase Involved In Angucycline Biosynthesis Length = 500 | Back alignment and structure |
| >pdb|1BGN|A Chain A, P-Hydroxybenzoate Hydroxylase (Phbh) Mutant With Cys 116 Replaced By Ser (C116s) And Arg 269 Replaced By Thr (R269t), In Complex With Fad And 4-Hydroxybenzoic Acid Length = 394 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 515 | |||
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 1e-110 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 5e-29 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 1e-26 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 3e-04 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 2e-26 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 5e-04 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 4e-24 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 6e-22 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 1e-20 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 8e-04 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 4e-20 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 1e-04 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 4e-20 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 7e-19 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 2e-18 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 1e-04 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 4e-18 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 2e-17 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 7e-15 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 5e-14 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 8e-14 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 1e-06 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 2e-13 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 2e-11 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 2e-05 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 2e-07 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 2e-07 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 2e-07 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 2e-04 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 4e-04 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 5e-04 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 6e-04 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 9e-04 |
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
Score = 332 bits (854), Expect = e-110
Identities = 81/463 (17%), Positives = 150/463 (32%), Gaps = 70/463 (15%)
Query: 52 NDDQYDVAVVGGGMVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVS 111
D+ DV + G G+ G LA L + V +++ +
Sbjct: 3 TDNHIDVLINGCGIGGAMLAYLLGR----QGHRVVVVEQAR----------RERAINGAD 48
Query: 112 TVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVENK 171
+ PA I + G V + +++V+ G +N V+ ++ +
Sbjct: 49 LLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVYH-DGELLRYFNYSSVDARGYFILMPCE 107
Query: 172 VLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDLSD 231
L +L + + ++ +R+ ++ + ++ L+D
Sbjct: 108 SLRRLVLEKIDGEATVEMLFETRIEAVQRDER------------------HAIDQVRLND 149
Query: 232 GTSLYAKLVVGADGGKSRVRE-LAGFKTTGWSYSQNAIICTVEHNKE-NYCAWQRFLPAG 289
G L ++VVGADG S VR L Y ++ T G
Sbjct: 150 GRVLRPRVVVGADGIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQG 209
Query: 290 PIA-LLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVD 348
+A PIG + + +V + ++A + + + ++
Sbjct: 210 GLAYFYPIGFDRARLVVSFPREEARELMADTRGESLRRRLQRF----------------- 252
Query: 349 MFSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHP 408
+ V S P+ + + Y + V ++GDA H VHP
Sbjct: 253 ------------VGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHP 300
Query: 409 LAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKA 468
+ GQG+NL DAS L+ + + + L Y+AER P N +++ +
Sbjct: 301 ITGQGMNLAIEDASALADALDLALRDACALE--DALAGYQAERFPVNQAIVSYGHALATS 358
Query: 469 YSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQRLPLPL 511
+ A G+ SY R P PL
Sbjct: 359 LEDR-QRFAGVFDTALQGSSRTPEALGGERSYQPV--RSPAPL 398
|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 100.0 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 100.0 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 100.0 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 100.0 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 100.0 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 100.0 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 100.0 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 100.0 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 100.0 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 100.0 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 100.0 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 100.0 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 100.0 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 100.0 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 100.0 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 100.0 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 100.0 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 100.0 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 100.0 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 100.0 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 100.0 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 100.0 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 100.0 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 100.0 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 100.0 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 99.98 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 99.98 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 99.96 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 99.9 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.86 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 99.65 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 99.61 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 99.59 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 99.58 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 99.56 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 99.54 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 99.54 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.53 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 99.53 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 99.53 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 99.46 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 99.46 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 99.43 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.43 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 99.41 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 99.41 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 99.41 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 99.4 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 99.39 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 99.37 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.37 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 99.36 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 99.36 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 99.34 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 99.32 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.32 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 99.31 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 99.29 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 99.28 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 99.28 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.28 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 99.27 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 99.27 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.26 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 99.26 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 99.25 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 99.25 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.24 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 99.24 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.24 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 99.21 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.2 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 99.18 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 99.17 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 99.16 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 99.14 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 99.13 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 99.13 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 99.13 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 99.12 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.12 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 99.12 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 99.11 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 99.11 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 99.11 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 99.1 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 99.1 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 99.1 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 99.08 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 99.07 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 99.06 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 99.05 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 99.05 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 99.05 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 99.04 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 99.02 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 99.02 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 99.01 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 99.01 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 98.98 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 98.96 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 98.95 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 98.95 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 98.95 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 98.93 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 98.92 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.89 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 98.88 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 98.86 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 98.86 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 98.85 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 98.84 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 98.83 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 98.83 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.81 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 98.77 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 98.76 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 98.75 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 98.75 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 98.73 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 98.72 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 98.7 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.69 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 98.67 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 98.66 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.65 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.63 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.63 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 98.62 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 98.62 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 98.6 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 98.6 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 98.58 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 98.58 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 98.58 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 98.56 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 98.56 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 98.55 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 98.54 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 98.54 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 98.53 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.52 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 98.52 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.5 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 98.49 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 98.49 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.49 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 98.49 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 98.48 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 98.47 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 98.46 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 98.46 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 98.46 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.45 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 98.45 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 98.44 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 98.43 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 98.43 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 98.42 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 98.42 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 98.41 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 98.41 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.4 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 98.39 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 98.38 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 98.37 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 98.37 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 98.36 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 98.36 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 98.36 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.35 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 98.34 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 98.33 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 98.33 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 98.32 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 98.31 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 98.31 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 98.31 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.3 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 98.29 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 98.25 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 98.24 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 98.23 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.18 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 98.16 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.13 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 98.12 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.12 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 98.12 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 98.12 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 98.1 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 98.1 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 98.1 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 98.09 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.09 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 98.09 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 98.08 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 98.07 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 98.06 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.06 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.06 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 98.05 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 98.0 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 97.99 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 97.99 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 97.99 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 97.99 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.99 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.98 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 97.98 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 97.98 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 97.98 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 97.98 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 97.97 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 97.97 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 97.96 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 97.95 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 97.95 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 97.94 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.93 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 97.93 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 97.92 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 97.92 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 97.91 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 97.89 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.86 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 97.84 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 97.8 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 97.8 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 97.77 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 97.76 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 97.74 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 97.74 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 97.74 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 97.74 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 97.73 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 97.72 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 97.7 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 97.68 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 97.66 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 97.65 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 97.61 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 97.57 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 97.56 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 97.53 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 97.53 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 97.51 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 97.51 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 97.5 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 97.48 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 97.47 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 97.47 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 97.46 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 97.44 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 97.44 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 97.43 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 97.39 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 97.36 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 97.35 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 97.3 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 97.28 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 97.27 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 97.26 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 97.24 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 97.24 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 97.23 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 97.22 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 97.21 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 97.19 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 97.18 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.17 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.17 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 97.11 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 97.07 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 97.01 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 97.0 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 96.99 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 96.92 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 96.87 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 96.8 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 96.63 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 96.62 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 96.61 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 96.56 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 96.55 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 96.55 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 96.53 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 96.26 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 95.9 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.81 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 95.74 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 95.74 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.66 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 95.46 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 95.19 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.18 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 94.87 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 94.87 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 94.87 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 94.83 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 94.62 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 94.52 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 94.38 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 94.24 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 94.22 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 94.0 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 93.79 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 93.57 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.41 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 93.34 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 93.34 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 93.26 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 93.23 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 92.93 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 92.85 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 92.6 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 92.36 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 92.29 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 92.29 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 92.2 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 92.13 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 92.06 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 92.05 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 92.02 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 92.01 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 91.97 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 91.94 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 91.86 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 91.85 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 91.84 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 91.84 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 91.76 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 91.72 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 91.64 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 91.49 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 91.49 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 91.42 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 91.29 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 91.27 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 91.26 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 91.23 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 91.23 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 91.14 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 91.13 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 91.02 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 90.8 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 90.79 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 90.71 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 90.7 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 90.67 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 90.52 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 90.49 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 90.49 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 90.35 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 90.24 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 90.17 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 90.15 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 90.15 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 90.14 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 90.14 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 90.11 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 90.06 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 90.01 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 89.98 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 89.88 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 89.74 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 89.7 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 89.65 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 89.61 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 89.55 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 89.53 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 89.47 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 89.46 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 89.42 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 89.14 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 89.13 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 88.95 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 88.83 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 88.82 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 88.78 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 88.74 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 88.61 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 88.25 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 88.19 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 88.14 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 88.03 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 87.97 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 87.97 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 87.97 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 87.96 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 87.85 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 87.65 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 87.57 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 87.5 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 87.39 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 87.38 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 87.36 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 87.35 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 87.26 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 87.24 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 87.22 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 87.19 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 87.18 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 87.14 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 87.01 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 86.93 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 86.92 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 86.91 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 86.91 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 86.83 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 86.83 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 86.75 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 86.74 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 86.71 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 86.68 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 86.54 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 86.51 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 86.48 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 86.38 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 86.26 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 86.18 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 86.05 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 85.97 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 85.97 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 85.94 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 85.89 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 85.81 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 85.78 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 85.78 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 85.77 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 85.71 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 85.65 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 85.51 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 85.45 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 85.39 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 85.34 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 85.32 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 85.23 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 85.23 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 85.06 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 85.0 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 84.95 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 84.83 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 84.65 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 84.53 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 84.44 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 84.44 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 84.28 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 84.25 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 84.23 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 84.21 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 83.73 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 83.57 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 83.52 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 83.46 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 83.44 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 83.42 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 83.4 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 83.38 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 83.3 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 83.29 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 83.25 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 83.22 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 83.17 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 83.15 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 83.07 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 83.05 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 83.03 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 82.93 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 82.9 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 82.87 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 82.64 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 82.64 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 82.62 | |
| 3on5_A | 362 | BH1974 protein; structural genomics, joint center | 82.53 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 82.53 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 82.45 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 82.37 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 82.25 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 82.17 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 81.93 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 81.79 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 81.79 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 81.69 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 81.64 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 81.49 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 81.37 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 81.24 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 81.21 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 81.15 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 81.14 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 80.98 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 80.97 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 80.84 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 80.81 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 80.8 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 80.78 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 80.64 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 80.4 |
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-43 Score=371.39 Aligned_cols=374 Identities=18% Similarity=0.201 Sum_probs=285.9
Q ss_pred CCCCCCccEEEECCCHHHHHHHHHHhcCCCCCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEEeCHhHHHHHHHcCCchh
Q 010200 50 TNNDDQYDVAVVGGGMVGMALACSLASMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQY 129 (515)
Q Consensus 50 ~~~~~~~dVvIVGgG~aGl~~A~~L~~~~~~~G~~V~v~E~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~lgl~~~ 129 (515)
..+++.+||+||||||+||++|+.|++. |++|+||||.+.+. ..+++..++++++++|+.+|+++.
T Consensus 6 ~~~~~~~dVlIVGaGpaGl~~A~~La~~----G~~v~vlE~~~~~~----------~~~r~~~l~~~~~~~l~~lGl~~~ 71 (500)
T 2qa1_A 6 HHHRSDAAVIVVGAGPAGMMLAGELRLA----GVEVVVLERLVERT----------GESRGLGFTARTMEVFDQRGILPR 71 (500)
T ss_dssp --CCSBCSEEEECCSHHHHHHHHHHHHT----TCCEEEEESCCC-C----------CCCCSEEECHHHHHHHHTTTCGGG
T ss_pred CCccCCCCEEEECcCHHHHHHHHHHHHC----CCCEEEEeCCCCCC----------CCCCcceECHHHHHHHHHCCCHHH
Confidence 3455679999999999999999999996 99999999998763 335689999999999999999988
Q ss_pred hhhhhccccceEEEEeCCCccceeeecccCC-CCcceEEechHHHHHHHHHHHhcCCCceEEcCCeeEEEEeCCCCCCcc
Q 010200 130 VQQHRHAYFDKMQVWDYTGLGYTKYNARDVN-KEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSIS 208 (515)
Q Consensus 130 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~i~r~~l~~~L~~~~~~~g~v~i~~~~~v~~i~~~~~~~~~~ 208 (515)
+.+. . ...... +. + ..+...... ..+..+.+++..+.+.|.+.+.+.| ++|+++++|++++.
T Consensus 72 ~~~~-~-~~~~~~-~~--~---~~~~~~~~~~~~~~~~~i~~~~l~~~L~~~~~~~g-v~v~~~~~v~~i~~-------- 134 (500)
T 2qa1_A 72 FGEV-E-TSTQGH-FG--G---LPIDFGVLEGAWQAAKTVPQSVTETHLEQWATGLG-ADIRRGHEVLSLTD-------- 134 (500)
T ss_dssp GCSC-C-BCCEEE-ET--T---EEEEGGGSTTGGGCEEEEEHHHHHHHHHHHHHHTT-CEEEETCEEEEEEE--------
T ss_pred HHhc-c-cccccc-cc--c---eecccccCCCCCCceeecCHHHHHHHHHHHHHHCC-CEEECCcEEEEEEE--------
Confidence 8765 2 222221 11 1 122222221 2234688999999999999999987 99999999999987
Q ss_pred cCCCCCcccccccCCeeEEEcCCCc---EEEeeEEEEecCCCchhhhhcCCccccccCCceEEEEEEEeecCCceEEEEe
Q 010200 209 VDSTPSATTLFTKGHLAKLDLSDGT---SLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRF 285 (515)
Q Consensus 209 ~~~~~~~~~~~~~~~~~~v~~~~g~---~~~ad~vV~AdG~~S~vr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 285 (515)
+++.+++++.++. ++++|+||+|||.+|.||+.+|.......+...++.+.+............+
T Consensus 135 ------------~~~~v~v~~~~~~g~~~~~a~~vVgADG~~S~VR~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 202 (500)
T 2qa1_A 135 ------------DGAGVTVEVRGPEGKHTLRAAYLVGCDGGRSSVRKAAGFDFPGTAATMEMYLADIKGVELQPRMIGET 202 (500)
T ss_dssp ------------ETTEEEEEEEETTEEEEEEESEEEECCCTTCHHHHHTTCCCCEECCCCEEEEEEEESCCCCCEEEEEE
T ss_pred ------------cCCeEEEEEEcCCCCEEEEeCEEEECCCcchHHHHHcCCCcCCCccceEEEEEEEEeCCCCCceEEEE
Confidence 3456788887764 7999999999999999999999887777777778887777654333344556
Q ss_pred cCCCcEEEEecCCCceEEEEEcCCCC-hHHhhcCCHHHHHHHHHHhhcCCCCCCCCCCCCCcccchhccccCcccccccc
Q 010200 286 LPAGPIALLPIGDNFSNIVWTMNPKD-ASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDMFSWFRGDATLSAKEC 364 (515)
Q Consensus 286 ~~~g~~~~~p~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 364 (515)
.++++++++|++++.+++++...... .......+.+++.+.+.+.+.....
T Consensus 203 ~~~g~~~~~p~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~---------------------------- 254 (500)
T 2qa1_A 203 LPGGMVMVGPLPGGITRIIVCERGTPPQRRETPPSWHEVADAWKRLTGDDIA---------------------------- 254 (500)
T ss_dssp ETTEEEEEEEETTTEEEEEEEETTCCC-----CCCHHHHHHHHHHHHSCCCT----------------------------
T ss_pred CCCcEEEEEEcCCCEEEEEEEcCCCCCccccCCCCHHHHHHHHHHhcCCCCC----------------------------
Confidence 78899999999998877777653322 2223446778888888775541000
Q ss_pred ccCCcceEEeccceeeeccccccccccccCcEEEEcccccccCCccccchhhcHHHHHHHHHHHHHhHhcCCCcchHHHH
Q 010200 365 FEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLL 444 (515)
Q Consensus 365 ~~i~~~~~~~~~~~~~~p~~~~~~~~~~~~~v~lvGDAAh~~~P~~G~G~n~al~da~~La~~l~~~~~~~~~~~~~~al 444 (515)
+ ... .....|+...+.+++|..|||+|+|||||.++|+.|||+|+||+||.+|+++|...++.. ....+|
T Consensus 255 --~----~~~-~~~~~~~~~~~~a~~~~~grv~L~GDAAH~~~P~~GqG~n~gi~DA~~La~~La~~~~g~---~~~~~L 324 (500)
T 2qa1_A 255 --H----AEP-VWVSAFGNATRQVTEYRRGRVILAGDSAHIHLPAGGQGMNTSIQDAVNLGWKLGAVVNGT---ATEELL 324 (500)
T ss_dssp --T----SEE-EEEEEEECCEEECSCSEETTEEECGGGTEECCCCSSCHHHHHHHHHHHHHHHHHHHHTTS---SCHHHH
T ss_pred --c----cce-eEEEEeccCcEEccccccCCEEEEEccccCCCCccccchhhhHHHHHHHHHHHHHHHcCC---CChHHH
Confidence 0 000 011236666667888999999999999999999999999999999999999999987532 237899
Q ss_pred HHHHHHhhHHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHhcccChhHHHHHHHHhhcCCC
Q 010200 445 KKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISYASGEQR 506 (515)
Q Consensus 445 ~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~g~~~ 506 (515)
+.|+++|++++..++..++.+..++.. ++....+|+.++.++ ..|.+++.+.+..+|.+.
T Consensus 325 ~~Y~~eR~~~~~~~~~~s~~~~~l~~~-~~~~~~~R~~~~~~~-~~~~~~~~~~~~~~g~~~ 384 (500)
T 2qa1_A 325 DSYHSERHAVGKRLLMNTQAQGLLFLS-GPEVQPLRDVLTELI-QYGEVARHLAGMVSGLEI 384 (500)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHS-CGGGHHHHHHHHHHH-TSHHHHHHHHHHHHSTTC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhcC-CchHHHHHHHHHHhh-cCHHHHHHHhhhhccCCC
Confidence 999999999999999999999998874 566778999888777 578899999988887653
|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 515 | ||||
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 2e-28 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 4e-11 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 6e-10 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 1e-07 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 9e-07 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 2e-06 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 3e-06 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 7e-06 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 1e-05 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 2e-05 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 4e-05 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 5e-05 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 6e-05 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 6e-05 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 7e-05 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 1e-04 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 1e-04 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 2e-04 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 2e-04 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 3e-04 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 3e-04 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 3e-04 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 5e-04 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 5e-04 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 5e-04 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 5e-04 | |
| d1hyha1 | 146 | c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro | 6e-04 | |
| d1guza1 | 142 | c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium | 6e-04 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 8e-04 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 8e-04 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 0.001 | |
| d1ldna1 | 148 | c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus | 0.001 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 0.001 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 0.002 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 0.003 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 0.003 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 0.003 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 0.003 | |
| d1y6ja1 | 142 | c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi | 0.003 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 0.004 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 0.004 |
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Phenol hydroxylase species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]
Score = 113 bits (283), Expect = 2e-28
Identities = 64/454 (14%), Positives = 105/454 (23%), Gaps = 104/454 (22%)
Query: 51 NNDDQYDVAVVGGGMVGMALACSLASMPLTKH-LSVAIIDSNPALGKSNFIKKEDPPDPR 109
++ DV +VG G G+ A L+ K L V IID + +
Sbjct: 3 YSESYCDVLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKRSTK----------VYNGQ 52
Query: 110 VSTVTPATISFFKEIGAWQYVQQHRHAYFDKMQVWDYTGLGYTKYNARDVNKEILGCVVE 169
+ T+ K +G + + + +++ G+ + R +
Sbjct: 53 ADGLQCRTLESLKNLGLADKILSEANDM-STIALYNPDENGHIRRTDRIPDTLPGISRYH 111
Query: 170 NKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPSSSSISVDSTPSATTLFTKGHLAKLDL 229
VLH + + L
Sbjct: 112 QVVLHQGRIERRILDSIAEISDTRIKVERPL----------------------------- 142
Query: 230 SDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQRFLPAG 289
+ D V + + S T N Q
Sbjct: 143 -IPEKMEIDSSKAEDPEAYPVTMTLRYMSEDESTPLQFGHKTE--NGLFRSNLQTQEEED 199
Query: 290 PIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYGPHPKSISSGSVDM 349
LP G I Y G
Sbjct: 200 ANYRLPEGKEAGEIET-----------------------VHCKYVIGCDGGHSWVRRTLG 236
Query: 350 FSWFRGDATLSAKECFEVPPRVVKLASERMVFPLSLKHANNYVSKRVVLIGDAAHTVHPL 409
F + +RV + GDA HT P
Sbjct: 237 FEMIVTEKF--------------------------------SKDERVFIAGDACHTHSPK 264
Query: 410 AGQGVNLGFGDASTLSRIIAEGIAVGADIGEASLLKKYEAERKPANIVMMAVLDGFQKAY 469
AGQG+N D L + V + +LK YE ER+P ++ F + +
Sbjct: 265 AGQGMNTSMMDTYNLGWKLG---LVLTGRAKRDILKTYEEERQPFAQALIDFDHQFSRLF 321
Query: 470 SVDFGPLNILRAAAFHGAQYISPLKRNIISYASG 503
S ++ + + +ASG
Sbjct: 322 SGR-PAKDVADEMGVSMDVFKEAFVKG-NEFASG 353
|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 99.97 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 99.97 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 99.95 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.9 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 99.87 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.62 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 99.55 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 99.52 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 99.51 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 99.38 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 99.37 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 99.37 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 99.32 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 99.29 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 99.25 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.24 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.23 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.22 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.15 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 99.14 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.14 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 99.07 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.03 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 99.02 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.97 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.96 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.96 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 98.95 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 98.94 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.93 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 98.93 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.92 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.91 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.87 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.87 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.85 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.84 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 98.82 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 98.8 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.8 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.78 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.76 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 98.72 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.7 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 98.7 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.7 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 98.7 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.65 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.64 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.62 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.59 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.57 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.57 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.5 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.49 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.47 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 98.39 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.38 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.37 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.35 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.35 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 98.33 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.32 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.28 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 98.26 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.24 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 98.22 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 98.21 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.2 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.2 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.19 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.17 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 98.16 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 98.14 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.11 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 98.1 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 98.06 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.03 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.01 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.97 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.91 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 97.85 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 97.77 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 97.73 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 97.72 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 97.7 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 97.67 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.67 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 97.59 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 97.23 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.55 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.5 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 96.5 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.26 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.24 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.17 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 96.0 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.0 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 95.99 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 95.98 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 95.41 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.38 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.19 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 95.18 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 94.87 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.85 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 94.64 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.43 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 94.35 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 94.13 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 94.08 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 94.02 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 93.69 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 93.56 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 93.51 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 93.49 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 93.41 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 93.19 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 93.02 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 92.89 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 92.79 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 92.59 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 92.41 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 92.32 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 92.28 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 92.08 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 91.98 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 91.72 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 91.64 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 91.56 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 91.43 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 91.3 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 91.18 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 91.13 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 91.02 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 90.91 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 90.9 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 90.72 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 90.23 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 90.21 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 90.15 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 90.06 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 89.81 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 89.79 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 89.7 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.32 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 89.16 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 89.14 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 89.09 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 88.7 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 88.7 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 88.65 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 87.7 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 87.7 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 87.65 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 87.47 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 86.95 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 86.22 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 85.99 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 85.35 | |
| d2voua2 | 128 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 85.25 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 84.96 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 84.8 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 84.16 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 83.79 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 83.66 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 83.47 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 83.1 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 82.74 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 82.63 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 82.45 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 82.27 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 81.71 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 81.32 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 81.06 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 80.69 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 80.63 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 80.41 |
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Phenol hydroxylase species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]
Probab=99.97 E-value=2.6e-31 Score=264.28 Aligned_cols=336 Identities=17% Similarity=0.168 Sum_probs=202.0
Q ss_pred CCccEEEECCCHHHHHHHHHHh-----cCCCCCCcEEEEEcCCCCCCCCCCCCCCCCCCCcEEEeCHhHHHHHHHcCCch
Q 010200 54 DQYDVAVVGGGMVGMALACSLA-----SMPLTKHLSVAIIDSNPALGKSNFIKKEDPPDPRVSTVTPATISFFKEIGAWQ 128 (515)
Q Consensus 54 ~~~dVvIVGgG~aGl~~A~~L~-----~~~~~~G~~V~v~E~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~lgl~~ 128 (515)
..|||+||||||+||++|+.|+ +. |++|+||||.+.+. ..++++.++++++++|+++|+++
T Consensus 6 ~~yDV~IvGaG~aGl~lA~~La~~~~~~~----G~~v~vlEr~~~~~----------~~~r~~~l~~~~~~~L~~lGl~~ 71 (360)
T d1pn0a1 6 SYCDVLIVGAGPAGLMAARVLSEYVRQKP----DLKVRIIDKRSTKV----------YNGQADGLQCRTLESLKNLGLAD 71 (360)
T ss_dssp EEEEEEEECCSHHHHHHHHHHHHHHHHST----TCCEEEECSSSSCC----------CSCSCCEECHHHHHHHHTTTCHH
T ss_pred CCCCEEEECcCHHHHHHHHHHHhcccccC----CCcEEEEcCCCCCC----------cCCeEEEECHHHHHHHHHcCChH
Confidence 4599999999999999999996 43 99999999998874 34558999999999999999999
Q ss_pred hhhhhhccccceEEEEeCCCccceeeecc-----cCCCCcceEEechHHHHHHHHHHHhcCCCceEEcCCeeEEEEeCCC
Q 010200 129 YVQQHRHAYFDKMQVWDYTGLGYTKYNAR-----DVNKEILGCVVENKVLHSSLLSCMQNTEFQKTIYPSRLTSMALLPS 203 (515)
Q Consensus 129 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~i~r~~l~~~L~~~~~~~g~v~i~~~~~v~~i~~~~~ 203 (515)
++.+... ....+.++............. ..........+.+..+...|.+.+.+.+.........+
T Consensus 72 ~i~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~-------- 142 (360)
T d1pn0a1 72 KILSEAN-DMSTIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIERRILDSIAEISDTRIKVERPL-------- 142 (360)
T ss_dssp HHHTTCB-CCCEEEEEEECTTSCEEEEEEEESSCTTSCSSCCEECCHHHHHHHHHHHHHHHHTTSSCEECSE--------
T ss_pred HHHhhcC-CcceeEEEecccCCcccccccccccccccccchheeecHHHHHHHHHHHHHhccccceeeeEec--------
Confidence 9998777 566666665433322221111 11122334678889999989888766542221111111
Q ss_pred CCCcccCCCCCcccccccCCeeEEEcCCCcEEEeeEEEEecCCCchhhhhcCCccccccCCceEEEEEEEeecCCceEEE
Q 010200 204 SSSISVDSTPSATTLFTKGHLAKLDLSDGTSLYAKLVVGADGGKSRVRELAGFKTTGWSYSQNAIICTVEHNKENYCAWQ 283 (515)
Q Consensus 204 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~~~ad~vV~AdG~~S~vr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 283 (515)
.+..+.+|.+++|||.+|.+|.............
T Consensus 143 ---------------------------~~~~~~~d~~~~~dg~~s~v~~~~~~~~~~~~~~------------------- 176 (360)
T d1pn0a1 143 ---------------------------IPEKMEIDSSKAEDPEAYPVTMTLRYMSEDESTP------------------- 176 (360)
T ss_dssp ---------------------------EEEEEEECGGGTTCTTCCCEEEEEEECCGGGSCC-------------------
T ss_pred ---------------------------ccceEEeeEEEEeecCCcceEEEEEEeecccccc-------------------
Confidence 1235789999999999999986542111100000
Q ss_pred EecCCCcEEEEecCCCceEEEEEcCCCChHHhhcCCHHHHHHHHHHhhcCCCC-CCCCCCCCCcccchhccccCcccccc
Q 010200 284 RFLPAGPIALLPIGDNFSNIVWTMNPKDASDCKSMNEDDFVKILNHALDYGYG-PHPKSISSGSVDMFSWFRGDATLSAK 362 (515)
Q Consensus 284 ~~~~~g~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~ 362 (515)
.....+..++.....+ ........ .|. +.................+....
T Consensus 177 ------~~~~~~~~~~~~~~~~----------------~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~--- 227 (360)
T d1pn0a1 177 ------LQFGHKTENGLFRSNL----------------QTQEEEDA----NYRLPEGKEAGEIETVHCKYVIGCDGG--- 227 (360)
T ss_dssp ------CTTCCCCCSSSCCCHH----------------HHHHHHHT----SCCCSTTCCTTCEEEEEEEEEEECCCT---
T ss_pred ------eeeeeecCCCceEEee----------------ecCCcccc----eeecCcccchhhHHHHHHHhhcCcccc---
Confidence 0000011111110000 00000000 111 11000000000000010010000
Q ss_pred ccccCCcceEEeccceeeeccccccccccc-cCcEEEEcccccccCCccccchhhcHHHHHHHHHHHHHhHhcCCCcchH
Q 010200 363 ECFEVPPRVVKLASERMVFPLSLKHANNYV-SKRVVLIGDAAHTVHPLAGQGVNLGFGDASTLSRIIAEGIAVGADIGEA 441 (515)
Q Consensus 363 ~~~~i~~~~~~~~~~~~~~p~~~~~~~~~~-~~~v~lvGDAAh~~~P~~G~G~n~al~da~~La~~l~~~~~~~~~~~~~ 441 (515)
.......++.......+|. .++|+|||||||.|+|+.|||+|+||+||..|++.|....+.. ...
T Consensus 228 -----------~~~~~~~~~~~~~~~~~~~~~grv~LvGDAAH~~~P~~GqG~n~al~Da~~La~~l~~~~~~~---~~~ 293 (360)
T d1pn0a1 228 -----------HSWVRRTLGFEMIVTEKFSKDERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGR---AKR 293 (360)
T ss_dssp -----------TCHHHHHHTCCCEECSCSEETTTEEECGGGTEECCSTTCCHHHHHHHHHHHHHHHHHHHHTTC---BCG
T ss_pred -----------cchhhcccccccchhhheeecCcEEEccCcccccccccCCCCcccHHHHHHHHHHHHHHhcCC---ChH
Confidence 0000011233333456665 5899999999999999999999999999999999999887643 236
Q ss_pred HHHHHHHHHhhHHHHHHHHHHHHHHHhhcCCCChHHHHHHHHHHhcccChhHHHHHHHH---hhcCCC
Q 010200 442 SLLKKYEAERKPANIVMMAVLDGFQKAYSVDFGPLNILRAAAFHGAQYISPLKRNIISY---ASGEQR 506 (515)
Q Consensus 442 ~al~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~---~~g~~~ 506 (515)
.+|+.|+++|+++...++..++.+.++|+..... . .........+.+++.+++. .+|.+.
T Consensus 294 ~~L~~Y~~~R~~~~~~~~~~s~~~~~~~~~~~~~-~----~~~~~~~~~~~~~~~f~~~~~~~~G~~~ 356 (360)
T d1pn0a1 294 DILKTYEEERQPFAQALIDFDHQFSRLFSGRPAK-D----VADEMGVSMDVFKEAFVKGNEFASGTAI 356 (360)
T ss_dssp GGGHHHHHHHHHHHHHHHHHHHHHHHHHHSCBCS-S----TTCTTSBCHHHHHHHHHHHHHHHTTCCC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCchH-H----HHHhcccchHHHHHHHHHhhhhheeeCc
Confidence 7899999999999999999999999999765322 1 1222233344455555444 577654
|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|