Citrus Sinensis ID: 010222

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MGGDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDGIIL
cccccccccccccHHHHHcccccccccccccccHHHccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccccccccHHHHHHHHccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccEcHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHc
mggdsnegnggntDMMQRIQssfgtssssipkqqtllsanqldlpqlnqnQLRARHFSQFatnfggdsskrvgippshpnqippispyssipvsrpgnqqmgsqnyspgpthsrslsqpssffsldslpplspspfrdspstsmsdqvstdvsmedrdgnshsllppspfnrgnasrigeslpprnkhrrsnsdipfgfstvmqsssplisprfaggldkavsgrenpgvakpaqlvkkesswerggesngegmgerksegevVDDLFSAYMNLEnidalnssgtddkngnenredldsrasgtktnggdssdneaessvneSGNSLQragmnssaekregikrtaggdvasttrhyrsvsmdsfmgklnfgdespklppspgtrpgqlspsnsidanspafslefgngefsgAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRdsvgltnqnNELKFRLQAMEQQAQLRDGIIL
mggdsnegnggnTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDrdgnshsllppspfnrgNASRIGeslpprnkhrrsnSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSgrenpgvakpaqlvkkesswerggesngegmgerkseGEVVDDLFSAYMNLENIDalnssgtddkngnenredldsrasgtktnggdssdneaessvnesgnslqragmnssaekregikrtaggdvasttrHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAeialtdpkrakrilanrqsaarskerKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAqlrdgiil
MGGDSNEGNGGNTDMMQRIQssfgtssssIPKQQTLLSAnqldlpqlnqnqlRARHFSQFATNFGGDSSKRVGIPPSHpnqippispyssipvsrpGNQQMGSQNYSPGPTHsrslsqpssffsldslpplspspfrdspsTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVqtlqteattlsaqltllqRDSVGLTNQNNELKFRLQAMEQQAQLRDGIIL
*************************************************************************************************************************************************************************************************************************************************************************DLFSAYMNLE******************************************************************************************************************************************************************************************************L*AQLTLL*********************************
***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YISELEHKVQTLQTEATTLSAQLTL*************ELKFRLQAMEQQAQLRDGIIL
*********GGNTDMMQRIQ***********KQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVS***********************QPSSFFSLDSLPPLSP***************************SHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRE**********************************GEVVDDLFSAYMNLENIDALNSSGTDD*****************************************************GIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPK**************SNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILAN**********KMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDGIIL
*****************************I***QTLLSANQLDLPQLNQNQLRA*******************IPPSHPNQIPPISPYSSI*********************************LDSLPPL****************************************************************PFGFSTVMQSSSPLISP***********************************************EGEVVDDLFSAYMNLENID**************************************************************************************F**KLNF****************************************SGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDGIIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQLRDGIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q69IL4 380 Transcription factor RF2a no no 0.206 0.278 0.726 4e-36
Q04088 398 Probable transcription fa no no 0.206 0.266 0.735 1e-35
Q6S4P4 329 Transcription factor RF2b no no 0.190 0.297 0.765 4e-35
Q9MA75341 Transcription factor VIP1 no no 0.307 0.463 0.536 2e-33
P14233242 TGACG-sequence-specific D N/A no 0.142 0.301 0.312 0.0002
Q9M7Q3454 ABSCISIC ACID-INSENSITIVE no no 0.132 0.149 0.337 0.0002
O24646168 Transcription factor HY5 no no 0.105 0.321 0.444 0.0007
P23922349 Transcription factor HBP- N/A no 0.128 0.189 0.348 0.0009
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function desciption
 Score =  152 bits (385), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 86/106 (81%)

Query: 407 GNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQT 466
           G    S AE KK ++  KLAE+AL DPKRAKRI ANRQSAARSKERKMRYI+ELE KVQT
Sbjct: 156 GTEGMSSAEAKKAVSAAKLAELALVDPKRAKRIWANRQSAARSKERKMRYIAELERKVQT 215

Query: 467 LQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDGI 512
           LQTEATTLSAQL LLQRD+ GLT +N+ELK RLQ MEQQ  L+D +
Sbjct: 216 LQTEATTLSAQLALLQRDTSGLTTENSELKLRLQTMEQQVHLQDAL 261
Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description
>sp|P14233|TGA1B_TOBAC TGACG-sequence-specific DNA-binding protein TGA-1B (Fragment) OS=Nicotiana tabacum GN=TGA1B PE=2 SV=1 Back     alignment and function description
>sp|Q9M7Q3|AI5L6_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arabidopsis thaliana GN=ABF3 PE=1 SV=1 Back     alignment and function description
>sp|O24646|HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana GN=HY5 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
255543893574 DNA binding protein, putative [Ricinus c 0.955 0.855 0.814 0.0
225427794589 PREDICTED: uncharacterized protein LOC10 0.980 0.855 0.797 0.0
449461639571 PREDICTED: uncharacterized protein LOC10 0.961 0.865 0.728 0.0
449526371566 PREDICTED: uncharacterized protein LOC10 0.959 0.871 0.729 0.0
449461635563 PREDICTED: uncharacterized protein LOC10 0.947 0.865 0.720 0.0
449529770554 PREDICTED: uncharacterized LOC101215703, 0.945 0.877 0.721 0.0
224077964507 predicted protein [Populus trichocarpa] 0.793 0.804 0.847 0.0
356545029538 PREDICTED: uncharacterized protein LOC78 0.887 0.847 0.708 1e-173
351722269525 bZIP transcription factor bZIP28 [Glycin 0.832 0.815 0.7 1e-168
30692108547 basic leucine zipper transcription facto 0.879 0.826 0.639 1e-158
>gi|255543893|ref|XP_002513009.1| DNA binding protein, putative [Ricinus communis] gi|223548020|gb|EEF49512.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/501 (81%), Positives = 440/501 (87%), Gaps = 10/501 (1%)

Query: 3   GDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFAT 62
           GD+ E N   ++MMQR+ SSFGT+ SS  KQQ   S  QL++P LNQ Q RARHF+ FA 
Sbjct: 2   GDTEEAN---SEMMQRLHSSFGTTQSS-SKQQPFSSMTQLEIPHLNQTQNRARHFAHFAQ 57

Query: 63  NFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSF 122
           NF  DSSKR+GIPPSHPNQIPPISPYS IPVSRPGNQQMGSQN+SPGPTHSRSLSQPSSF
Sbjct: 58  NFSTDSSKRIGIPPSHPNQIPPISPYSQIPVSRPGNQQMGSQNFSPGPTHSRSLSQPSSF 117

Query: 123 FSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESL 182
           FSLDSLPPLSP+PFRDS STS++D VSTDVSME+RD NSHSLLPPSPFNRGNASR+ ESL
Sbjct: 118 FSLDSLPPLSPAPFRDSSSTSVADPVSTDVSMEERDANSHSLLPPSPFNRGNASRVAESL 177

Query: 183 PPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESS 242
           PPR  HRRSNSDIPFG S VMQSS PLI  R +GGL+++VSG+EN  VAKP QLVKKE  
Sbjct: 178 PPRKAHRRSNSDIPFGLSYVMQSSPPLIPLRPSGGLERSVSGKENSSVAKPTQLVKKE-- 235

Query: 243 WERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRAS 302
           WERG +S  EGMGERKSEGEVVDDLFSAYMNL+ IDALNSSGTDDKNGNENREDLDSRAS
Sbjct: 236 WERGNDSIAEGMGERKSEGEVVDDLFSAYMNLDTIDALNSSGTDDKNGNENREDLDSRAS 295

Query: 303 GTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSM 362
           GTKTNGGDSSDNEAESSVNESG+SL RAG+NSS EKREGIKR+AGGD+A TTRHYRSVSM
Sbjct: 296 GTKTNGGDSSDNEAESSVNESGSSLLRAGVNSSTEKREGIKRSAGGDIAPTTRHYRSVSM 355

Query: 363 DSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMAN 422
           DSFMGKLNFGDESPKLPPSPG+RPGQLSPSNSID N  AFSL+FGNGEFSGAELKKIMAN
Sbjct: 356 DSFMGKLNFGDESPKLPPSPGSRPGQLSPSNSIDGN--AFSLDFGNGEFSGAELKKIMAN 413

Query: 423 EKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ 482
           EKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ
Sbjct: 414 EKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ 473

Query: 483 RDSVGLTNQNNELKFRLQAME 503
             S  LT  N  L   ++ ++
Sbjct: 474 --SPYLTTLNEALTAEVRRLK 492

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427794|ref|XP_002269363.1| PREDICTED: uncharacterized protein LOC100255631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449461639|ref|XP_004148549.1| PREDICTED: uncharacterized protein LOC101216189 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526371|ref|XP_004170187.1| PREDICTED: uncharacterized protein LOC101227308 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449461635|ref|XP_004148547.1| PREDICTED: uncharacterized protein LOC101215703 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449529770|ref|XP_004171871.1| PREDICTED: uncharacterized LOC101215703, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224077964|ref|XP_002305468.1| predicted protein [Populus trichocarpa] gi|222848432|gb|EEE85979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545029|ref|XP_003540948.1| PREDICTED: uncharacterized protein LOC780560 [Glycine max] Back     alignment and taxonomy information
>gi|351722269|ref|NP_001237238.1| bZIP transcription factor bZIP28 [Glycine max] gi|113367236|gb|ABI34675.1| bZIP transcription factor bZIP28 [Glycine max] Back     alignment and taxonomy information
>gi|30692108|ref|NP_849520.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|79326483|ref|NP_001031810.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|23297471|gb|AAN12977.1| unknown protein [Arabidopsis thaliana] gi|332661589|gb|AEE86989.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|332661590|gb|AEE86990.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.655 0.609 0.620 2e-102
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.665 0.651 0.524 5.8e-82
TAIR|locus:2033123 337 bZIP52 "AT1G06850" [Arabidopsi 0.299 0.456 0.469 1.8e-29
TAIR|locus:2061908 367 AT2G40620 "AT2G40620" [Arabido 0.272 0.381 0.453 3.5e-27
TAIR|locus:2057300294 UNE4 "unfertilized embryo sac 0.352 0.615 0.378 2.4e-25
TAIR|locus:2198856 423 AT1G06070 "AT1G06070" [Arabido 0.313 0.380 0.421 7.6e-25
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.307 0.463 0.445 3.8e-24
TAIR|locus:2061340 398 AT2G31370 [Arabidopsis thalian 0.396 0.512 0.379 2.3e-23
TAIR|locus:2056442262 AT2G13150 [Arabidopsis thalian 0.311 0.610 0.366 1e-21
TAIR|locus:2057030264 AT2G12900 "AT2G12900" [Arabido 0.229 0.446 0.349 6.2e-16
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1015 (362.4 bits), Expect = 2.0e-102, P = 2.0e-102
 Identities = 237/382 (62%), Positives = 271/382 (70%)

Query:   151 DVSMEDRDG---NSHSLLPPSPFNRGNAS-----RIGESLPPRNKHRRSNSDIPFGFSTV 202
             DVSMEDRD    NS+  LPPSPF R N++     R+GESLPPR  HRRSNSDIP GF+  
Sbjct:   124 DVSMEDRDSGVFNSNHSLPPSPFTRCNSTSSSSLRVGESLPPRKSHRRSNSDIPSGFN-- 181

Query:   203 MQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGE 262
                S PLI PR    L+++ SG E    +K    VKKESS ER      EG+GER    E
Sbjct:   182 ---SMPLIPPR---PLERSFSGGECADWSKSNPFVKKESSCER------EGVGER----E 225

Query:   263 VVDDLFSAYMNLENIDALNSSGTDD-KNGNENREDLDS-RASGTKTNGGDSSDNEAESS- 319
              +DDLFSAYMNLENID LNSS  DD KNGNENR+D++S RASGTKTNG   SD E ESS 
Sbjct:   226 AMDDLFSAYMNLENIDVLNSSEADDSKNGNENRDDMESSRASGTKTNG---SDTEGESSS 282

Query:   320 VNESGNSLQRAGMNSSAEKREGIKR-TAGGDVASTTRHYRSVSMDS-FMGKLNFGDESPK 377
             VNES N+     MNSS EKRE +KR  AGGD+A TTRHYRSVS+DS FM KL+FGDES K
Sbjct:   283 VNESANN----NMNSSGEKRESVKRRAAGGDIAPTTRHYRSVSVDSCFMEKLSFGDESLK 338

Query:   378 LPPSPGTRPGQLSPSNSIDANS-PAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRA 436
              PPSPG+   ++SP+NS+D NS  AFS+EF NGEF+ AE+KKIMAN+KLAE+A++DPKR 
Sbjct:   339 PPPSPGSMSRKVSPTNSVDGNSGAAFSIEFNNGEFTAAEMKKIMANDKLAEMAMSDPKRV 398

Query:   437 KR------ILANRQSAARSKERKMRYISELEHKVXXXXXXXXXXXXXXXXXXRDSVGLTN 490
             KR      ILANRQSAARSKERKMRYI ELEHKV                  RD +GLTN
Sbjct:   399 KRNDPLFRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTN 458

Query:   491 QNNELKFRLQAMEQQAQLRDGI 512
             QNNELKFRLQAMEQQA+LRD +
Sbjct:   459 QNNELKFRLQAMEQQARLRDAL 480
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057300 UNE4 "unfertilized embryo sac 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056442 AT2G13150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
smart0033865 smart00338, BRLZ, basic region leucin zipper 3e-16
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 6e-07
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 4e-06
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 5e-04
pfam08614194 pfam08614, ATG16, Autophagy protein 16 (ATG16) 0.002
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 72.6 bits (179), Expect = 3e-16
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 432 DPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 491
           D KR +R   NR++A RS+ERK   I ELE KV+ L+ E   L  ++  L+R+   L ++
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 492 NNE 494
             E
Sbjct: 63  LEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
smart0033865 BRLZ basic region leucin zipper. 99.41
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.31
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.29
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.08
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.08
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 98.94
KOG3584348 consensus cAMP response element binding protein an 98.84
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.18
KOG0837279 consensus Transcriptional activator of the JUN fam 97.83
KOG4571294 consensus Activating transcription factor 4 [Trans 97.52
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.36
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 97.2
KOG3119269 consensus Basic region leucine zipper transcriptio 97.17
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.51
PRK13169110 DNA replication intiation control protein YabA; Re 96.41
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.9
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 95.87
PRK10884206 SH3 domain-containing protein; Provisional 94.63
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.46
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.41
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.1
PRK10884206 SH3 domain-containing protein; Provisional 94.08
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 94.01
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 93.84
COG4467114 Regulator of replication initiation timing [Replic 93.81
PRK0029568 hypothetical protein; Provisional 93.63
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.6
PRK0279372 phi X174 lysis protein; Provisional 93.49
PRK0073668 hypothetical protein; Provisional 93.4
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 93.38
PRK0432574 hypothetical protein; Provisional 93.27
PF1374789 DUF4164: Domain of unknown function (DUF4164) 93.25
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.24
PRK0211973 hypothetical protein; Provisional 93.17
PRK0440675 hypothetical protein; Provisional 92.92
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.85
PRK11637 428 AmiB activator; Provisional 92.57
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 92.56
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 92.38
COG307479 Uncharacterized protein conserved in bacteria [Fun 92.16
PRK0084677 hypothetical protein; Provisional 91.91
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.73
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 91.59
PRK1542279 septal ring assembly protein ZapB; Provisional 91.23
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.03
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 90.96
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.92
COG4942 420 Membrane-bound metallopeptidase [Cell division and 90.81
PRK11637 428 AmiB activator; Provisional 90.66
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 90.62
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.29
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 90.19
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 89.17
COG307479 Uncharacterized protein conserved in bacteria [Fun 89.16
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 89.14
PF13851201 GAS: Growth-arrest specific micro-tubule binding 89.03
PF14662 193 CCDC155: Coiled-coil region of CCDC155 88.95
PRK10698222 phage shock protein PspA; Provisional 88.91
KOG0288 459 consensus WD40 repeat protein TipD [General functi 88.79
PRK1542279 septal ring assembly protein ZapB; Provisional 88.74
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 88.56
PRK10803 263 tol-pal system protein YbgF; Provisional 88.34
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 88.22
COG290072 SlyX Uncharacterized protein conserved in bacteria 88.18
TIGR02977219 phageshock_pspA phage shock protein A. Members of 87.95
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 87.38
KOG1103 561 consensus Predicted coiled-coil protein [Function 87.2
PF04880 166 NUDE_C: NUDE protein, C-terminal conserved region; 87.02
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 86.98
KOG1962216 consensus B-cell receptor-associated protein and r 86.97
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.75
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 86.73
PF10186 302 Atg14: UV radiation resistance protein and autopha 86.65
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 86.62
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 86.62
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 86.6
PRK13922 276 rod shape-determining protein MreC; Provisional 86.51
COG4026290 Uncharacterized protein containing TOPRIM domain, 86.49
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 86.46
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 86.42
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.36
PF14662193 CCDC155: Coiled-coil region of CCDC155 86.2
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 86.13
PRK13169110 DNA replication intiation control protein YabA; Re 86.1
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 85.99
PRK09039 343 hypothetical protein; Validated 85.81
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 85.77
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 85.6
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 85.48
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 85.43
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 85.21
PRK0211973 hypothetical protein; Provisional 84.9
PF13851201 GAS: Growth-arrest specific micro-tubule binding 84.84
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 84.78
PRK0440675 hypothetical protein; Provisional 84.7
PHA02562 562 46 endonuclease subunit; Provisional 84.68
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 84.61
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 84.4
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 84.31
PRK10803 263 tol-pal system protein YbgF; Provisional 84.07
PRK00888105 ftsB cell division protein FtsB; Reviewed 84.0
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 83.99
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 83.92
smart0033865 BRLZ basic region leucin zipper. 83.91
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.83
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 83.77
KOG3119269 consensus Basic region leucine zipper transcriptio 83.6
PF06216 389 RTBV_P46: Rice tungro bacilliform virus P46 protei 83.49
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 83.19
PRK14127109 cell division protein GpsB; Provisional 83.17
PRK09039 343 hypothetical protein; Validated 82.95
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 82.91
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.86
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 82.4
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 82.3
PF15294278 Leu_zip: Leucine zipper 81.83
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 81.78
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 81.77
COG2433 652 Uncharacterized conserved protein [Function unknow 81.44
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.37
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 80.99
KOG4196135 consensus bZIP transcription factor MafK [Transcri 80.97
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 80.88
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 80.8
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 80.55
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 80.53
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 80.51
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 80.28
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.21
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 80.21
PRK03918 880 chromosome segregation protein; Provisional 80.16
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 80.1
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.41  E-value=1.1e-12  Score=103.65  Aligned_cols=63  Identities=38%  Similarity=0.500  Sum_probs=58.5

Q ss_pred             cChHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010222          431 TDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNN  493 (514)
Q Consensus       431 ~DpKR~KRiLkNRESAqRSReRKKqYLeELE~KVq~LqtENssLs~QLtlLQre~~sL~tENk  493 (514)
                      .|+|+.+|+++||+||+++|+||++|+.+||.+|+.|+.+|..|..++..|+.++..|..++.
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~~   64 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELE   64 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            478999999999999999999999999999999999999999999999999888888777653

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF06216 RTBV_P46: Rice tungro bacilliform virus P46 protein; InterPro: IPR009347 This family consists of several Rice tungro bacilliform virus P46 proteins Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 4e-12
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 7e-12
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 2e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-09
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 6e-09
2wt7_B90 Transcription factor MAFB; transcription, transcri 9e-08
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 6e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 6e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 9e-06
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 2e-04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 4e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 60.1 bits (146), Expect = 4e-12
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 434 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ 482
           KR  R++ NR++A  S+ +K  Y+  LE++V  L+ +  TL  +L  L+
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALK 49
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.47
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.29
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.28
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.17
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.03
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.0
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.94
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.5
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.5
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.27
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.24
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.46
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.74
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.83
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.73
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.7
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.25
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 92.81
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.37
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.26
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 91.52
1deb_A54 APC protein, adenomatous polyposis coli protein; c 91.32
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.44
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 90.44
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 90.41
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.95
3m48_A33 General control protein GCN4; leucine zipper, synt 89.65
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 89.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 89.23
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 89.1
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 89.1
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 89.04
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 89.02
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 88.51
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 88.22
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 88.18
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 88.16
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 88.11
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 87.66
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 87.32
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.16
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 87.02
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 86.68
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 86.55
2wt7_B90 Transcription factor MAFB; transcription, transcri 86.38
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 86.12
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.87
2hy6_A34 General control protein GCN4; protein design, para 85.34
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 85.08
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 85.02
2bni_A34 General control protein GCN4; four helix bundle, a 84.95
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 84.62
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 84.1
1uo4_A34 General control protein GCN4; four helix bundle, c 84.02
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 83.96
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 83.58
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 83.42
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 83.33
4ati_A118 MITF, microphthalmia-associated transcription fact 83.03
4ath_A83 MITF, microphthalmia-associated transcription fact 83.02
3bas_A89 Myosin heavy chain, striated muscle/general contro 82.85
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 82.67
4h22_A103 Leucine-rich repeat flightless-interacting protei; 82.67
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 82.39
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 81.96
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 81.91
3m0d_C65 TNF receptor-associated factor 1; trimeric helix c 81.73
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 81.51
2v4h_A110 NF-kappa-B essential modulator; transcription, met 81.41
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 81.4
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 81.24
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 80.94
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 80.92
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 80.25
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 80.25
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 80.22
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.47  E-value=5.4e-14  Score=109.14  Aligned_cols=52  Identities=33%  Similarity=0.526  Sum_probs=48.7

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010222          434 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDS  485 (514)
Q Consensus       434 KR~KRiLkNRESAqRSReRKKqYLeELE~KVq~LqtENssLs~QLtlLQre~  485 (514)
                      ||++|+++||+||++||+||++|+++||.+|..|+.||..|..++..|+..+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999999887643
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3m0d_C TNF receptor-associated factor 1; trimeric helix coiled coiled, acetylation, alternative splic apoptosis, coiled coil, cytoplasm; 2.80A {Homo sapiens} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 92.34
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 84.27
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=92.34  E-value=0.018  Score=45.74  Aligned_cols=47  Identities=21%  Similarity=0.340  Sum_probs=33.5

Q ss_pred             HHHhhhcchhHHhhhhccChHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 010222          414 AELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISEL  460 (514)
Q Consensus       414 ~E~KKim~~ekLaElAl~DpKR~KRiLkNRESAqRSReRKKqYLeEL  460 (514)
                      +|-+..++...|.|..+.=-+-+||.=+|+++||++|+||....++|
T Consensus        28 ~eFne~l~~~~Lte~Ql~lirDIRRRGKNKvAAqnCRKRKld~~d~l   74 (74)
T d1sknp_          28 SELQQVLKNESLSEYQRQLIRKIRRRGKNKVAARTCRQRRTDRHDKM   74 (74)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHHHhCCCCHHHHHHHHHHHHhcccHHHHHHHHHhhhhhhccC
Confidence            44444554444554444446889999999999999999999876543
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure