Citrus Sinensis ID: 010244

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MQDDCGAASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQRVK
cccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccccHHEEEccccccccccEEEccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccccEEEccccccccccccccHHHHHHHHHccccccEEEcccHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEccEEEEEEcccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHccccccccccccccHHHHHHHcccccEEEEccccHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHcccccEEEEcccccccHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHc
cccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEEEEHHHHccccEEEccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccccEEEccEEEEccccccccHHHHHHHHHHHHHHHHEccccHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEccccEEEEEccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHcc
mqddcgaasattteqykmkiphvltvagsdsgagaGIQADLKACAARGVYCSTVITAVTAqntagvqgvnivpEDFVAAQLKSVLSDMQVdvvktgmlpsTDLVKVLLQSLsefpvralvvdpvmvstsgdvlagpstitglrenllpmadivtPNVKEASALLGGMQVVTVADMCSAAKLlhnlgprtvlvkggdlpdssdavdiffdgedfhELRSsrvntrnthgtgcTLASCIAAELAKGSPMLSAVKVAKCFVETAldyskdivigsgpqgpfdhllrlkstsrqshraeafnpsdlFLYAVTdsgmnkkwgRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCvhgvpllinDRIDIAlacdadgvhlgqsdmpARTARallgpdkiigvscktpeEAHQAWIdganyigcggvyptntkannltvgldGLKTvclasklpvvaiggigisnaSDVMKIGVSNLKGVAVVSALfdrecilpeSKKLHAVLMDAVQRVK
mqddcgaasattteqykmkiPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRssrvntrnthgtGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRaeafnpsdlflyAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQRVK
MQDDCGAASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQRVK
****************KMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLL****************PSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLM*******
**********************VLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDA*****
***********TTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQRVK
*****************MKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDDCGAASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECILPESKKLHAVLMDAVQRVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q5M731522 Thiamine biosynthetic bif yes no 0.972 0.957 0.760 0.0
O48881523 Thiamine biosynthetic bif N/A no 0.951 0.934 0.745 0.0
Q2QWK9548 Probable thiamine biosynt yes no 0.957 0.897 0.691 0.0
P61422490 Thiamine biosynthesis bif yes no 0.496 0.520 0.496 2e-53
P56904266 Hydroxymethylpyrimidine/p yes no 0.474 0.917 0.457 3e-51
P55882266 Hydroxymethylpyrimidine/p yes no 0.509 0.984 0.435 6e-51
P76422266 Hydroxymethylpyrimidine/p N/A no 0.509 0.984 0.420 3e-50
Q6GEY2276 Hydroxymethylpyrimidine/p yes no 0.503 0.938 0.383 6e-47
P99124276 Hydroxymethylpyrimidine/p yes no 0.503 0.938 0.379 8e-47
P66915276 Hydroxymethylpyrimidine/p yes no 0.503 0.938 0.379 8e-47
>sp|Q5M731|TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana GN=TH1 PE=1 SV=1 Back     alignment and function desciption
 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/502 (76%), Positives = 432/502 (86%), Gaps = 2/502 (0%)

Query: 8   ASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQ 67
           AS TTTE  + K+P VLTVAGSDSGAGAGIQADLK CAARGVYC++VITAVTAQNT GVQ
Sbjct: 19  ASMTTTESVR-KVPQVLTVAGSDSGAGAGIQADLKVCAARGVYCASVITAVTAQNTRGVQ 77

Query: 68  GVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVS 127
            V+++P +F++ QLKSVLSD + DVVKTGMLPST++V+VLLQ+LS+FPVRALVVDPVMVS
Sbjct: 78  SVHLLPPEFISEQLKSVLSDFEFDVVKTGMLPSTEIVEVLLQNLSDFPVRALVVDPVMVS 137

Query: 128 TSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGP 187
           TSG VLAG S ++  RE LLP+ADI+TPNVKEASALL G ++ TVA+M SAAK LH +GP
Sbjct: 138 TSGHVLAGSSILSIFRERLLPIADIITPNVKEASALLDGFRIETVAEMRSAAKSLHEMGP 197

Query: 188 RTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPM 247
           R VLVKGGDLPDSSD+VD++FDG++FHELRS R+ TRNTHGTGCTLASCIAAELAKGS M
Sbjct: 198 RFVLVKGGDLPDSSDSVDVYFDGKEFHELRSPRIATRNTHGTGCTLASCIAAELAKGSSM 257

Query: 248 LSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAV 307
           LSAVKVAK FV+ ALDYSKDIVIGSG QGPFDH   LK    QS R   FNP DLFLYAV
Sbjct: 258 LSAVKVAKRFVDNALDYSKDIVIGSGMQGPFDHFFGLKKDP-QSSRCSIFNPDDLFLYAV 316

Query: 308 TDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLI 367
           TDS MNKKW RSI DA+KAA+EGGATIIQLREK+A+TR FLE AKAC+ IC  HGV LLI
Sbjct: 317 TDSRMNKKWNRSIVDALKAAIEGGATIIQLREKEAETREFLEEAKACIDICRSHGVSLLI 376

Query: 368 NDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGC 427
           NDRIDIALACDADGVH+GQSDMP    R+LLGPDKIIGVSCKTPE+AHQAW DGA+YIG 
Sbjct: 377 NDRIDIALACDADGVHVGQSDMPVDLVRSLLGPDKIIGVSCKTPEQAHQAWKDGADYIGS 436

Query: 428 GGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVS 487
           GGV+PTNTKANN T+GLDGLK VC ASKLPVVAIGGIGISNA  VM+I   NLKGVAVVS
Sbjct: 437 GGVFPTNTKANNRTIGLDGLKEVCEASKLPVVAIGGIGISNAGSVMQIDAPNLKGVAVVS 496

Query: 488 ALFDRECILPESKKLHAVLMDA 509
           ALFD++C+L ++KKLH  L ++
Sbjct: 497 ALFDQDCVLTQAKKLHKTLKES 518
Essential for thiamine biosynthesis. Bifunctional enzyme that catalyzes the phosphorylation of hydroxymethylpyrimidine phosphate (HMP-P) to HMP-PP and condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monophosphate (TMP).
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 9
>sp|O48881|TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus GN=BTH1 PE=1 SV=1 Back     alignment and function description
>sp|Q2QWK9|TPS1_ORYSJ Probable thiamine biosynthetic bifunctional enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0192500 PE=2 SV=2 Back     alignment and function description
>sp|P61422|THIED_GEOSL Thiamine biosynthesis bifunctional protein ThiED OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiDE PE=3 SV=1 Back     alignment and function description
>sp|P56904|THID_RHIME Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Rhizobium meliloti (strain 1021) GN=thiD PE=3 SV=2 Back     alignment and function description
>sp|P55882|THID_SALTY Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiD PE=1 SV=2 Back     alignment and function description
>sp|P76422|THID_ECOLI Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Escherichia coli (strain K12) GN=thiD PE=1 SV=1 Back     alignment and function description
>sp|Q6GEY2|THID_STAAR Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain MRSA252) GN=thiD PE=3 SV=1 Back     alignment and function description
>sp|P99124|THID_STAAN Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain N315) GN=thiD PE=1 SV=1 Back     alignment and function description
>sp|P66915|THID_STAAM Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
359486279 681 PREDICTED: putative hydroxymethylpyrimid 0.994 0.750 0.803 0.0
297739580497 unnamed protein product [Vitis vinifera] 0.966 1.0 0.820 0.0
255579675546 phosphomethylpyrimidine kinase, putative 0.961 0.904 0.793 0.0
118487300531 unknown [Populus trichocarpa] 0.970 0.939 0.779 0.0
224073276507 predicted protein [Populus trichocarpa] 0.970 0.984 0.777 0.0
357445411576 Thiamine-phosphate pyrophosphorylase [Me 0.955 0.852 0.771 0.0
30688130522 thiamine-phosphate pyrophosphorylase [Ar 0.972 0.957 0.760 0.0
449445302532 PREDICTED: thiamine biosynthetic bifunct 0.982 0.949 0.748 0.0
22135970522 phosphomethylpyrimidine kinase [Arabidop 0.972 0.957 0.760 0.0
297845330522 hypothetical protein ARALYDRAFT_472545 [ 0.974 0.959 0.755 0.0
>gi|359486279|ref|XP_002265950.2| PREDICTED: putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/514 (80%), Positives = 457/514 (88%), Gaps = 3/514 (0%)

Query: 1   MQDDCGAASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTA 60
           MQ+D     +T  +  KMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTA
Sbjct: 171 MQED---RPSTVKDDSKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTA 227

Query: 61  QNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALV 120
           QNT GVQGVNIVPEDFVA QLKSVLSDM VDVVKTGMLP+  +VKVL  SL EFPV+ALV
Sbjct: 228 QNTVGVQGVNIVPEDFVAEQLKSVLSDMHVDVVKTGMLPTIGIVKVLHHSLKEFPVQALV 287

Query: 121 VDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAK 180
           VDPVMVSTSGDVLAGPS +   RE LLPMADIVTPN+KEASALLGG+Q+ TV+DMC+AAK
Sbjct: 288 VDPVMVSTSGDVLAGPSILAAFREELLPMADIVTPNLKEASALLGGLQLETVSDMCTAAK 347

Query: 181 LLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAE 240
           L+H++GPR VLVKGGDLP S DAVDIFFDG+DF+ELRSSR+ TRNTHGTGCTLASCIAAE
Sbjct: 348 LIHDMGPRNVLVKGGDLPSSLDAVDIFFDGDDFYELRSSRIKTRNTHGTGCTLASCIAAE 407

Query: 241 LAKGSPMLSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPS 300
           LAKGS +LSAVK AK ++ETALDYSKDI IG+G QGPFDHLL+LKS  R S R +AFNP+
Sbjct: 408 LAKGSQILSAVKAAKHYIETALDYSKDIAIGNGFQGPFDHLLKLKSNIRNSFRKQAFNPA 467

Query: 301 DLFLYAVTDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCV 360
           +LFLYAVTDSGMNKKWGRSIT+AVKAA+EGGATI+QLREKDA+TR FLEAAKAC++IC  
Sbjct: 468 NLFLYAVTDSGMNKKWGRSITEAVKAAIEGGATIVQLREKDAETRDFLEAAKACVEICHS 527

Query: 361 HGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWID 420
           HGVPLLINDRID+ALACDADGVH+GQSD+PAR  R LLGP+KIIGVSCKTPE+A +AWID
Sbjct: 528 HGVPLLINDRIDVALACDADGVHVGQSDIPARVVRTLLGPEKIIGVSCKTPEQAEKAWID 587

Query: 421 GANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNL 480
           GA+YIGCGGVYPTNTKANN+TVGLDGLKTVCLASKLPVVAIGGI  SNA  VM+IGV NL
Sbjct: 588 GADYIGCGGVYPTNTKANNITVGLDGLKTVCLASKLPVVAIGGINASNARTVMEIGVPNL 647

Query: 481 KGVAVVSALFDRECILPESKKLHAVLMDAVQRVK 514
           KGVAVVSALFDREC+L E++KLH  L  A   VK
Sbjct: 648 KGVAVVSALFDRECVLTETQKLHGDLTQAAAMVK 681

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739580|emb|CBI29762.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255579675|ref|XP_002530677.1| phosphomethylpyrimidine kinase, putative [Ricinus communis] gi|223529770|gb|EEF31708.1| phosphomethylpyrimidine kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118487300|gb|ABK95478.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073276|ref|XP_002304056.1| predicted protein [Populus trichocarpa] gi|222841488|gb|EEE79035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357445411|ref|XP_003592983.1| Thiamine-phosphate pyrophosphorylase [Medicago truncatula] gi|355482031|gb|AES63234.1| Thiamine-phosphate pyrophosphorylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|30688130|ref|NP_173707.2| thiamine-phosphate pyrophosphorylase [Arabidopsis thaliana] gi|75222969|sp|Q5M731.1|TPS1L_ARATH RecName: Full=Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic; Includes: RecName: Full=Thiamine-phosphate synthase; Short=TP synthase; Short=TPS; AltName: Full=Thiamine-phosphate pyrophosphorylase; Short=TMP pyrophosphorylase; Short=TMP-PPase; Includes: RecName: Full=Hydroxymethylpyrimidine kinase; Short=HMP kinase; Flags: Precursor gi|56550709|gb|AAV97808.1| At1g22940 [Arabidopsis thaliana] gi|332192192|gb|AEE30313.1| thiamine-phosphate pyrophosphorylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449445302|ref|XP_004140412.1| PREDICTED: thiamine biosynthetic bifunctional enzyme TH1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22135970|gb|AAM91567.1| phosphomethylpyrimidine kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845330|ref|XP_002890546.1| hypothetical protein ARALYDRAFT_472545 [Arabidopsis lyrata subsp. lyrata] gi|297336388|gb|EFH66805.1| hypothetical protein ARALYDRAFT_472545 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
TAIR|locus:2017734522 TH1 "THIAMINE REQUIRING 1" [Ar 0.972 0.957 0.760 7.3e-201
UNIPROTKB|O48881523 BTH1 "Thiamine biosynthetic bi 0.974 0.957 0.735 1.5e-193
TIGR_CMR|GSU_0605490 GSU_0605 "thiamine-phosphate p 0.496 0.520 0.496 7.5e-57
ASPGD|ASPL0000004890510 AN10762 [Emericella nidulans ( 0.359 0.362 0.442 1.6e-55
TIGR_CMR|BA_0734270 BA_0734 "phosphomethylpyrimidi 0.503 0.959 0.454 3.7e-55
TIGR_CMR|CBU_0334479 CBU_0334 "phosphomethylpyrimid 0.877 0.941 0.309 2e-49
UNIPROTKB|P76422266 thiD "ThiD" [Escherichia coli 0.507 0.981 0.422 1.1e-48
UNIPROTKB|P66913265 thiD "Hydroxymethylpyrimidine/ 0.511 0.992 0.430 7.7e-48
UNIPROTKB|Q9KSG0282 VC_1296 "Phosphomethylpyrimidi 0.525 0.957 0.402 7.7e-48
TIGR_CMR|VC_1296282 VC_1296 "phosphomethylpyrimidi 0.525 0.957 0.402 7.7e-48
TAIR|locus:2017734 TH1 "THIAMINE REQUIRING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1944 (689.4 bits), Expect = 7.3e-201, P = 7.3e-201
 Identities = 382/502 (76%), Positives = 432/502 (86%)

Query:     8 ASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQ 67
             AS TTTE  + K+P VLTVAGSDSGAGAGIQADLK CAARGVYC++VITAVTAQNT GVQ
Sbjct:    19 ASMTTTESVR-KVPQVLTVAGSDSGAGAGIQADLKVCAARGVYCASVITAVTAQNTRGVQ 77

Query:    68 GVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVS 127
              V+++P +F++ QLKSVLSD + DVVKTGMLPST++V+VLLQ+LS+FPVRALVVDPVMVS
Sbjct:    78 SVHLLPPEFISEQLKSVLSDFEFDVVKTGMLPSTEIVEVLLQNLSDFPVRALVVDPVMVS 137

Query:   128 TSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGP 187
             TSG VLAG S ++  RE LLP+ADI+TPNVKEASALL G ++ TVA+M SAAK LH +GP
Sbjct:   138 TSGHVLAGSSILSIFRERLLPIADIITPNVKEASALLDGFRIETVAEMRSAAKSLHEMGP 197

Query:   188 RTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPM 247
             R VLVKGGDLPDSSD+VD++FDG++FHELRS R+ TRNTHGTGCTLASCIAAELAKGS M
Sbjct:   198 RFVLVKGGDLPDSSDSVDVYFDGKEFHELRSPRIATRNTHGTGCTLASCIAAELAKGSSM 257

Query:   248 LSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAV 307
             LSAVKVAK FV+ ALDYSKDIVIGSG QGPFDH   LK    QS R   FNP DLFLYAV
Sbjct:   258 LSAVKVAKRFVDNALDYSKDIVIGSGMQGPFDHFFGLKKDP-QSSRCSIFNPDDLFLYAV 316

Query:   308 TDSGMNKKWGRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLI 367
             TDS MNKKW RSI DA+KAA+EGGATIIQLREK+A+TR FLE AKAC+ IC  HGV LLI
Sbjct:   317 TDSRMNKKWNRSIVDALKAAIEGGATIIQLREKEAETREFLEEAKACIDICRSHGVSLLI 376

Query:   368 NDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGC 427
             NDRIDIALACDADGVH+GQSDMP    R+LLGPDKIIGVSCKTPE+AHQAW DGA+YIG 
Sbjct:   377 NDRIDIALACDADGVHVGQSDMPVDLVRSLLGPDKIIGVSCKTPEQAHQAWKDGADYIGS 436

Query:   428 GGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVS 487
             GGV+PTNTKANN T+GLDGLK VC ASKLPVVAIGGIGISNA  VM+I   NLKGVAVVS
Sbjct:   437 GGVFPTNTKANNRTIGLDGLKEVCEASKLPVVAIGGIGISNAGSVMQIDAPNLKGVAVVS 496

Query:   488 ALFDRECILPESKKLHAVLMDA 509
             ALFD++C+L ++KKLH  L ++
Sbjct:   497 ALFDQDCVLTQAKKLHKTLKES 518
GO:0003824 "catalytic activity" evidence=IEA
GO:0004789 "thiamine-phosphate diphosphorylase activity" evidence=IEA;IGI;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008972 "phosphomethylpyrimidine kinase activity" evidence=IEA;IGI
GO:0009228 "thiamine biosynthetic process" evidence=IEA;IMP
GO:0008902 "hydroxymethylpyrimidine kinase activity" evidence=IGI
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
UNIPROTKB|O48881 BTH1 "Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic" [Brassica napus (taxid:3708)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0605 GSU_0605 "thiamine-phosphate pyrophosphorylase/phosphomethylpyrimidine kinase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
ASPGD|ASPL0000004890 AN10762 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0734 BA_0734 "phosphomethylpyrimidine kinase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0334 CBU_0334 "phosphomethylpyrimidine kinase/thiamin-phosphate pyrophosphorylase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P76422 thiD "ThiD" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P66913 thiD "Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KSG0 VC_1296 "Phosphomethylpyrimidine kinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1296 VC_1296 "phosphomethylpyrimidine kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2QWK9TPS1_ORYSJ2, ., 7, ., 1, ., 4, 90.69100.95710.8978yesno
Q5M731TPS1L_ARATH2, ., 7, ., 1, ., 4, 90.76090.97270.9578yesno
O48881TPS1_BRANA2, ., 7, ., 1, ., 4, 90.74540.95130.9349N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.7LOW CONFIDENCE prediction!
3rd Layer2.7.10.691
4th Layer2.7.1.49LOW CONFIDENCE prediction!
3rd Layer2.5.1.30.737
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
PLN02898502 PLN02898, PLN02898, HMP-P kinase/thiamin-monophosp 0.0
PRK06427266 PRK06427, PRK06427, bifunctional hydroxy-methylpyr 1e-118
TIGR00097254 TIGR00097, HMP-P_kinase, phosphomethylpyrimidine k 1e-116
COG0351263 COG0351, ThiD, Hydroxymethylpyrimidine/phosphometh 1e-114
cd01169242 cd01169, HMPP_kinase, 4-amino-5-hydroxymethyl-2-me 1e-111
pfam08543246 pfam08543, Phos_pyr_kin, Phosphomethylpyrimidine k 1e-107
cd00564196 cd00564, TMP_TenI, Thiamine monophosphate synthase 2e-78
PTZ00347504 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase 4e-78
pfam02581180 pfam02581, TMP-TENI, Thiamine monophosphate syntha 4e-76
PRK00043212 PRK00043, thiE, thiamine-phosphate pyrophosphoryla 9e-74
PRK08573448 PRK08573, PRK08573, phosphomethylpyrimidine kinase 2e-72
PRK02615347 PRK02615, PRK02615, thiamine-phosphate pyrophospho 4e-71
COG0352211 COG0352, ThiE, Thiamine monophosphate synthase [Co 3e-67
TIGR00693196 TIGR00693, thiE, thiamine-phosphate pyrophosphoryl 3e-64
PRK12412268 PRK12412, PRK12412, pyridoxal kinase; Reviewed 4e-63
PRK14713530 PRK14713, PRK14713, multifunctional hydroxymethylp 1e-61
PRK12616270 PRK12616, PRK12616, pyridoxal kinase; Reviewed 3e-55
PRK09517755 PRK09517, PRK09517, multifunctional thiamine-phosp 6e-55
PRK12413253 PRK12413, PRK12413, phosphomethylpyrimidine kinase 2e-46
PTZ00493321 PTZ00493, PTZ00493, phosphomethylpyrimidine kinase 5e-31
PRK09517 755 PRK09517, PRK09517, multifunctional thiamine-phosp 4e-28
PRK07695201 PRK07695, PRK07695, transcriptional regulator TenI 2e-24
PRK08999312 PRK08999, PRK08999, hypothetical protein; Provisio 6e-18
cd01173254 cd01173, pyridoxal_pyridoxamine_kinase, Pyridoxal 1e-16
COG2240281 COG2240, PdxK, Pyridoxal/pyridoxine/pyridoxamine k 9e-16
PRK03512211 PRK03512, PRK03512, thiamine-phosphate pyrophospho 4e-15
PRK07105284 PRK07105, PRK07105, pyridoxamine kinase; Validated 3e-11
PRK12290437 PRK12290, thiE, thiamine-phosphate pyrophosphoryla 5e-11
cd01174292 cd01174, ribokinase, Ribokinase catalyses the phos 8e-11
PRK05756286 PRK05756, PRK05756, pyridoxamine kinase; Validated 1e-10
TIGR00687286 TIGR00687, pyridox_kin, pyridoxal kinase 5e-10
PTZ00344296 PTZ00344, PTZ00344, pyridoxal kinase; Provisional 1e-09
cd00287196 cd00287, ribokinase_pfkB_like, ribokinase/pfkB sup 1e-09
PLN02978308 PLN02978, PLN02978, pyridoxal kinase 9e-07
PRK08176281 PRK08176, pdxK, pyridoxal-pyridoxamine kinase/hydr 2e-06
TIGR02152293 TIGR02152, D_ribokin_bact, ribokinase 2e-06
cd01164289 cd01164, FruK_PfkB_like, 1-phosphofructokinase (Fr 2e-06
COG0524311 COG0524, RbsK, Sugar kinases, ribokinase family [C 5e-06
pfam00294298 pfam00294, PfkB, pfkB family carbohydrate kinase 6e-06
PRK11142306 PRK11142, PRK11142, ribokinase; Provisional 9e-05
cd01171254 cd01171, YXKO-related, B 1e-04
COG0063284 COG0063, COG0063, Predicted sugar kinase [Carbohyd 0.002
COG1105310 COG1105, FruK, Fructose-1-phosphate kinase and rel 0.002
TIGR03168303 TIGR03168, 1-PFK, hexose kinase, 1-phosphofructoki 0.004
>gnl|CDD|215486 PLN02898, PLN02898, HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information 
 Score =  870 bits (2249), Expect = 0.0
 Identities = 383/497 (77%), Positives = 431/497 (86%)

Query: 17  KMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDF 76
            MK+PHVLTVAGSDSGAGAGIQAD+KACAARGVYC+T ITAVTAQNT GVQGV+ VP DF
Sbjct: 6   PMKVPHVLTVAGSDSGAGAGIQADIKACAARGVYCTTAITAVTAQNTVGVQGVHAVPLDF 65

Query: 77  VAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGP 136
           VA QLKSVLSDM VDVVKTGMLPS ++VKVL Q+L EFPV+ALVVDPVMVSTSGDVLAGP
Sbjct: 66  VAEQLKSVLSDMPVDVVKTGMLPSAEIVKVLCQALKEFPVKALVVDPVMVSTSGDVLAGP 125

Query: 137 STITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGD 196
           S ++ LRE LLP+A IVTPNVKEASALLGG  + TVADM SAAK LH LGPR VLVKGG 
Sbjct: 126 SILSALREELLPLATIVTPNVKEASALLGGDPLETVADMRSAAKELHKLGPRYVLVKGGH 185

Query: 197 LPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKC 256
           LPDS DAVD+ +DG +FHELRSSR+ TRNTHGTGCTLASCIAAELAKGS MLSAVKVAK 
Sbjct: 186 LPDSLDAVDVLYDGTEFHELRSSRIKTRNTHGTGCTLASCIAAELAKGSDMLSAVKVAKR 245

Query: 257 FVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKW 316
           +VETAL+YSKDI IG+G QGPF+HL  LKS +++S R   FNP +LFLYAVTDSGMNKKW
Sbjct: 246 YVETALEYSKDIGIGNGAQGPFNHLFFLKSWAKKSSRQSRFNPRNLFLYAVTDSGMNKKW 305

Query: 317 GRSITDAVKAALEGGATIIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALA 376
           GRS  DAV+AA+EGGATI+QLREK+A+TR F+E AKACL IC  +GVPLLINDR+D+ALA
Sbjct: 306 GRSTVDAVRAAIEGGATIVQLREKEAETREFIEEAKACLAICRSYGVPLLINDRVDVALA 365

Query: 377 CDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEEAHQAWIDGANYIGCGGVYPTNTK 436
           CDADGVHLGQSDMP R AR+LLGP KIIGVSCKTPE+A QAW DGA+YIGCGGV+PTNTK
Sbjct: 366 CDADGVHLGQSDMPVRLARSLLGPGKIIGVSCKTPEQAEQAWKDGADYIGCGGVFPTNTK 425

Query: 437 ANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRECIL 496
           ANN T+GLDGL+ VC ASKLPVVAIGGI  SNA+ VM+ G  NLKGVAVVSALFD+E +L
Sbjct: 426 ANNKTIGLDGLREVCEASKLPVVAIGGISASNAASVMESGAPNLKGVAVVSALFDQEDVL 485

Query: 497 PESKKLHAVLMDAVQRV 513
             ++KLHA+L +A+   
Sbjct: 486 KATRKLHAILTEALSES 502

Length = 502
>gnl|CDD|180561 PRK06427, PRK06427, bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed Back     alignment and domain information
>gnl|CDD|232823 TIGR00097, HMP-P_kinase, phosphomethylpyrimidine kinase Back     alignment and domain information
>gnl|CDD|223428 COG0351, ThiD, Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238574 cd01169, HMPP_kinase, 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 Back     alignment and domain information
>gnl|CDD|219893 pfam08543, Phos_pyr_kin, Phosphomethylpyrimidine kinase Back     alignment and domain information
>gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>gnl|CDD|240375 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|217120 pfam02581, TMP-TENI, Thiamine monophosphate synthase/TENI Back     alignment and domain information
>gnl|CDD|234590 PRK00043, thiE, thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|236297 PRK08573, PRK08573, phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|235054 PRK02615, PRK02615, thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|223429 COG0352, ThiE, Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233094 TIGR00693, thiE, thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>gnl|CDD|183512 PRK12412, PRK12412, pyridoxal kinase; Reviewed Back     alignment and domain information
>gnl|CDD|237797 PRK14713, PRK14713, multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|183624 PRK12616, PRK12616, pyridoxal kinase; Reviewed Back     alignment and domain information
>gnl|CDD|169939 PRK09517, PRK09517, multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|183513 PRK12413, PRK12413, phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|240440 PTZ00493, PTZ00493, phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|169939 PRK09517, PRK09517, multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|181086 PRK07695, PRK07695, transcriptional regulator TenI; Provisional Back     alignment and domain information
>gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238578 cd01173, pyridoxal_pyridoxamine_kinase, Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP Back     alignment and domain information
>gnl|CDD|225149 COG2240, PdxK, Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|179586 PRK03512, PRK03512, thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|180840 PRK07105, PRK07105, pyridoxamine kinase; Validated Back     alignment and domain information
>gnl|CDD|237041 PRK12290, thiE, thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|238579 cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>gnl|CDD|235592 PRK05756, PRK05756, pyridoxamine kinase; Validated Back     alignment and domain information
>gnl|CDD|211599 TIGR00687, pyridox_kin, pyridoxal kinase Back     alignment and domain information
>gnl|CDD|240372 PTZ00344, PTZ00344, pyridoxal kinase; Provisional Back     alignment and domain information
>gnl|CDD|238177 cd00287, ribokinase_pfkB_like, ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>gnl|CDD|215529 PLN02978, PLN02978, pyridoxal kinase Back     alignment and domain information
>gnl|CDD|181269 PRK08176, pdxK, pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed Back     alignment and domain information
>gnl|CDD|233751 TIGR02152, D_ribokin_bact, ribokinase Back     alignment and domain information
>gnl|CDD|238570 cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase Back     alignment and domain information
>gnl|CDD|236858 PRK11142, PRK11142, ribokinase; Provisional Back     alignment and domain information
>gnl|CDD|238576 cd01171, YXKO-related, B Back     alignment and domain information
>gnl|CDD|223141 COG0063, COG0063, Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224030 COG1105, FruK, Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234133 TIGR03168, 1-PFK, hexose kinase, 1-phosphofructokinase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 100.0
COG0351263 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidi 100.0
KOG2598523 consensus Phosphomethylpyrimidine kinase [Coenzyme 100.0
PRK12616270 pyridoxal kinase; Reviewed 100.0
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 100.0
PTZ00493321 phosphomethylpyrimidine kinase; Provisional 100.0
PRK12412268 pyridoxal kinase; Reviewed 100.0
TIGR00097254 HMP-P_kinase phosphomethylpyrimidine kinase. This 100.0
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 100.0
PRK06427266 bifunctional hydroxy-methylpyrimidine kinase/ hydr 100.0
PF08543246 Phos_pyr_kin: Phosphomethylpyrimidine kinase; Inte 100.0
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 100.0
cd01169242 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrim 100.0
PTZ00347504 phosphomethylpyrimidine kinase; Provisional 100.0
PRK09517755 multifunctional thiamine-phosphate pyrophosphoryla 100.0
PRK14713530 multifunctional hydroxymethylpyrimidine phosphokin 100.0
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 100.0
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 100.0
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 100.0
PRK08573448 phosphomethylpyrimidine kinase; Provisional 100.0
PRK12413253 phosphomethylpyrimidine kinase; Provisional 100.0
PRK08999312 hypothetical protein; Provisional 100.0
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 100.0
cd01173254 pyridoxal_pyridoxamine_kinase Pyridoxal kinase pla 100.0
PRK08176281 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpy 100.0
PRK05756286 pyridoxamine kinase; Validated 100.0
PRK07105284 pyridoxamine kinase; Validated 100.0
PRK07695201 transcriptional regulator TenI; Provisional 100.0
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 100.0
COG2240281 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coe 100.0
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 100.0
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.97
TIGR00687286 pyridox_kin pyridoxal kinase. ThiD and related pro 99.97
KOG2599308 consensus Pyridoxal/pyridoxine/pyridoxamine kinase 99.97
PTZ00344296 pyridoxal kinase; Provisional 99.96
PLN02978308 pyridoxal kinase 99.96
cd01171254 YXKO-related B.subtilis YXKO protein of unknown fu 99.96
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.94
TIGR00196272 yjeF_cterm yjeF C-terminal region, hydroxyethylthi 99.94
PLN02334229 ribulose-phosphate 3-epimerase 99.93
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.92
PRK10565508 putative carbohydrate kinase; Provisional 99.89
COG0063284 Predicted sugar kinase [Carbohydrate transport and 99.88
PF01256242 Carb_kinase: Carbohydrate kinase; InterPro: IPR000 99.81
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.81
PRK06806281 fructose-bisphosphate aldolase; Provisional 99.8
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 99.8
TIGR00694249 thiM hydroxyethylthiazole kinase. This model repre 99.8
PRK05581220 ribulose-phosphate 3-epimerase; Validated 99.8
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 99.79
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 99.78
cd01170242 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (T 99.78
cd01174292 ribokinase Ribokinase catalyses the phosphorylatio 99.77
PRK11142306 ribokinase; Provisional 99.76
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 99.75
PTZ00292326 ribokinase; Provisional 99.75
TIGR03828304 pfkB 1-phosphofructokinase. This enzyme acts in co 99.74
cd01164289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 99.74
PRK09850313 pseudouridine kinase; Provisional 99.74
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 99.73
TIGR02152293 D_ribokin_bact ribokinase. This model describes ri 99.73
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.73
PRK09355263 hydroxyethylthiazole kinase; Validated 99.73
PRK09954362 putative kinase; Provisional 99.72
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.72
cd01166294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 99.72
cd01172304 RfaE_like RfaE encodes a bifunctional ADP-heptose 99.71
TIGR03168303 1-PFK hexose kinase, 1-phosphofructokinase family. 99.71
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 99.71
TIGR02198315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 99.71
PRK09513312 fruK 1-phosphofructokinase; Provisional 99.7
PLN02341470 pfkB-type carbohydrate kinase family protein 99.7
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.7
PRK13508309 tagatose-6-phosphate kinase; Provisional 99.7
TIGR01231309 lacC tagatose-6-phosphate kinase. This enzyme is p 99.7
cd01941288 YeiC_kinase_like YeiC-like sugar kinase. Found in 99.69
PRK10294309 6-phosphofructokinase 2; Provisional 99.69
cd01167295 bac_FRK Fructokinases (FRKs) mainly from bacteria 99.69
PTZ00247345 adenosine kinase; Provisional 99.69
cd01168312 adenosine_kinase Adenosine kinase (AK) catalyzes t 99.69
PRK09434304 aminoimidazole riboside kinase; Provisional 99.67
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 99.65
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 99.64
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.63
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.63
PF00294301 PfkB: pfkB family carbohydrate kinase; InterPro: I 99.63
PLN02323330 probable fructokinase 99.63
cd01945284 ribokinase_group_B Ribokinase-like subgroup B. Fou 99.63
cd01946277 ribokinase_group_C Ribokinase-like subgroup C. Fou 99.63
PRK07315293 fructose-bisphosphate aldolase; Provisional 99.62
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.62
PLN02813426 pfkB-type carbohydrate kinase family protein 99.61
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 99.61
PLN02967581 kinase 99.61
cd01944289 YegV_kinase_like YegV-like sugar kinase. Found onl 99.61
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.6
cd01940264 Fructoselysine_kinase_like Fructoselysine kinase-l 99.6
COG0524311 RbsK Sugar kinases, ribokinase family [Carbohydrat 99.59
KOG3974306 consensus Predicted sugar kinase [Carbohydrate tra 99.58
PLN02548332 adenosine kinase 99.58
PLN02379367 pfkB-type carbohydrate kinase family protein 99.58
cd00287196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 99.57
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.57
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 99.56
cd01937254 ribokinase_group_D Ribokinase-like subgroup D. Fou 99.56
cd01943328 MAK32 MAK32 kinase. MAK32 is a protein found prima 99.55
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.55
cd01942279 ribokinase_group_A Ribokinase-like subgroup A. Fou 99.54
PRK15074434 inosine/guanosine kinase; Provisional 99.54
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 99.54
PLN02543496 pfkB-type carbohydrate kinase family protein 99.53
PRK07226267 fructose-bisphosphate aldolase; Provisional 99.51
cd01947265 Guanosine_kinase_like Guanosine kinase-like sugar 99.5
PRK09813260 fructoselysine 6-kinase; Provisional 99.49
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.47
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 99.45
cd01939290 Ketohexokinase Ketohexokinase (fructokinase, KHK) 99.43
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 99.43
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.42
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.38
PLN02630335 pfkB-type carbohydrate kinase family protein 99.36
KOG2855330 consensus Ribokinase [Carbohydrate transport and m 99.35
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.34
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.33
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 99.33
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.3
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.29
COG2145265 ThiM Hydroxyethylthiazole kinase, sugar kinase fam 99.29
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 99.28
PRK06801286 hypothetical protein; Provisional 99.27
KOG2854343 consensus Possible pfkB family carbohydrate kinase 99.27
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 99.27
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 99.26
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 99.23
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 99.23
PF02110246 HK: Hydroxyethylthiazole kinase family; InterPro: 99.22
PRK08005210 epimerase; Validated 99.16
PRK08091228 ribulose-phosphate 3-epimerase; Validated 99.16
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 99.16
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 99.15
PRK08185283 hypothetical protein; Provisional 99.13
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.12
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 99.12
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 99.11
PRK14057254 epimerase; Provisional 99.09
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 99.05
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 99.04
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 99.03
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 98.97
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 98.96
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 98.95
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.85
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 98.85
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 98.82
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.81
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.81
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.79
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 98.79
PRK08227264 autoinducer 2 aldolase; Validated 98.79
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.79
PRK00208250 thiG thiazole synthase; Reviewed 98.78
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 98.76
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.76
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 98.75
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.75
PRK04302223 triosephosphate isomerase; Provisional 98.67
PRK06852304 aldolase; Validated 98.65
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.62
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.61
PLN02591250 tryptophan synthase 98.61
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.59
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 98.54
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 98.48
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.4
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.4
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 98.39
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.37
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.37
PRK14024241 phosphoribosyl isomerase A; Provisional 98.36
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 98.36
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 98.34
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 98.31
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.31
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 98.31
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.3
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.28
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.27
PRK09250348 fructose-bisphosphate aldolase; Provisional 98.25
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 98.25
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.22
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.21
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.17
PLN02460338 indole-3-glycerol-phosphate synthase 98.11
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 98.1
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.05
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 98.04
KOG2947308 consensus Carbohydrate kinase [Carbohydrate transp 98.02
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.01
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 97.99
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.97
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 97.97
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.96
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 97.94
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 97.94
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 97.93
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 97.93
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.93
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.92
KOG3009614 consensus Predicted carbohydrate kinase, contains 97.92
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.91
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.91
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.89
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.89
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.85
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 97.85
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.85
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 97.84
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.83
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 97.82
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.82
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.81
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 97.79
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 97.78
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.78
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.78
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.77
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.74
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 97.74
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 97.7
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 97.68
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 97.68
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.67
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.64
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.64
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.63
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.63
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.62
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.61
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 97.61
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.59
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 97.59
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 97.59
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.56
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.55
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 97.55
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.54
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.51
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 97.51
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.49
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 97.49
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 97.49
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 97.48
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 97.48
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 97.48
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 97.44
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 97.42
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 97.4
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 97.4
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 97.37
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.36
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.35
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.35
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 97.35
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.33
PLN02363256 phosphoribosylanthranilate isomerase 97.32
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 97.32
PRK06096284 molybdenum transport protein ModD; Provisional 97.32
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 97.31
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 97.3
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 97.3
PRK09016296 quinolinate phosphoribosyltransferase; Validated 97.27
PLN02535364 glycolate oxidase 97.26
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.26
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.22
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 97.2
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.2
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 97.2
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 97.2
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.2
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 97.19
KOG4201289 consensus Anthranilate synthase component II [Amin 97.19
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.18
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 97.18
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 97.15
TIGR01334277 modD putative molybdenum utilization protein ModD. 97.14
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.12
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.11
KOG0538363 consensus Glycolate oxidase [Energy production and 97.11
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 97.1
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.08
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 97.08
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 97.08
PRK10605362 N-ethylmaleimide reductase; Provisional 97.06
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 97.01
PLN02979366 glycolate oxidase 96.93
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 96.92
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 96.9
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 96.86
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 96.83
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 96.8
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 96.7
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 96.69
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 96.68
PRK11572248 copper homeostasis protein CutC; Provisional 96.67
COG3142241 CutC Uncharacterized protein involved in copper re 96.66
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 96.65
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 96.65
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.62
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 96.6
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 96.59
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 96.58
PRK00507221 deoxyribose-phosphate aldolase; Provisional 96.54
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 96.54
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 96.53
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 96.43
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 96.36
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 96.32
PRK13523337 NADPH dehydrogenase NamA; Provisional 96.28
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.23
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 96.15
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 96.13
PRK13585 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.11
PRK05835307 fructose-bisphosphate aldolase; Provisional 96.1
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.08
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 96.07
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.07
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.01
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 95.98
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 95.97
PRK13587 234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.96
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 95.93
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 95.89
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 95.89
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 95.85
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 95.82
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 95.8
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 95.75
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 95.74
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 95.73
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 95.7
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.68
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 95.63
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.61
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 95.61
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.57
PRK14024 241 phosphoribosyl isomerase A; Provisional 95.53
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 95.49
COG1411229 Uncharacterized protein related to proFAR isomeras 95.49
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 95.48
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 95.45
PRK07084321 fructose-bisphosphate aldolase; Provisional 95.4
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 95.4
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 95.37
PLN02826409 dihydroorotate dehydrogenase 95.36
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 95.34
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 95.33
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.27
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 95.24
PRK01362214 putative translaldolase; Provisional 95.08
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.07
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 94.98
PRK14565237 triosephosphate isomerase; Provisional 94.95
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 94.91
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 94.9
PRK12655220 fructose-6-phosphate aldolase; Reviewed 94.87
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 94.87
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.82
TIGR00007 230 phosphoribosylformimino-5-aminoimidazole carboxami 94.78
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 94.76
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 94.71
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 94.68
PLN02411391 12-oxophytodienoate reductase 94.64
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 94.64
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.63
PLN02274505 inosine-5'-monophosphate dehydrogenase 94.43
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 94.42
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 94.42
PRK12653220 fructose-6-phosphate aldolase; Reviewed 94.29
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 94.23
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.17
TIGR03586327 PseI pseudaminic acid synthase. 94.12
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.11
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 94.06
PLN02446 262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 94.04
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 94.01
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 93.92
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 93.89
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 93.85
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 93.81
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.78
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 93.77
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 93.64
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 93.28
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 93.26
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 93.25
PRK14114 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.14
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 93.14
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 93.06
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 93.04
TIGR01306 321 GMP_reduct_2 guanosine monophosphate reductase, ba 93.02
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 93.02
PRK12656222 fructose-6-phosphate aldolase; Reviewed 92.94
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 92.85
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 92.75
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 92.73
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 92.71
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 92.63
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 92.52
PRK00042250 tpiA triosephosphate isomerase; Provisional 92.44
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 92.38
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 92.35
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 92.18
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 92.15
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.12
COG3684306 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydr 92.08
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 92.04
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 91.99
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 91.95
PRK15492260 triosephosphate isomerase; Provisional 91.91
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 91.9
PRK14567253 triosephosphate isomerase; Provisional 91.89
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 91.81
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 91.81
COG0826 347 Collagenase and related proteases [Posttranslation 91.73
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 91.68
TIGR01919 243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 91.57
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 91.55
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 91.5
PLN02617 538 imidazole glycerol phosphate synthase hisHF 91.5
PRK07188352 nicotinate phosphoribosyltransferase; Provisional 91.42
PRK07094323 biotin synthase; Provisional 91.42
PRK09197350 fructose-bisphosphate aldolase; Provisional 91.36
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 91.31
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 91.31
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 91.28
KOG4202227 consensus Phosphoribosylanthranilate isomerase [Am 91.25
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 91.22
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 91.17
PLN02591250 tryptophan synthase 91.16
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 91.1
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 91.04
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 90.95
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 90.88
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.88
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 90.75
PLN02429315 triosephosphate isomerase 90.39
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 90.35
PRK13586 232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.32
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 90.29
PRK01261229 aroD 3-dehydroquinate dehydratase; Provisional 90.27
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 90.12
PRK12399324 tagatose 1,6-diphosphate aldolase; Reviewed 90.05
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 90.01
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 89.99
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 89.98
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 89.86
KOG0538363 consensus Glycolate oxidase [Energy production and 89.61
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 89.34
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 89.34
PRK04147293 N-acetylneuraminate lyase; Provisional 89.33
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 89.28
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 88.8
TIGR01496257 DHPS dihydropteroate synthase. This model represen 88.67
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 88.64
PF04481 242 DUF561: Protein of unknown function (DUF561); Inte 88.62
PRK11572 248 copper homeostasis protein CutC; Provisional 88.53
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 88.5
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 88.3
PRK15452 443 putative protease; Provisional 88.16
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 88.16
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 88.12
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 88.07
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 88.01
PLN028581378 fructose-bisphosphate aldolase 87.99
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 87.93
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 87.85
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 87.67
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 87.51
PTZ00333255 triosephosphate isomerase; Provisional 87.33
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 87.18
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 87.17
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carb 87.07
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 87.07
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 87.03
PLN02535364 glycolate oxidase 87.02
PLN02979366 glycolate oxidase 86.96
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 86.85
PRK12331 448 oxaloacetate decarboxylase; Provisional 86.71
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 86.42
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 86.13
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 86.12
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 85.88
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 85.66
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 85.41
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 85.33
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 85.17
PRK06256336 biotin synthase; Validated 85.12
PRK02227 238 hypothetical protein; Provisional 84.98
PRK04161329 tagatose 1,6-diphosphate aldolase; Reviewed 84.98
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 84.93
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information 
Probab=100.00  E-value=2.2e-81  Score=661.67  Aligned_cols=497  Identities=77%  Similarity=1.160  Sum_probs=446.2

Q ss_pred             cccCCCCCeEEEEecCCCCChhcHHHHHHHHHHcCceeeecceEeeeecCCCeeeeEecCHHHHHHHHHHHHcCCCcCEE
Q 010244           14 EQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVV   93 (514)
Q Consensus        14 ~~~k~~~~~vL~i~g~d~~ggag~~a~~~~l~~~g~~~~~~~t~~~~~n~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~i   93 (514)
                      .+.+|++++||+|+|||++||||++||++++.++|+++++++|+++.||+.++..+.++|++++.+|++.+++++++++|
T Consensus         3 ~~~~~~~~~vL~IaGsD~~gGAGi~aDl~t~~a~G~~~~~v~Talt~q~t~~v~~~~~~~~~~~~~ql~~~~~d~~~~ai   82 (502)
T PLN02898          3 TESPMKVPHVLTVAGSDSGAGAGIQADIKACAARGVYCTTAITAVTAQNTVGVQGVHAVPLDFVAEQLKSVLSDMPVDVV   82 (502)
T ss_pred             cCCCCCCCeEEEEeeeCCCcHHHHHHHHHHHHHcCCEecceeeEEEEEcCCccceeeeCCHHHHHHHHHHHHhCCCCCEE
Confidence            45678899999999999999999999999999999999999999999999999889999999999999999999999999


Q ss_pred             EEcccCCHHHHHHHHHHHhcCCCCcEEEecceecCCCCCCCChhHHHHHHHhhcccceEEcCCHHHHHHhhCCCCCCCHH
Q 010244           94 KTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVA  173 (514)
Q Consensus        94 ~~G~~~~~~~~~~~~~~~~~~~~~~ivlDPv~~~~~g~~~~~~~~~~~l~~~ll~~~diitpN~~E~~~L~g~~~~~~~~  173 (514)
                      ++||+.+.++++.+.+++++++.+++|+||||.+++|..+++++..+.+++++++.+|+||||..|++.|+|.....+.+
T Consensus        83 k~G~l~~~~~i~~i~~~l~~~~~~~vVlDPV~~~~~G~~l~~~~~~~~l~~~Ll~~adiitPN~~Ea~~L~g~~~~~~~~  162 (502)
T PLN02898         83 KTGMLPSAEIVKVLCQALKEFPVKALVVDPVMVSTSGDVLAGPSILSALREELLPLATIVTPNVKEASALLGGDPLETVA  162 (502)
T ss_pred             EECCcCCHHHHHHHHHHHHhCCCCCEEEccccccCCCCccCCHHHHHHHHHhhhccCeEEcCCHHHHHHHhCCCCCCCHH
Confidence            99999999999999999988766469999999999999999988888888789999999999999999999844556677


Q ss_pred             HHHHHHHHHHhcCCCeEEEecccCCCCCCceEEEEeCCeEEEEeecccCCCCCCCCcchHHHHHHHHHHcCCCHHHHHHH
Q 010244          174 DMCSAAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKV  253 (514)
Q Consensus       174 ~~~~~a~~l~~~g~~~Vvvt~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~~d~~GaGD~f~a~i~~~l~~g~~l~~A~~~  253 (514)
                      ++.++++++.++|++.|+||+|+.+......++++++++.++++.++++..+++||||+|+|+|+++|++|+++++|++.
T Consensus       163 ~~~~~a~~l~~~G~~~VvItgg~~~~~~~~~~~l~~~~~~~~~~~~~i~~~~t~GaGD~fsaaiaa~l~~G~~l~eAv~~  242 (502)
T PLN02898        163 DMRSAAKELHKLGPRYVLVKGGHLPDSLDAVDVLYDGTEFHELRSSRIKTRNTHGTGCTLASCIAAELAKGSDMLSAVKV  242 (502)
T ss_pred             HHHHHHHHHHhcCCCEEEEcCCCCCCCCcceEEEEcCCeEEEEecceeCCCCCCchhhhHHHHHHHHHHcCCCHHHHHHH
Confidence            88899999999999999999998642223345677766666778878887899999999999999999999999999999


Q ss_pred             HHHHHHHHHhcccccccCCCCCCCccccccccccccccccccccCCCCceEEEEeCCCCCccCCCCHHHHHHHHHhCCCC
Q 010244          254 AKCFVETALDYSKDIVIGSGPQGPFDHLLRLKSTSRQSHRAEAFNPSDLFLYAVTDSGMNKKWGRSITDAVKAALEGGAT  333 (514)
Q Consensus       254 A~~~~~~~i~~~~~~~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ly~it~~~~~~~~~~~~~~~~~~~~~~Gv~  333 (514)
                      |..+++.+|+.+.+.+.|+|..+|++|++.+.....+....+.|.|.++++|+|||+..+..+.+++.+.+++++++|++
T Consensus       243 A~~~v~~ai~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ly~it~~~~~~~~~~~~~~~l~~~l~~Gv~  322 (502)
T PLN02898        243 AKRYVETALEYSKDIGIGNGAQGPFNHLFFLKSWAKKSSRQSRFNPRNLFLYAVTDSGMNKKWGRSTVDAVRAAIEGGAT  322 (502)
T ss_pred             HHHHHHHHHHhhhccCCCCCCCCChhhhhhhhcccccccccccCCcCCceEEEEECccccccccchHHHHHHHHHHcCCC
Confidence            99999999999876655666567889987775444333334567888899999999865322235688899999999999


Q ss_pred             EEEEEcCCCCHHHHHHHHHHHHHHHhhcCceEEEcCcHHHHHhCCCCeEEeCCCCCCHHHHHhhcCCCcEEEEecCCHHH
Q 010244          334 IIQLREKDADTRGFLEAAKACLQICCVHGVPLLINDRIDIALACDADGVHLGQSDMPARTARALLGPDKIIGVSCKTPEE  413 (514)
Q Consensus       334 ~v~lr~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~~~~~~a~~~ga~gvhl~~~~~~~~~~~~~~~~~~~ig~s~~~~~e  413 (514)
                      +||||+|+.+.+++.++++++.++|+++++++++|+++++|.+.|+||||+++.+++....|+.++++.++|.||||.+|
T Consensus       323 ~vqlR~k~~~~~~~~~~a~~l~~~~~~~~~~liind~~~lA~~~~adGvHl~~~d~~~~~~r~~~~~~~~iG~S~h~~~e  402 (502)
T PLN02898        323 IVQLREKEAETREFIEEAKACLAICRSYGVPLLINDRVDVALACDADGVHLGQSDMPVRLARSLLGPGKIIGVSCKTPEQ  402 (502)
T ss_pred             EEEEccCCCCHHHHHHHHHHHHHHHHHhCCEEEEcChHHHHHhcCCCEEEeChHhcCHHHHHHhcCCCCEEEEeCCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999888889888889999999999999


Q ss_pred             HHHhhhCCCcEEEeccccCCCCCCCCccCCHHHHHHHHHcCCCCEEEECCCCcccHHHHHHCCCCCCceEEEeecccCCC
Q 010244          414 AHQAWIDGANYIGCGGVYPTNTKANNLTVGLDGLKTVCLASKLPVVAIGGIGISNASDVMKIGVSNLKGVAVVSALFDRE  493 (514)
Q Consensus       414 ~~~a~~~g~d~v~~~~vf~t~~k~~~~~~g~~~l~~~~~~~~~pv~a~GGi~~~~~~~~~~~Ga~~~~gva~~~~i~~~~  493 (514)
                      +++|.+.|+|||++||+|+|.+||..+++|++.++++++.+++||+|+|||+++|+.+++++|+++.||||++|+||+++
T Consensus       403 ~~~a~~~gadyi~~gpif~t~tk~~~~~~g~~~~~~~~~~~~~Pv~aiGGI~~~~~~~~~~~G~~~~~gvav~~~i~~~~  482 (502)
T PLN02898        403 AEQAWKDGADYIGCGGVFPTNTKANNKTIGLDGLREVCEASKLPVVAIGGISASNAASVMESGAPNLKGVAVVSALFDQE  482 (502)
T ss_pred             HHHHhhcCCCEEEECCeecCCCCCCCCCCCHHHHHHHHHcCCCCEEEECCCCHHHHHHHHHcCCCcCceEEEEeHHhcCC
Confidence            99999999999999999999999998889999999999988999999999999999999999888888999999999999


Q ss_pred             CHHHHHHHHHHHHHHHh
Q 010244          494 CILPESKKLHAVLMDAV  510 (514)
Q Consensus       494 ~~~~~~~~~~~~~~~~~  510 (514)
                      ||.+.++++++.+.+..
T Consensus       483 d~~~~~~~~~~~~~~~~  499 (502)
T PLN02898        483 DVLKATRKLHAILTEAL  499 (502)
T ss_pred             CHHHHHHHHHHHHHHHh
Confidence            99999999999988743

>COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Back     alignment and domain information
>KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] Back     alignment and domain information
>PRK12616 pyridoxal kinase; Reviewed Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00493 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK12412 pyridoxal kinase; Reviewed Back     alignment and domain information
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK06427 bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed Back     alignment and domain information
>PF08543 Phos_pyr_kin: Phosphomethylpyrimidine kinase; InterPro: IPR013749 This enzyme 2 Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd01169 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 Back     alignment and domain information
>PTZ00347 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK08573 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK12413 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>cd01173 pyridoxal_pyridoxamine_kinase Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP Back     alignment and domain information
>PRK08176 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed Back     alignment and domain information
>PRK05756 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK07105 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>COG2240 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR00687 pyridox_kin pyridoxal kinase Back     alignment and domain information
>KOG2599 consensus Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00344 pyridoxal kinase; Provisional Back     alignment and domain information
>PLN02978 pyridoxal kinase Back     alignment and domain information
>cd01171 YXKO-related B Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00196 yjeF_cterm yjeF C-terminal region, hydroxyethylthiazole kinase-related Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK10565 putative carbohydrate kinase; Provisional Back     alignment and domain information
>COG0063 Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01256 Carb_kinase: Carbohydrate kinase; InterPro: IPR000631 This family is related to Hydroxyethylthiazole kinase IPR000417 from INTERPRO and PfkB carbohydrate kinase IPR011611 from INTERPRO implying that it also a carbohydrate kinase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR00694 thiM hydroxyethylthiazole kinase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>cd01170 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK09355 hydroxyethylthiazole kinase; Validated Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>PLN02323 probable fructokinase Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PLN02967 kinase Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3974 consensus Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism] Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PF02110 HK: Hydroxyethylthiazole kinase family; InterPro: IPR000417 Thiamine pyrophosphate (TPP), a required cofactor for many enzymes in the cell, is synthesised de novo in Salmonella typhimurium [] Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG3684 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG4202 consensus Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>PRK12399 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK04161 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
1jxh_A288 4-Amino-5-Hydroxymethyl-2-Methylpyrimidine Phosphat 8e-52
2i5b_A271 The Crystal Structure Of An Adp Complex Of Bacillus 2e-46
1xi3_A215 Thiamine Phosphate Pyrophosphorylase From Pyrococcu 1e-38
1ub0_A258 Crystal Structure Analysis Of Phosphomethylpyrimidi 3e-38
3rm5_A550 Structure Of Trifunctional Thi20 From Yeast Length 5e-34
3nl2_A 540 The Crystal Structure Of Candida Glabrata Thi6, A B 1e-32
3nm1_A 540 The Crystal Structure Of Candida Glabrata Thi6, A B 1e-32
3o15_A235 Crystal Structure Of Bacillus Subtilis Thiamin Phos 2e-27
2tps_A227 Thiamin Phosphate Synthase Length = 227 3e-27
1g4p_A226 Thiamin Phosphate Synthase Length = 226 6e-27
1g67_A225 Thiamin Phosphate Synthase Length = 225 7e-27
1g4e_A227 Thiamin Phosphate Synthase Length = 227 7e-27
1g69_A228 Thiamin Phosphate Synthase Length = 228 7e-27
3o16_A235 Crystal Structure Of Bacillus Subtilis Thiamin Phos 1e-26
3o63_A243 Crystal Structure Of Thiamin Phosphate Synthase Fro 1e-15
1yad_A221 Structure Of Teni From Bacillus Subtilis Length = 2 2e-08
2f7k_A327 Crystal Structure Of Human Pyridoxal Kinase Length 2e-06
2yxt_A312 Human Pyridoxal Kinase Length = 312 2e-06
3fhx_A312 Crystal Structure Of D235a Mutant Of Human Pyridoxa 2e-06
3fhy_A312 Crystal Structure Of D235n Mutant Of Human Pyridoxa 2e-06
3zs7_A300 Crystal Structure Of Pyridoxal Kinase From Trypanos 3e-06
2ajp_A326 Crystal Structure Of A Human Pyridoxal Kinase Lengt 3e-06
1lhp_A312 Crystal Structure Of Pyridoxal Kinase From Sheep Br 4e-06
2ddm_A283 Crystal Structure Of Pyridoxal Kinase From The Esch 8e-06
3mbj_A291 Crystal Structure Of A Putative Phosphomethylpyrimi 4e-04
1rk2_A309 E. Coli Ribokinase Complexed With Ribose And Adp, S 5e-04
>pdb|1JXH|A Chain A, 4-Amino-5-Hydroxymethyl-2-Methylpyrimidine Phosphate Kinase From Salmonella Typhimurium Length = 288 Back     alignment and structure 
Iteration: 1

 Score =  201 bits (511), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 155/265 (58%), Gaps = 2/265 (0%)
Query: 17  KMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDF 76
            M+  + LT+AG+D   GAGIQADLK  +A G Y  +VITA+ A+NT GVQ V  +  DF
Sbjct: 22  HMQRINALTIAGTDPSGGAGIQADLKTFSALGAYGCSVITALVAENTCGVQSVYRIEPDF 81
Query: 77  VAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGP 136
           VAAQL SV SD+++D  K GML  TD+V+ + + L    VR +V+D VM++ SGD L  P
Sbjct: 82  VAAQLDSVFSDVRIDTTKIGMLAETDIVEAVAERLQRHHVRNVVLDTVMLAKSGDPLLSP 141
Query: 137 STITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGD 196
           S I  LR  LLP   ++TPN+ EA+ALL      T  +M +  + L  +G   VL+KGG 
Sbjct: 142 SAIETLRVRLLPQVSLITPNLPEAAALLDAPHARTEQEMLAQGRALLAMGCEAVLMKGGH 201
Query: 197 LPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKC 256
           L D+    D  F  E      + RVNT+NTHGTGCTL++ +AA   +       V  AK 
Sbjct: 202 LEDAQSP-DWLFTREGEQRFSAPRVNTKNTHGTGCTLSAALAALRPRHRSWGETVNEAKA 260
Query: 257 FVETALDYSKDIVIGSGPQGPFDHL 281
           ++  AL  +  + +G G  GP  H 
Sbjct: 261 WLSAALAQADTLEVGKGI-GPVHHF 284
>pdb|2I5B|A Chain A, The Crystal Structure Of An Adp Complex Of Bacillus Subtilis Pyridoxal Kinase Provides Evidence For The Parralel Emergence Of Enzyme Activity During Evolution Length = 271 Back     alignment and structure
>pdb|1XI3|A Chain A, Thiamine Phosphate Pyrophosphorylase From Pyrococcus Furiosus Pfu-1255191-001 Length = 215 Back     alignment and structure
>pdb|1UB0|A Chain A, Crystal Structure Analysis Of Phosphomethylpyrimidine Kinase (Thid) From Thermus Thermophilus Hb8 Length = 258 Back     alignment and structure
>pdb|3RM5|A Chain A, Structure Of Trifunctional Thi20 From Yeast Length = 550 Back     alignment and structure
>pdb|3NL2|A Chain A, The Crystal Structure Of Candida Glabrata Thi6, A Bifunctional Enzyme Involved In Thiamin Biosyhthesis Of Eukaryotes Length = 540 Back     alignment and structure
>pdb|3NM1|A Chain A, The Crystal Structure Of Candida Glabrata Thi6, A Bifunctional Enzyme Involved In Thiamin Biosyhthesis Of Eukaryotes Length = 540 Back     alignment and structure
>pdb|3O15|A Chain A, Crystal Structure Of Bacillus Subtilis Thiamin Phosphate Synthase Complexed With A Carboxylated Thiazole Phosphate Length = 235 Back     alignment and structure
>pdb|2TPS|A Chain A, Thiamin Phosphate Synthase Length = 227 Back     alignment and structure
>pdb|1G4P|A Chain A, Thiamin Phosphate Synthase Length = 226 Back     alignment and structure
>pdb|1G67|A Chain A, Thiamin Phosphate Synthase Length = 225 Back     alignment and structure
>pdb|1G4E|A Chain A, Thiamin Phosphate Synthase Length = 227 Back     alignment and structure
>pdb|1G69|A Chain A, Thiamin Phosphate Synthase Length = 228 Back     alignment and structure
>pdb|3O16|A Chain A, Crystal Structure Of Bacillus Subtilis Thiamin Phosphate Synthase K159a Length = 235 Back     alignment and structure
>pdb|3O63|A Chain A, Crystal Structure Of Thiamin Phosphate Synthase From Mycobacterium Tuberculosis Length = 243 Back     alignment and structure
>pdb|1YAD|A Chain A, Structure Of Teni From Bacillus Subtilis Length = 221 Back     alignment and structure
>pdb|2F7K|A Chain A, Crystal Structure Of Human Pyridoxal Kinase Length = 327 Back     alignment and structure
>pdb|2YXT|A Chain A, Human Pyridoxal Kinase Length = 312 Back     alignment and structure
>pdb|3FHX|A Chain A, Crystal Structure Of D235a Mutant Of Human Pyridoxal Kinase Length = 312 Back     alignment and structure
>pdb|3FHY|A Chain A, Crystal Structure Of D235n Mutant Of Human Pyridoxal Kinase Length = 312 Back     alignment and structure
>pdb|3ZS7|A Chain A, Crystal Structure Of Pyridoxal Kinase From Trypanosoma Brucei Length = 300 Back     alignment and structure
>pdb|2AJP|A Chain A, Crystal Structure Of A Human Pyridoxal Kinase Length = 326 Back     alignment and structure
>pdb|1LHP|A Chain A, Crystal Structure Of Pyridoxal Kinase From Sheep Brain Length = 312 Back     alignment and structure
>pdb|2DDM|A Chain A, Crystal Structure Of Pyridoxal Kinase From The Escherichia Coli Pdxk Gene At 2.1 A Resolution Length = 283 Back     alignment and structure
>pdb|3MBJ|A Chain A, Crystal Structure Of A Putative Phosphomethylpyrimidine Kinase (Bt_4458) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.10 A Resolution (Rhombohedral Form) Length = 291 Back     alignment and structure
>pdb|1RK2|A Chain A, E. Coli Ribokinase Complexed With Ribose And Adp, Solved In Space Group P212121 Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
1jxh_A288 Phosphomethylpyrimidine kinase; THID, ribokinase f 1e-134
2i5b_A271 Phosphomethylpyrimidine kinase; ADP complex, PDXK, 1e-131
3rm5_A550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 1e-127
1ub0_A258 THID, phosphomethylpyrimidine kinase; thiamin bios 1e-125
3h74_A282 Pyridoxal kinase; PSI-II, structural genomics, pro 5e-92
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 2e-84
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 7e-82
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 3e-79
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 4e-79
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 3e-78
3nl6_A540 Thiamine biosynthetic bifunctional enzyme; thiamin 3e-07
2ddm_A283 Pyridoxine kinase; pyridoxal kinase, ribokinase, p 1e-69
3mbh_A291 Putative phosphomethylpyrimidine kinase; structura 2e-66
3pzs_A289 PM kinase, pyridoxamine kinase; structural genomic 9e-64
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 5e-58
3zs7_A300 Pyridoxal kinase; transferase, sleeping sickness; 7e-52
2yxt_A312 Pyridoxal kinase; beta sheet with alpha helix, met 2e-49
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 1e-09
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 2e-09
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 2e-09
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 2e-09
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 7e-08
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 1e-07
2fv7_A331 Ribokinase; structural genomics, structural genomi 5e-07
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 2e-05
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 6e-05
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 1e-04
2ajr_A331 Sugar kinase, PFKB family; TM0828, possible 1-phos 1e-04
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 2e-04
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 2e-04
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 3e-04
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 6e-04
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 7e-04
>1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* Length = 288 Back     alignment and structure
 Score =  389 bits (1003), Expect = e-134
 Identities = 115/277 (41%), Positives = 159/277 (57%), Gaps = 2/277 (0%)

Query: 8   ASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQ 67
           +S    +   M+  + LT+AG+D   GAGIQADLK  +A G Y  +VITA+ A+NT GVQ
Sbjct: 13  SSGYHIQGRHMQRINALTIAGTDPSGGAGIQADLKTFSALGAYGCSVITALVAENTCGVQ 72

Query: 68  GVNIVPEDFVAAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVS 127
            V  +  DFVAAQL SV SD+++D  K GML  TD+V+ + + L    VR +V+D VM++
Sbjct: 73  SVYRIEPDFVAAQLDSVFSDVRIDTTKIGMLAETDIVEAVAERLQRHHVRNVVLDTVMLA 132

Query: 128 TSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGP 187
            SGD L  PS I  LR  LLP   ++TPN+ EA+ALL      T  +M +  + L  +G 
Sbjct: 133 KSGDPLLSPSAIETLRVRLLPQVSLITPNLPEAAALLDAPHARTEQEMLAQGRALLAMGC 192

Query: 188 RTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPM 247
             VL+KGG L D + + D  F  E      + RVNT+NTHGTGCTL++ +AA   +    
Sbjct: 193 EAVLMKGGHLED-AQSPDWLFTREGEQRFSAPRVNTKNTHGTGCTLSAALAALRPRHRSW 251

Query: 248 LSAVKVAKCFVETALDYSKDIVIGSGPQGPFDHLLRL 284
              V  AK ++  AL  +  + +G G  GP  H    
Sbjct: 252 GETVNEAKAWLSAALAQADTLEVGKG-IGPVHHFHAW 287
>2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Length = 550 Back     alignment and structure
>1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 Length = 258 Back     alignment and structure
>3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Length = 282 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Length = 215 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Length = 221 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Length = 243 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Length = 227 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Length = 540 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Length = 540 Back     alignment and structure
>2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Length = 283 Back     alignment and structure
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* Length = 291 Back     alignment and structure
>3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} PDB: 1td2_A* 1vi9_A* Length = 289 Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Length = 210 Back     alignment and structure
>3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} Length = 300 Back     alignment and structure
>2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* Length = 312 Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Length = 317 Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Length = 311 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Length = 309 Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Length = 325 Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Length = 304 Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Length = 331 Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Length = 330 Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Length = 323 Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Length = 306 Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Length = 331 Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Length = 306 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Length = 343 Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Length = 309 Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} PDB: 3k9e_A Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
3rm5_A550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 100.0
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 100.0
3h74_A282 Pyridoxal kinase; PSI-II, structural genomics, pro 100.0
2i5b_A271 Phosphomethylpyrimidine kinase; ADP complex, PDXK, 100.0
3mbh_A291 Putative phosphomethylpyrimidine kinase; structura 100.0
1ub0_A258 THID, phosphomethylpyrimidine kinase; thiamin bios 100.0
3pzs_A289 PM kinase, pyridoxamine kinase; structural genomic 100.0
1jxh_A288 Phosphomethylpyrimidine kinase; THID, ribokinase f 100.0
3zs7_A300 Pyridoxal kinase; transferase, sleeping sickness; 100.0
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 100.0
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 100.0
2ddm_A283 Pyridoxine kinase; pyridoxal kinase, ribokinase, p 99.97
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 99.96
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.96
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.95
3bgk_A311 SMU.573, putative uncharacterized protein; alpha/b 99.95
2r3b_A310 YJEF-related protein; putative kinase in the ribok 99.95
2yxt_A312 Pyridoxal kinase; beta sheet with alpha helix, met 99.94
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 99.92
3rpz_A279 ADP/ATP-dependent NAD(P)H-hydrate dehydratase; str 99.92
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 99.91
3rss_A502 Putative uncharacterized protein; unknown function 99.91
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 99.9
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 99.89
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.86
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 99.86
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 99.85
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 99.82
3k5w_A475 Carbohydrate kinase; 11206B,helicobacter pylori,PS 99.82
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 99.82
2fv7_A331 Ribokinase; structural genomics, structural genomi 99.82
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 99.81
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 99.8
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 99.78
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 99.78
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 99.77
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 99.77
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 99.77
4e84_A352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 99.77
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 99.77
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 99.77
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 99.76
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 99.76
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 99.76
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 99.75
3cqd_A309 6-phosphofructokinase isozyme 2; phosphofructokina 99.75
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 99.75
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 99.75
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 99.75
3umo_A309 6-phosphofructokinase isozyme 2; glycolysis, trans 99.74
3ie7_A320 LIN2199 protein; phosphofructokinases, transferase 99.74
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 99.74
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 99.74
3dzv_A273 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_ 99.73
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 99.72
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 99.72
3vas_A370 Putative adenosine kinase; ribokinase, enzyme, tra 99.72
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 99.71
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 99.71
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 99.71
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 99.71
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 99.7
2ajr_A331 Sugar kinase, PFKB family; TM0828, possible 1-phos 99.7
1ekq_A272 Hydroxyethylthiazole kinase; alpha-beta, transfera 99.69
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 99.69
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 99.69
3otx_A347 Adenosine kinase, putative; AP5A, transferase-tran 99.69
1bx4_A345 Protein (adenosine kinase); human adenosine kinase 99.68
3loo_A365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 99.68
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 99.68
1v8a_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 99.67
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 99.67
3ikh_A299 Carbohydrate kinase; transferase,kinase,SAD,ribose 99.67
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 99.67
2abs_A383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 99.67
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 99.66
4e3a_A352 Sugar kinase protein; structural genomics, protein 99.66
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 99.65
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 99.64
3go6_A310 Ribokinase RBSK; phosphofructokinase, carbohydrate 99.64
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 99.63
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 99.62
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.61
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 99.6
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.6
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.59
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 99.59
4gm6_A351 PFKB family carbohydrate kinase; enzyme function i 99.59
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 99.59
3uq6_A372 Adenosine kinase, putative; ribokinase, transferas 99.59
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 99.58
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 99.57
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 99.57
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.57
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 99.57
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 99.57
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 99.56
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 99.56
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.55
3nl6_A540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.55
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.54
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.52
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.51
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.5
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.5
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.48
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.47
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.47
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 99.47
3bf5_A306 Ribokinase related protein; 10640157, putative rib 99.46
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.45
3hpd_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 99.45
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 99.44
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 99.43
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.41
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.4
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.35
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.34
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.3
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 99.29
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 99.27
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 99.27
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 99.27
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.23
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.23
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 99.23
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 99.22
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.1
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.0
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 98.99
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 98.95
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 98.93
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 98.8
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.78
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 98.76
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.75
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.75
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.72
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 98.69
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.65
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 98.65
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 98.61
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 98.61
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.57
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.55
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 98.51
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 98.49
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 98.41
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 98.39
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.39
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 98.38
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 98.38
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 98.38
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 98.36
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.34
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 98.33
3tha_A252 Tryptophan synthase alpha chain; structural genomi 98.31
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 98.31
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.3
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 98.28
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.26
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 98.23
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 98.2
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.18
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 98.16
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 98.12
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 98.05
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.01
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.01
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.97
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.91
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 97.91
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.89
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.88
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 97.85
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 97.84
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 97.83
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.83
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 97.81
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 97.78
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 97.75
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 97.73
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 97.73
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 97.69
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 97.68
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 97.68
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.65
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 97.62
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 97.62
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 97.61
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.61
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 97.6
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.58
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 97.55
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 97.54
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.51
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.51
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 97.51
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.48
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 97.47
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 97.42
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.39
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 97.39
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.37
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 97.35
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 97.32
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 97.31
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 97.3
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.28
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 97.21
3oa3_A288 Aldolase; structural genomics, seattle structural 97.17
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 97.17
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 97.16
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.15
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 97.15
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.12
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 97.11
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.1
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.08
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 97.05
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 97.03
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 96.91
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 96.86
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.86
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 96.85
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 96.79
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.76
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 96.76
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 96.67
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 96.67
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 96.64
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 96.57
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 96.56
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 96.53
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 96.52
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 96.47
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.45
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 96.37
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 96.36
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 96.32
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 96.24
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 96.16
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 96.11
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.07
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.06
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 96.04
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 96.04
1ka9_F 252 Imidazole glycerol phosphtate synthase; riken stru 96.03
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 96.03
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 96.0
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 95.95
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 95.91
1thf_D 253 HISF protein; thermophIle, TIM-barrel, histidine b 95.87
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 95.83
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 95.76
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 95.76
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 95.75
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.56
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 95.5
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 95.47
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 95.4
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 95.38
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 95.22
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 95.18
1h5y_A 253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 95.16
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 95.06
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 95.01
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 94.74
1qo2_A 241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 94.72
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 94.71
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 94.63
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 94.56
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 94.36
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 94.29
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 94.27
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 94.23
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.16
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 94.01
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 94.01
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.84
1vzw_A 244 Phosphoribosyl isomerase A; histidine biosynthesis 93.64
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 93.55
2agk_A 260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 93.12
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.01
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 92.98
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 92.98
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 92.85
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 92.83
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 92.66
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 92.59
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 92.56
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.49
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 92.31
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 92.16
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 92.16
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 91.96
3qw4_B 453 UMP synthase; N-terminal orotidine monophosphate d 91.85
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 91.85
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 91.75
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.74
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 91.72
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 91.51
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 91.37
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 91.21
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 91.18
2p0o_A 372 Hypothetical protein DUF871; structural genomics, 91.13
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 90.89
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 90.86
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 90.8
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 90.44
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 90.4
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 90.38
1dos_A358 Aldolase class II; lyase, classii fructose 1,6-bis 90.32
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 90.19
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 90.18
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 90.08
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 90.0
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 89.92
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 89.88
1x7f_A 385 Outer surface protein; structural genomics, unknow 89.75
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 89.73
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 89.68
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 89.52
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 89.39
2fli_A 220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 89.22
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 89.14
3iwp_A 287 Copper homeostasis protein CUTC homolog; conserved 89.13
1yya_A250 Triosephosphate isomerase; riken structural genomi 89.11
3elf_A349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 89.08
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 88.96
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 88.88
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 88.71
3luf_A259 Two-component system response regulator/ggdef doma 88.53
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 88.33
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 88.23
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 88.2
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 88.1
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.93
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 87.32
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 87.19
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 87.08
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 87.0
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 86.69
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 86.52
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 86.51
2qr6_A 393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 86.48
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 86.36
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 86.33
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 86.2
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 86.08
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 85.98
1rpx_A 230 Protein (ribulose-phosphate 3-epimerase); chloropl 85.15
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 85.11
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 85.11
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 85.09
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 84.92
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 84.86
3eww_A260 Ompdecase, orotidine-5'-phosphate decarboxylase; T 84.85
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 84.84
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 84.78
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 84.75
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 84.69
3ble_A337 Citramalate synthase from leptospira interrogans; 84.58
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 84.57
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 84.56
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 84.56
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 84.48
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 84.4
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 84.3
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 84.25
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 84.09
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 84.05
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 84.05
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 83.67
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 83.66
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 83.36
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 83.17
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 83.09
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 83.01
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 82.88
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 82.84
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 82.84
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 82.71
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 82.59
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 82.56
3jte_A143 Response regulator receiver protein; structural ge 82.56
1twd_A 256 Copper homeostasis protein CUTC; TIM-like protein, 82.54
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 82.51
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 82.34
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 82.27
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 82.25
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 82.14
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 82.13
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 82.05
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 81.98
2fiq_A 420 Putative tagatose 6-phosphate kinase 1; structural 81.98
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 81.94
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 81.88
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 81.86
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 81.86
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 81.72
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 81.71
3drw_A474 ADP-specific phosphofructokinase; AMP, GLYC kinase 81.69
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 81.67
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 81.58
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 81.57
1izc_A339 Macrophomate synthase intermolecular diels-aldera; 81.57
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 81.55
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 81.49
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 81.41
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 81.24
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 81.21
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 81.15
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 81.09
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 80.83
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 80.81
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 80.51
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 80.5
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 80.47
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 80.46
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 80.43
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 80.35
3g3d_A312 UMP synthase, uridine 5'-monophosphate synthase; C 80.35
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 80.33
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 80.27
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 80.12
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.7e-41  Score=360.61  Aligned_cols=293  Identities=37%  Similarity=0.561  Sum_probs=240.4

Q ss_pred             cccccccccCCCCCeEEEEecCCCCChhcHHHHHHHHHHcCceeeecceEeeeecCCCeeeeEecCHHHHHHHHHHHHcC
Q 010244            8 ASATTTEQYKMKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSD   87 (514)
Q Consensus         8 ~~~r~~~~~k~~~~~vL~i~g~d~~ggag~~a~~~~l~~~g~~~~~~~t~~~~~n~~~~~~~~~~~~~~~~~~l~~l~~~   87 (514)
                      .|+....+|||++|+||+|+|||++||||++||+++|+++|+++++++|+++.||+.++..+..+|++++.+|++.++++
T Consensus        10 ~~~~~~~~~~~~~~~vL~IaGsd~~gGAgi~Adlktl~a~g~~~~~~~Tavt~q~~~~v~~~~~~p~~~v~~ql~~~~~d   89 (550)
T 3rm5_A           10 PPPYLTLACNEKLPTVLSIAGTDPSGGAGIEADVKTITAHRCYAMTCITALNAQTPVKVYSINNTPKEVVFQTLESNLKD   89 (550)
T ss_dssp             CCTTGGGGTTBCCCEEEEEEEBCTTSSSHHHHHHHHHHHTTCEEEEEEEEEEEECSSCEEEEEECCHHHHHHHHHHHHHH
T ss_pred             CCcccccccCCCCCEEEEEeCcCCCcHHHHHHHHHHHHHcCCeeceeceEEEeecCCCcceEEECCHHHHHHHHHHHHhC
Confidence            45666788999999999999999999999999999999999999999999999999999999899999999999999988


Q ss_pred             CCcCEEEEcccCCHHHHHHHHHHHhcC--CCCcEEEecceecCCCCCCCChhHHHHHHHhhcccceEEcCCHHHHHHhhC
Q 010244           88 MQVDVVKTGMLPSTDLVKVLLQSLSEF--PVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLG  165 (514)
Q Consensus        88 ~~~~~i~~G~~~~~~~~~~~~~~~~~~--~~~~ivlDPv~~~~~g~~~~~~~~~~~l~~~ll~~~diitpN~~E~~~L~g  165 (514)
                      .++|+|++||+ +.++++.+.+++++.  ..+++|+||||++++|..+++++..+.+++++++.++|||||..|++.|+|
T Consensus        90 ~~~daIkiG~l-s~~~i~~v~~~l~~~~~~~~~vVlDPvm~a~~g~~l~~~~~~~~l~~~Ll~~a~iitPN~~Ea~~L~g  168 (550)
T 3rm5_A           90 MKCNVIKTGML-TAAAIEVLHEKLLQLGENRPKLVVDPVLVATSGSSLAGKDIVSLITEKVAPFADILTPNIPECYKLLG  168 (550)
T ss_dssp             BCCSEEEECSC-CHHHHHHHHHHHHHHGGGSCEEEECCCC---------CTTHHHHHHHHTGGGCSEECCBHHHHHHHHS
T ss_pred             CCCCEEEECCC-CHHHHHHHHHHHHHhcccCCCEEEecceecCCCCcCCCHHHHHHHHHHhhCcceEEecCHHHHHHHhC
Confidence            89999999999 999999999998775  234599999999888888888888888887899999999999999999998


Q ss_pred             CC-CCCCHHHHHHHHHHHHhcCC-CeEEEecccCCCC----CCceEEEEe--CCeEEEEeecccCCCCCCCCcchHHHHH
Q 010244          166 GM-QVVTVADMCSAAKLLHNLGP-RTVLVKGGDLPDS----SDAVDIFFD--GEDFHELRSSRVNTRNTHGTGCTLASCI  237 (514)
Q Consensus       166 ~~-~~~~~~~~~~~a~~l~~~g~-~~Vvvt~g~~g~~----~~~~~~~~~--~~~~~~~~~~~~~~~d~~GaGD~f~a~i  237 (514)
                      .. .+.+.+++.+++++|.++|. +.|+||+|+.+..    ....++++.  +++.+.++.++++.++++|+||+|+|+|
T Consensus       169 ~~~~i~~~~d~~~aa~~L~~~g~~~~VvvkgG~~~~~g~~~~~~~d~l~~~~~~~~~~~~~~~v~~~~t~GtGD~fsaai  248 (550)
T 3rm5_A          169 EERKVNGLQDIFQIAKDLAKITKCSNILVKGGHIPWNDEKEKYITDVLFLGAEQKFIIFKGNFVNTTHTHGTGCTLASAI  248 (550)
T ss_dssp             CCCCCCSSHHHHHHHHHHHHHHCCSCEEEEECC-------CCEEEEEEEETTTTEEEEEEEECCCCSCCBTHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCEEEEeCCCCCcccCCCCeEEEEEEEcCCCeEEEEEecCcCCCCCcChhHHHHHHH
Confidence            42 35566788999999999887 7999999885311    113346774  5566778888888789999999999999


Q ss_pred             HHHHHcCCCHHHHHHHHHHHHHHHHhcccccccCCC-CCCCccccccccccccccccccccCCCC
Q 010244          238 AAELAKGSPMLSAVKVAKCFVETALDYSKDIVIGSG-PQGPFDHLLRLKSTSRQSHRAEAFNPSD  301 (514)
Q Consensus       238 ~~~l~~g~~l~~A~~~A~~~~~~~i~~~~~~~~g~g-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (514)
                      +++|++|.++.+|++.|+.+++.+|+.+..+..|.| .+||+||+..+.....++.+..++.+++
T Consensus       249 aa~La~G~~l~eAv~~A~~~v~~ai~~~~~~g~g~~~~~gp~~h~~~~~~~~~~~~~~~~~~~~~  313 (550)
T 3rm5_A          249 ASNLARGYSLPQSVYGGIEYVQNAVAIGCDVTKETVKDNGPINHVYAVEIPLEKMLSDECFTASD  313 (550)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHHHHHHHHCBCCBCTTCCSCCBCCTTTTCCCHHHHHHSCTTCCCCC
T ss_pred             HHHHHcCCCHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCcCchhhhcchhhhhcccccccccc
Confidence            999999999999999999999999999987643422 2789999988776555555545565544
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Back     alignment and structure
>2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} Back     alignment and structure
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* Back     alignment and structure
>1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 Back     alignment and structure
>3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A* Back     alignment and structure
>1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* Back     alignment and structure
>3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} Back     alignment and structure
>2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A Back     alignment and structure
>2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3rpz_A ADP/ATP-dependent NAD(P)H-hydrate dehydratase; structural genomics, PSI-biology; HET: AMP NPW; 1.51A {Bacillus subtilis} PDB: 3rph_A* 3rq2_A* 3rq5_A* 3rq6_A* 3rq8_A* 3rqh_A* 3rqq_A* 3rqx_A* 1kyh_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3rss_A Putative uncharacterized protein; unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydrat lyase; HET: NAP; 1.95A {Thermotoga maritima} PDB: 3rrb_A* 2ax3_A* 3rre_A* 3rrj_A* 3rs8_A* 3rs9_A* 3rsf_A* 3rsg_A* 3rrf_A* 3rsq_A* 3rt7_A* 3rt9_A* 3rta_A* 3rtb_A* 3rtc_A* 3rtd_A* 3rte_A* 3rtg_A* 3ru2_A* 3ru3_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>3k5w_A Carbohydrate kinase; 11206B,helicobacter pylori,PSI-II, NYSGXRC, , structural genomics, protein structure initiative; 2.60A {Helicobacter pylori} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>3dzv_A 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_816404.1, structural genomics, joint center for structural genomics, JCSG; HET: ADP; 2.57A {Enterococcus faecalis} Back     alignment and structure
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} PDB: 3hpd_A Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3hpd_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, ATP-binding, M metal-binding, nucleotide-binding, thiamine biosynthesis; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3eww_A Ompdecase, orotidine-5'-phosphate decarboxylase; TIM barrel, unusual catalysis, disease mutati glycosyltransferase, lyase, multifunctional enzyme; HET: U1P; 1.10A {Homo sapiens} PDB: 2qcl_A* 2qcm_A* 3ewu_A* 2qcf_A* 3ex6_A* 3ex4_A* 2qcd_A* 2qcc_A 2qcg_A* 2qch_A* 2qcn_A* 2qce_A* 3ewz_A* 3ex1_A* 3ex2_A* 3ex3_A* 3ex0_A* 3ex5_A* 3l0k_A* 3l0n_A* ... Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3drw_A ADP-specific phosphofructokinase; AMP, GLYC kinase, magnesium, metal-binding, transferase, structural G PSI-2, protein structure initiative; HET: AMP; 1.90A {Pyrococcus horikoshii} PDB: 1u2x_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3g3d_A UMP synthase, uridine 5'-monophosphate synthase; C-terminal domain, orotidine 5'-monophosphate decarboxylase, human, 5-fluoro-6-azido-UMP; HET: 5FU; 1.70A {Homo sapiens} PDB: 3bvj_A* 3mw7_A* 4hib_A* 4hkp_A* 2p1f_A 2eaw_A 3bgg_A* 3bgj_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 514
d1jxha_266 c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyri 1e-70
d1ub0a_258 c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyri 1e-62
d1vi9a_288 c.72.1.5 (A:) Pyridoxamine kinase {Escherichia col 9e-39
d1xi3a_206 c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon 2e-37
d1lhpa_309 c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) 2e-36
d2tpsa_226 c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus 2e-31
d1ekqa_269 c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kin 5e-14
d1v8aa_264 c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kin 3e-12
d1kyha_275 c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus 7e-09
d1rkda_306 c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 9e-08
d2ax3a1278 c.72.1.4 (A:212-489) Hypothetical protein TM0922, 2e-06
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 1e-05
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 1e-05
d1vm7a_299 c.72.1.1 (A:) Ribokinase {Thermotoga maritima [Tax 2e-04
>d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} Length = 266 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Thiamin biosynthesis kinases
domain: 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD)
species: Salmonella typhimurium [TaxId: 90371]

 Score =  224 bits (572), Expect = 1e-70
 Identities = 114/264 (43%), Positives = 156/264 (59%), Gaps = 2/264 (0%)

Query: 18  MKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFV 77
           M+  + LT+AG+D   GAGIQADLK  +A G Y  +VITA+ A+NT GVQ V  +  DFV
Sbjct: 1   MQRINALTIAGTDPSGGAGIQADLKTFSALGAYGCSVITALVAENTCGVQSVYRIEPDFV 60

Query: 78  AAQLKSVLSDMQVDVVKTGMLPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPS 137
           AAQL SV SD+++D  K GML  TD+V+ + + L    VR +V+D VM++ SGD L  PS
Sbjct: 61  AAQLDSVFSDVRIDTTKIGMLAETDIVEAVAERLQRHHVRNVVLDTVMLAKSGDPLLSPS 120

Query: 138 TITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCSAAKLLHNLGPRTVLVKGGDL 197
            I  LR  LLP   ++TPN+ EA+ALL      T  +M +  + L  +G   VL+KGG L
Sbjct: 121 AIETLRVRLLPQVSLITPNLPEAAALLDAPHARTEQEMLAQGRALLAMGCEAVLMKGGHL 180

Query: 198 PDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCF 257
            D + + D  F  E      + RVNT+NTHGTGCTL++ +AA   +       V  AK +
Sbjct: 181 ED-AQSPDWLFTREGEQRFSAPRVNTKNTHGTGCTLSAALAALRPRHRSWGETVNEAKAW 239

Query: 258 VETALDYSKDIVIGSGPQGPFDHL 281
           +  AL  +  + +G G  GP  H 
Sbjct: 240 LSAALAQADTLEVGKGI-GPVHHF 262
>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} Length = 258 Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Length = 288 Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Length = 206 Back     information, alignment and structure
>d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} Length = 309 Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Length = 269 Back     information, alignment and structure
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 264 Back     information, alignment and structure
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} Length = 275 Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Length = 306 Back     information, alignment and structure
>d2ax3a1 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 278 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d1jxha_266 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 100.0
d1ub0a_258 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 100.0
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 100.0
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 100.0
d1vi9a_288 Pyridoxamine kinase {Escherichia coli [TaxId: 562] 100.0
d1lhpa_309 Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940] 100.0
d1kyha_275 Hypothetical protein YxkO {Bacillus subtilis [TaxI 99.93
d2ax3a1278 Hypothetical protein TM0922, C-terminal domain {Th 99.91
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 99.71
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 99.7
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 99.69
d2abqa1306 Fructose 1-phosphate kinase FruB {Bacillus halodur 99.68
d2f02a1313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 99.66
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 99.62
d1ekqa_269 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ba 99.6
d2ajra1319 Putative sugar kinase TM0828 {Thermotoga maritima 99.57
d1v8aa_264 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ar 99.54
d1rkda_306 Ribokinase {Escherichia coli [TaxId: 562]} 99.53
d1v19a_302 2-keto-3-deoxygluconate kinase {Thermus thermophil 99.47
d2afba1333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 99.44
d1bx4a_342 Adenosine kinase {Human (Homo sapiens) [TaxId: 960 99.39
d1vk4a_288 Hypothetical protein TM0415 {Thermotoga maritima [ 99.38
d1vm7a_299 Ribokinase {Thermotoga maritima [TaxId: 2336]} 99.35
d2fv7a1308 Ribokinase {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2absa1350 Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} 99.27
d1tyya_304 Aminoimidazole riboside kinase {Salmonella typhimu 99.25
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 99.24
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 99.23
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 99.22
d2dcna1308 Hypothetical fructokinase ST2478 {Sulfolobus tokod 99.21
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.11
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 99.05
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 99.03
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.98
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 98.67
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 98.53
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 98.51
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 98.47
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 98.46
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 98.44
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 98.21
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.21
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 98.21
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.19
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 98.15
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 98.06
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 98.04
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.04
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 97.87
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 97.87
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 97.73
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.71
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.65
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 97.58
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 97.57
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 97.55
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 97.51
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 97.45
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 97.43
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 97.31
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.31
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 97.26
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 97.23
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 97.2
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 97.15
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.14
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 97.14
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 97.11
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 97.1
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 97.08
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 96.92
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 96.88
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 96.76
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 96.61
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.61
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 96.24
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 96.14
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 96.11
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 95.97
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 95.81
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.47
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 95.34
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.25
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 95.17
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.08
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 95.03
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 94.96
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 94.93
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.78
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 94.59
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 94.53
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 94.53
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 94.51
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 94.42
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 94.38
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 94.27
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 94.21
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 93.47
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 93.4
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 93.26
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 93.17
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 93.12
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 93.01
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 92.83
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 92.74
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 92.67
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 92.5
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 92.36
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 92.36
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 92.24
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 91.82
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 91.78
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 91.56
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 91.48
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 91.48
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 91.46
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 91.33
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 91.15
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 90.79
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 90.67
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 90.45
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 90.22
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 90.21
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 89.71
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 89.18
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 89.1
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 88.26
d1dqwa_267 Orotidine 5'-monophosphate decarboxylase (OMP deca 87.99
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 87.84
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 87.18
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 86.82
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 86.48
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 86.37
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 86.2
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 86.11
d1qkka_140 Transcriptional regulatory protein DctD, receiver 85.55
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 85.37
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 85.22
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 84.88
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 84.82
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 84.7
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 84.44
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 83.76
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 83.56
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 83.15
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 83.1
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 82.79
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 82.77
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 82.61
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 82.56
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 82.32
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 82.02
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 81.74
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 80.84
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 80.74
d1twda_ 247 Copper homeostasis protein CutC {Shigella flexneri 80.39
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 80.15
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 80.1
>d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Thiamin biosynthesis kinases
domain: 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD)
species: Salmonella typhimurium [TaxId: 90371]

Probab=100.00  E-value=2.4e-46  Score=360.14  Aligned_cols=265  Identities=43%  Similarity=0.651  Sum_probs=230.7

Q ss_pred             CCCCeEEEEecCCCCChhcHHHHHHHHHHcCceeeecceEeeeecCCCeeeeEecCHHHHHHHHHHHHcCCCcCEEEEcc
Q 010244           18 MKIPHVLTVAGSDSGAGAGIQADLKACAARGVYCSTVITAVTAQNTAGVQGVNIVPEDFVAAQLKSVLSDMQVDVVKTGM   97 (514)
Q Consensus        18 ~~~~~vL~i~g~d~~ggag~~a~~~~l~~~g~~~~~~~t~~~~~n~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~i~~G~   97 (514)
                      |++.+||+|+|+|++||||++||+++++++|+|+++++|+++.||+.++..+.+++++++.+|++.+++++++++|++||
T Consensus         1 m~~~~vL~IaG~D~sgGAGi~ADi~t~~alg~~~~~v~TalT~Qn~~~v~~v~~~~~~~i~~ql~~l~~d~~~~aIkiG~   80 (266)
T d1jxha_           1 MQRINALTIAGTDPSGGAGIQADLKTFSALGAYGCSVITALVAENTCGVQSVYRIEPDFVAAQLDSVFSDVRIDTTKIGM   80 (266)
T ss_dssp             CCCCEEEEEEECCTTSSSHHHHHHHHHHHTTCEEEEEEEEEEEEETTEEEEEEECCHHHHHHHHHHHHTTSCCSEEEECC
T ss_pred             CCcceEEEEeccCCCCHHHHHHHHHHHHHcCCeecceeeEEEeEcCcCeeEEEECCHHHHHHHHHHHHhcccCceEEEcc
Confidence            67788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHhcCCCCcEEEecceecCCCCCCCChhHHHHHHHhhcccceEEcCCHHHHHHhhCCCCCCCHHHHHH
Q 010244           98 LPSTDLVKVLLQSLSEFPVRALVVDPVMVSTSGDVLAGPSTITGLRENLLPMADIVTPNVKEASALLGGMQVVTVADMCS  177 (514)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~ivlDPv~~~~~g~~~~~~~~~~~l~~~ll~~~diitpN~~E~~~L~g~~~~~~~~~~~~  177 (514)
                      +.+.++++.+.+++++++..++|+|||+.+.++..+.+++..+.++++|+|.+|+||||..|++.|++.....+.++..+
T Consensus        81 l~s~~~i~~v~~~l~~~~~~~~vvdpv~~~~~~~~~~~~~~~~~~~~~Llp~adviTPN~~Ea~~Ll~~~~~~~~~~~~~  160 (266)
T d1jxha_          81 LAETDIVEAVAERLQRHHVRNVVLDTVMLAKSGDPLLSPSAIETLRVRLLPQVSLITPNLPEAAALLDAPHARTEQEMLA  160 (266)
T ss_dssp             CCSHHHHHHHHHHHHHTTCCSEEEECCCC------CCCHHHHHHHHHHTGGGCSEEECBHHHHHHHHTCCCCCSHHHHHH
T ss_pred             cchHHHHHHHHHHHHhccCCceEEeccccccccchhhHHHHHHHHHHHhhhhhheecCCHHHHHHHhcCCcccChHHHHH
Confidence            99999999999999998877799999999999988999999999988999999999999999999998677788889999


Q ss_pred             HHHHHHhcCCCeEEEecccCCCCCCceEEEEeCCeEEEEeecccCCCCCCCCcchHHHHHHHHHHcCCCHHHHHHHHHHH
Q 010244          178 AAKLLHNLGPRTVLVKGGDLPDSSDAVDIFFDGEDFHELRSSRVNTRNTHGTGCTLASCIAAELAKGSPMLSAVKVAKCF  257 (514)
Q Consensus       178 ~a~~l~~~g~~~Vvvt~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~~d~~GaGD~f~a~i~~~l~~g~~l~~A~~~A~~~  257 (514)
                      +++.+.++|++.|++|+++..+ +...++++++++.+.+..++....+++|+||+|+++|+++|++|+++++|++.|..+
T Consensus       161 aa~~l~~~g~~~Vlikg~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~hGTGc~lasaiaa~La~G~~l~~Av~~A~~~  239 (266)
T d1jxha_         161 QGRALLAMGCEAVLMKGGHLED-AQSPDWLFTREGEQRFSAPRVNTKNTHGTGCTLSAALAALRPRHRSWGETVNEAKAW  239 (266)
T ss_dssp             HHHHHHHTTCSEEEEBC----------CEEECSSCEEEC---CCCCSCCBTHHHHHHHHHHHHGGGSSSHHHHHHHHHHH
T ss_pred             HHHHHHhcCCceEEEeccccCC-CcceEEEEcCCceEEEeeccccCCCCCCchHHHHHHHHHHHHcCCCHHHHHHHHHHH
Confidence            9999999999999999998653 234467777777777776676666889999999999999999999999999999999


Q ss_pred             HHHHHhcccccccCCCCCCCccccccc
Q 010244          258 VETALDYSKDIVIGSGPQGPFDHLLRL  284 (514)
Q Consensus       258 ~~~~i~~~~~~~~g~g~~~~~~~~~~~  284 (514)
                      ++.+|+.+.+++.|.| .||++|+.++
T Consensus       240 v~~~i~~s~~~~~G~g-~gp~~h~~~~  265 (266)
T d1jxha_         240 LSAALAQADTLEVGKG-IGPVHHFHAW  265 (266)
T ss_dssp             HHHHHTTGGGCCCCSS-SCBCCTTTTT
T ss_pred             HHHHHHhCCCCCCCCc-CCCchhhhhc
Confidence            9999999988777888 8999998765
>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ax3a1 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure