Citrus Sinensis ID: 010325


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAAVSGYPNQGGQSKQGLPPKKAAESDSSSTRATPSDPPLDSK
ccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEHHccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcHccccHHHHccccccEEEEEcccHccHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHEcccccccccEEEEEcccccccccccHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccHHHHHcccccccccccccHHHHccccEEEEEccHHHHHHHHHHHHcccccccccHHEEEEEccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccc
MQLLNAVMATRMLTstmkngggpssegipfgsVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILqrsgtpsekkqaaaIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSqeagkggelthdeTTIISGaldltektaeeamtpiestfsldvnsklDWEAMGKILArghsrvpvysgnpknIIGLLLVKSLltvrpetetpvsavsirriprvpsdmplyDILNEFQKGSSHMAAVVKAkgksktlppmtdgkkpklneakggdcdltapllskqdektesvvvdvdrplssgsmnrlsssqrsdsttngliyasediedgeviGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSvarapssrrligqkgaavsgypnqggqskqglppkkaaesdssstratpsdppldsk
MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSqeagkggelthdETTIISGALDLTEKTAEEAMTpiestfsldvnsKLDWEAMGKILarghsrvpvysgNPKNIIGLLLVKSLLtvrpetetpvsavsirriprvpsdMPLYDILNEFQKGSSHMAAVVKakgksktlppmtdgkkpklneakggdCDLTapllskqdektesvvvdvdrplssgsmnrlsssqrsdsttnGLIYasediedgeVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAaassvarapssrrliGQKGAavsgypnqggqskqglppkkaaesdssstratpsdppldsk
MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAgimsgltlglmslglveleILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPlssgsmnrlsssqrsdsttngLIYASediedgevigiiTLEDVFEELLQEEIVDETDEYVDVHKRIrvaaaaaassvarapssrrLIGQKGAAVSGYPNQGGQSKQGLPPKKAAESDSSSTRATPSDPPLDSK
***************************IPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQR*********AAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQE******LTHDETTIISGALDLT**********IESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEF***********************************************************************************GLIYASEDIEDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAA*************************************************************
********A********************FGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELE**************AAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNE***************************DETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTAP************VVDVDRPLSSG************STTNGLIYASEDIE*G*VIGIITLEDVFEELLQ************************************************************************************
MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQR*********AAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPLSS****************NGLIYASEDIEDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVA*****************IGQKGAAVSG*************************************
*QLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGG*****APLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAA**************************************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQYVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVLGHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITLEDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAAVSGYPNQGGQSKQGLPPKKAAESDSSSTRATPSDPPLDSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
Q67XQ0494 DUF21 domain-containing p yes no 0.914 0.949 0.776 0.0
Q4V3C7495 DUF21 domain-containing p no no 0.904 0.937 0.738 0.0
Q9ZVS8499 Putative DUF21 domain-con no no 0.881 0.905 0.691 1e-178
Q8VZI2424 DUF21 domain-containing p no no 0.771 0.933 0.535 1e-118
Q9ZQR4423 DUF21 domain-containing p no no 0.789 0.957 0.526 1e-117
Q8RY60527 DUF21 domain-containing p no no 0.941 0.916 0.463 1e-115
Q9LTD8500 DUF21 domain-containing p no no 0.789 0.81 0.490 1e-115
Q12296 706 Protein MAM3 OS=Saccharom yes no 0.576 0.419 0.417 4e-61
Q9USJ3 679 Uncharacterized protein C yes no 0.567 0.428 0.397 1e-56
A0JPA0 769 Metal transporter CNNM4 O yes no 0.594 0.396 0.393 6e-56
>sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=2 SV=1 Back     alignment and function desciption
 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/487 (77%), Positives = 413/487 (84%), Gaps = 18/487 (3%)

Query: 1   MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLM 60
           M L+NAV A R+L+   ++ G    E IPFGS  W  YAGISC LVLFAGIMSGLTLGLM
Sbjct: 1   MHLINAVAAARILSGIGQSNGNNGGEAIPFGSFEWITYAGISCFLVLFAGIMSGLTLGLM 60

Query: 61  SLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQ 120
           SLGLVELEILQRSGTP+EKKQAAAIFPVVQKQHQLLVTLLLCNA +ME LPIYLDKLFN+
Sbjct: 61  SLGLVELEILQRSGTPNEKKQAAAIFPVVQKQHQLLVTLLLCNAMAMEGLPIYLDKLFNE 120

Query: 121 YVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVL 180
           YVAIILSVTFVL FGEVIPQAICTRYGLAVGANFVWLVRILM +CYPIA+PIGKILD VL
Sbjct: 121 YVAIILSVTFVLAFGEVIPQAICTRYGLAVGANFVWLVRILMTLCYPIAFPIGKILDLVL 180

Query: 181 GHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS 240
           GHN+ALFRRAQLKALV+IHSQEAGKGGELTHDETTIISGALDLTEKTA+EAMTPIESTFS
Sbjct: 181 GHNDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAQEAMTPIESTFS 240

Query: 241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR 300
           LDVNSKLDWEAMGKILARGHSRVPVYSGNPKN+IGLLLVKSLLTVRPETET VSAV IRR
Sbjct: 241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNVIGLLLVKSLLTVRPETETLVSAVCIRR 300

Query: 301 IPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTA 360
           IPRVP+DMPLYDILNEFQKGSSHMAAVVK K     +PP T  ++   +  +  D DLTA
Sbjct: 301 IPRVPADMPLYDILNEFQKGSSHMAAVVKVK-GKSKVPPSTLLEE---HTDESNDSDLTA 356

Query: 361 PLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITL 420
           PLL K++   ++V+V +D+       N  S  Q ++S  +G  + SE IEDGEVIGIITL
Sbjct: 357 PLLLKREGNHDNVIVTIDKA------NGQSFFQNNESGPHGFSHTSEAIEDGEVIGIITL 410

Query: 421 EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAAVSGYPNQ 480
           EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASS+ARAPSSR+L+ QKG         
Sbjct: 411 EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSIARAPSSRKLLAQKGT-------- 462

Query: 481 GGQSKQG 487
           GGQ+KQG
Sbjct: 463 GGQNKQG 469





Arabidopsis thaliana (taxid: 3702)
>sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 Back     alignment and function description
>sp|Q8VZI2|Y4370_ARATH DUF21 domain-containing protein At4g33700 OS=Arabidopsis thaliana GN=CBSDUF6 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQR4|Y2452_ARATH DUF21 domain-containing protein At2g14520 OS=Arabidopsis thaliana GN=CBSDUF3 PE=2 SV=2 Back     alignment and function description
>sp|Q8RY60|Y1733_ARATH DUF21 domain-containing protein At1g47330 OS=Arabidopsis thaliana GN=CBSDUF7 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 Back     alignment and function description
>sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 Back     alignment and function description
>sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
255551477502 conserved hypothetical protein [Ricinus 0.951 0.972 0.830 0.0
224102601500 predicted protein [Populus trichocarpa] 0.949 0.974 0.838 0.0
356557879489 PREDICTED: DUF21 domain-containing prote 0.951 0.997 0.815 0.0
224107237502 predicted protein [Populus trichocarpa] 0.972 0.994 0.805 0.0
449465210496 PREDICTED: DUF21 domain-containing prote 0.943 0.975 0.808 0.0
449528085496 PREDICTED: DUF21 domain-containing prote 0.943 0.975 0.808 0.0
356521943493 PREDICTED: DUF21 domain-containing prote 0.943 0.981 0.793 0.0
356564538493 PREDICTED: DUF21 domain-containing prote 0.943 0.981 0.797 0.0
225432520505 PREDICTED: DUF21 domain-containing prote 0.974 0.990 0.781 0.0
225436964504 PREDICTED: putative DUF21 domain-contain 0.941 0.958 0.768 0.0
>gi|255551477|ref|XP_002516784.1| conserved hypothetical protein [Ricinus communis] gi|223543872|gb|EEF45398.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/502 (83%), Positives = 447/502 (89%), Gaps = 14/502 (2%)

Query: 1   MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAGIMSGLTLGLM 60
           M L+NAVMATRMLT   ++ G   SEGIPFGS+WWF+YAGISC LVLFAGIMSGLTLGLM
Sbjct: 1   MHLVNAVMATRMLTMLGQSNG--VSEGIPFGSIWWFIYAGISCFLVLFAGIMSGLTLGLM 58

Query: 61  SLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQ 120
           SLGLVELEILQRSGT SEKKQAAAI PVVQKQHQLLVTLLLCNAA+MEALPIYLDKLFNQ
Sbjct: 59  SLGLVELEILQRSGTSSEKKQAAAILPVVQKQHQLLVTLLLCNAAAMEALPIYLDKLFNQ 118

Query: 121 YVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVL 180
           YVAIILSVTFVLFFGEVIPQ+IC+RYGLAVGANFVWLVRILMIICYPI+YPIGKILDWVL
Sbjct: 119 YVAIILSVTFVLFFGEVIPQSICSRYGLAVGANFVWLVRILMIICYPISYPIGKILDWVL 178

Query: 181 GHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS 240
           GHNEALFRRAQLK LV+IHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS
Sbjct: 179 GHNEALFRRAQLKVLVSIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS 238

Query: 241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR 300
           LDVNSKLDWEAMGK+LARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR
Sbjct: 239 LDVNSKLDWEAMGKVLARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR 298

Query: 301 IPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTA 360
           IPRVPSDMPLYDILNEFQKGSSHMAAVVK+K KSK   PMT G+K + N+A  GD +LT 
Sbjct: 299 IPRVPSDMPLYDILNEFQKGSSHMAAVVKSKAKSKI--PMTTGEKQEENKATAGDSELTI 356

Query: 361 PLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITL 420
           PLL KQDEK ++V++D+DR +S  S N+ +SSQR D+ TNGL+ +SEDIEDGEVIGIITL
Sbjct: 357 PLLVKQDEKLDTVILDMDR-VSRLSSNKQTSSQRFDAATNGLVQSSEDIEDGEVIGIITL 415

Query: 421 EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAAVSGYPNQ 480
           EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRL   KG    G P Q
Sbjct: 416 EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLTANKGTGAQGKPGQ 475

Query: 481 GGQSKQGLPPKKAAESDSSSTR 502
                      + +E+DSSS R
Sbjct: 476 A---------LRKSENDSSSPR 488




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224102601|ref|XP_002312743.1| predicted protein [Populus trichocarpa] gi|222852563|gb|EEE90110.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356557879|ref|XP_003547237.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] Back     alignment and taxonomy information
>gi|224107237|ref|XP_002314418.1| predicted protein [Populus trichocarpa] gi|222863458|gb|EEF00589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465210|ref|XP_004150321.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528085|ref|XP_004171037.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356521943|ref|XP_003529609.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] Back     alignment and taxonomy information
>gi|356564538|ref|XP_003550510.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] Back     alignment and taxonomy information
>gi|225432520|ref|XP_002280174.1| PREDICTED: DUF21 domain-containing protein At4g14240 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225436964|ref|XP_002276672.1| PREDICTED: putative DUF21 domain-containing protein At1g03270 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
TAIR|locus:2129540494 AT4G14240 "AT4G14240" [Arabido 0.922 0.957 0.674 2.8e-160
TAIR|locus:2129535495 AT4G14230 "AT4G14230" [Arabido 0.935 0.969 0.625 3.1e-147
TAIR|locus:2014520499 AT1G03270 "AT1G03270" [Arabido 0.686 0.705 0.719 5.5e-143
TAIR|locus:2134273424 AT4G33700 "AT4G33700" [Arabido 0.592 0.716 0.573 5.4e-96
TAIR|locus:2055155423 AT2G14520 "AT2G14520" [Arabido 0.617 0.749 0.545 3.4e-94
TAIR|locus:2149659500 AT5G52790 "AT5G52790" [Arabido 0.690 0.708 0.460 2.1e-92
TAIR|locus:2203746527 AT1G47330 "AT1G47330" [Arabido 0.619 0.603 0.501 7.1e-90
ASPGD|ASPL0000049101 716 AN1876 [Emericella nidulans (t 0.649 0.465 0.358 6.9e-63
SGD|S000005421 706 MAM3 "Protein required for nor 0.575 0.417 0.385 1.6e-59
POMBASE|SPCC4B3.03c 679 SPCC4B3.03c "mitochondrial mor 0.608 0.459 0.359 1.6e-57
TAIR|locus:2129540 AT4G14240 "AT4G14240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1561 (554.6 bits), Expect = 2.8e-160, P = 2.8e-160
 Identities = 328/486 (67%), Positives = 361/486 (74%)

Query:     1 MQLLNAVMATRMLTSTMKNGGGPSSEGIPFGSVWWFVYAGISCVLVLFAXXXXXXXXXXX 60
             M L+NAV A R+L+   ++ G    E IPFGS  W  YAGISC LVLFA           
Sbjct:     1 MHLINAVAAARILSGIGQSNGNNGGEAIPFGSFEWITYAGISCFLVLFAGIMSGLTLGLM 60

Query:    61 XXXXXXXXILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYLDKLFNQ 120
                     ILQRSGTP+EKKQAAAIFPVVQKQHQLLVTLLLCNA +ME LPIYLDKLFN+
Sbjct:    61 SLGLVELEILQRSGTPNEKKQAAAIFPVVQKQHQLLVTLLLCNAMAMEGLPIYLDKLFNE 120

Query:   121 YVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDWVL 180
             YVAIILSVTFVL FGEVIPQAICTRYGLAVGANFVWLVRILM +CYPIA+PIGKILD VL
Sbjct:   121 YVAIILSVTFVLAFGEVIPQAICTRYGLAVGANFVWLVRILMTLCYPIAFPIGKILDLVL 180

Query:   181 GHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS 240
             GHN+ALFRRAQLKALV+IHSQEAGKGGELTHDETTIISGALDLTEKTA+EAMTPIESTFS
Sbjct:   181 GHNDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAQEAMTPIESTFS 240

Query:   241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR 300
             LDVNSKLDWEAMGKILARGHSRVPVYSGNPKN+IGLLLVKSLLTVRPETET VSAV IRR
Sbjct:   241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNVIGLLLVKSLLTVRPETETLVSAVCIRR 300

Query:   301 IPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTDGKKPKLNEAKGGDCDLTA 360
             IPRVP+DMPLYDILNEFQKGSSHMAAVVK KGKSK +PP T  ++   +  +  D DLTA
Sbjct:   301 IPRVPADMPLYDILNEFQKGSSHMAAVVKVKGKSK-VPPSTLLEE---HTDESNDSDLTA 356

Query:   361 PLLSKQDEKTESVVVDVDRPXXXXXXXXXXXXXXXXXXXXXLIYASXXXXXXXXXXXXTL 420
             PLL K++   ++V+V +D+                        + S            TL
Sbjct:   357 PLLLKREGNHDNVIVTIDKANGQSFFQNNESGPHGFS------HTSEAIEDGEVIGIITL 410

Query:   421 EDVFEELLQEEIVDETDEYVDVHKRIXXXXXXXXXXXXXXXXXXXLIGQKGAAVSGYPNQ 480
             EDVFEELLQEEIVDETDEYVDVHKRI                   L+ QKG   +G  N+
Sbjct:   411 EDVFEELLQEEIVDETDEYVDVHKRIRVAAAAAASSIARAPSSRKLLAQKG---TGGQNK 467

Query:   481 GGQSKQ 486
              GQ+ +
Sbjct:   468 QGQTNK 473


GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2129535 AT4G14230 "AT4G14230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014520 AT1G03270 "AT1G03270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134273 AT4G33700 "AT4G33700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055155 AT2G14520 "AT2G14520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149659 AT5G52790 "AT5G52790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203746 AT1G47330 "AT1G47330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000049101 AN1876 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000005421 MAM3 "Protein required for normal mitochondrial morphology" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPCC4B3.03c SPCC4B3.03c "mitochondrial morphology protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q67XQ0Y4424_ARATHNo assigned EC number0.77610.91420.9493yesno
Q4V3C7Y4423_ARATHNo assigned EC number0.73890.90440.9373nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.297.1
hypothetical protein (496 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00012610
hypothetical protein (232 aa)
       0.442

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
COG1253429 COG1253, TlyC, Hemolysins and related proteins con 3e-42
pfam01595182 pfam01595, DUF21, Domain of unknown function DUF21 5e-32
TIGR03520408 TIGR03520, GldE, gliding motility-associated prote 3e-24
COG4536423 COG4536, CorB, Putative Mg2+ and Co2+ transporter 9e-23
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain 4e-19
COG4535293 COG4535, CorC, Putative Mg2+ and Co2+ transporter 2e-11
PRK15094292 PRK15094, PRK15094, magnesium/cobalt efflux protei 6e-09
PRK11573413 PRK11573, PRK11573, hypothetical protein; Provisio 2e-05
COG1253429 COG1253, TlyC, Hemolysins and related proteins con 9e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-04
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
 Score =  155 bits (394), Expect = 3e-42
 Identities = 81/302 (26%), Positives = 131/302 (43%), Gaps = 22/302 (7%)

Query: 44  VLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCN 103
           +L+  +   S     L+SL    LE L   G     K+A A   ++++ ++ L T+ L  
Sbjct: 12  LLIALSAFFSAAEFALVSLRRSRLEQLAEEG----NKRAKAALKLIERLNRYLSTVQLGI 67

Query: 104 -----AASMEALPIYLDKLFNQYVAIILSVTFVLF--------FGEVIPQAICTRYGLAV 150
                       P     L     A+ LS              FGE++P++I  R    V
Sbjct: 68  TLVSLLLGAVGEPALAALLEPLLEALGLSAALSFAIITFLHVVFGELVPKSIAIRNPEKV 127

Query: 151 GANFVWLVRILMIICYPIAYPIGKILDWVLG-HNEALFRRAQLKALVTIHS--QEAGKGG 207
                  +R    + YP+ + + +I + +L            L +         E+ + G
Sbjct: 128 ALLIAPPLRFFYRLLYPLIWLLNRIANAILRLFGVEPVEEEALTSTEEELELVSESAEEG 187

Query: 208 ELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYS 267
            L  +E  +I+  LDL ++T  E MTP     +LD+   ++ E +  IL  GHSR+PVY 
Sbjct: 188 VLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESGHSRIPVYD 246

Query: 268 GNPKNIIGLLLVKSLLTVRPETE-TPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAA 326
           G+  NIIG++ VK LL    + +      V +R    VP  + L D+L EF++  +HMA 
Sbjct: 247 GDLDNIIGIVHVKDLLRALLDGQSDLDLRVLVRPPLFVPETLSLSDLLEEFREERTHMAI 306

Query: 327 VV 328
           VV
Sbjct: 307 VV 308


Length = 429

>gnl|CDD|216595 pfam01595, DUF21, Domain of unknown function DUF21 Back     alignment and domain information
>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE Back     alignment and domain information
>gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>gnl|CDD|236933 PRK11573, PRK11573, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 100.0
PRK11573413 hypothetical protein; Provisional 100.0
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 100.0
COG1253429 TlyC Hemolysins and related proteins containing CB 100.0
KOG2118498 consensus Predicted membrane protein, contains two 100.0
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 100.0
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.98
PF01595183 DUF21: Domain of unknown function DUF21; InterPro: 99.94
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.7
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 99.69
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.6
COG2524294 Predicted transcriptional regulator, contains C-te 99.58
COG4109432 Predicted transcriptional regulator containing CBS 99.51
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.5
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.42
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.37
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.35
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.34
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.34
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.33
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.33
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.33
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.33
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.33
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.32
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.32
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.3
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.3
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.3
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.3
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.29
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.29
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.27
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.27
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.27
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.27
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.26
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.26
COG3620187 Predicted transcriptional regulator with C-termina 99.25
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.25
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.25
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.25
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.25
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.25
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.24
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.24
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.23
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.23
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.22
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.22
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.22
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.22
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.22
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.21
PRK11573413 hypothetical protein; Provisional 99.21
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.21
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.21
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.2
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.2
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.2
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.2
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.2
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.2
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.19
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.19
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.19
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.19
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.19
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.18
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.18
COG1253429 TlyC Hemolysins and related proteins containing CB 99.18
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.17
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.17
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.17
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.17
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.17
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.16
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.16
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.16
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.16
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.16
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.15
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.15
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.14
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.12
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.1
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.1
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.09
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.08
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.06
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.06
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.05
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.03
COG0517117 FOG: CBS domain [General function prediction only] 99.0
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 98.9
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.82
COG2905 610 Predicted signal-transduction protein containing c 98.8
PRK14869546 putative manganese-dependent inorganic pyrophospha 98.71
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.53
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.52
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.44
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 98.26
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.21
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.19
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.09
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.04
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 97.58
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 97.57
PRK14869546 putative manganese-dependent inorganic pyrophospha 97.54
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.47
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.43
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.4
COG2524294 Predicted transcriptional regulator, contains C-te 97.4
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 97.37
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.36
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 97.33
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 97.32
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.31
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.22
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 97.18
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 97.16
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.15
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 97.12
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 97.07
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.07
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.07
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 97.06
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.06
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.05
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.02
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 97.02
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 97.01
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 97.01
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 96.99
COG3448382 CBS-domain-containing membrane protein [Signal tra 96.98
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 96.98
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.97
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 96.97
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.96
COG0517117 FOG: CBS domain [General function prediction only] 96.95
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 96.94
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 96.94
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 96.93
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 96.92
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 96.92
PLN02274505 inosine-5'-monophosphate dehydrogenase 96.9
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 96.89
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 96.89
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 96.88
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 96.88
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 96.86
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 96.85
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 96.84
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 96.83
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 96.82
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 96.82
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 96.8
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 96.8
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 96.79
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 96.78
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 96.77
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 96.75
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 96.75
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 96.75
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 96.72
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 96.72
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 96.7
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 96.7
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 96.68
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 96.66
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 96.64
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 96.64
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 96.62
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 96.58
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 96.53
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.51
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 96.5
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 96.48
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 96.48
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 96.46
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 96.45
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 96.31
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 96.29
PRK01862574 putative voltage-gated ClC-type chloride channel C 96.28
COG3620187 Predicted transcriptional regulator with C-termina 96.22
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 96.18
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 96.16
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.11
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 96.08
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 96.06
COG4175386 ProV ABC-type proline/glycine betaine transport sy 96.05
COG2905 610 Predicted signal-transduction protein containing c 95.92
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 95.91
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 95.67
cd02205113 CBS_pair The CBS domain, named after human CBS, is 95.55
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 95.53
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.52
COG4109432 Predicted transcriptional regulator containing CBS 94.11
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 93.51
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 90.73
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 90.43
PF0347181 CorC_HlyC: Transporter associated domain; InterPro 86.64
PRK10070400 glycine betaine transporter ATP-binding subunit; P 86.55
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 86.28
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=5.7e-66  Score=515.36  Aligned_cols=366  Identities=23%  Similarity=0.339  Sum_probs=322.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHcCCchhHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHH
Q 010325           35 WFVYAGISCVLVLFAGIMSGLTLGLMSLGLVELEILQRSGTPSEKKQAAAIFPVVQKQHQLLVTLLLCNAASMEALPIYL  114 (513)
Q Consensus        35 ~~~~~~i~~~LlllsafFSg~E~Al~s~~~~~L~~l~~~g~~~~kk~a~~il~l~~~~~~ll~Tll~~n~~~~~~~~~~~  114 (513)
                      |. +++++++|+++||||||+|+|+++++|.|++.++++|+    |+|+++.+++++|++++.|+|+||+++|++.+.+.
T Consensus         3 ~~-l~~~iiili~iSAfFSgSETal~a~nr~Rlr~la~~G~----~~Akrv~kLL~k~drlig~iLIGNNLvNilasala   77 (423)
T COG4536           3 WI-LIIAIIILIIISAFFSGSETALTALNRYRLRHLAKQGN----RGAKRVEKLLEKPDRLIGTILIGNNLVNILASALA   77 (423)
T ss_pred             ch-HHHHHHHHHHHHHHhcccHHHHhhccHHHHHHHHHccc----hhhHHHHHHhcCchheeeeeeecccHHHHHHHHHH
Confidence            44 44667789999999999999999999999999999999    47899999999999999999999999998766543


Q ss_pred             ----HHHHHH---HHHHHHHHHHHHHhhccchhhHHHHhhhHHHHhHHHHHHHHHHHHHHHHHHHHHHHHH---HhCCC-
Q 010325          115 ----DKLFNQ---YVAIILSVTFVLFFGEVIPQAICTRYGLAVGANFVWLVRILMIICYPIAYPIGKILDW---VLGHN-  183 (513)
Q Consensus       115 ----~~~~~~---~~a~~i~t~lilifGEiiPK~la~~~~~~i~~~~a~~~~~l~~l~~Pl~~~~~~~~~~---llg~~-  183 (513)
                          -++||.   .+|+.++|+++++|+|++||++|..||++++...+.++.++..+|+|++|.++++.+.   ++|.+ 
T Consensus        78 T~~~irl~Gd~GvaIAt~~mT~vilvFaEVlPKt~Aa~~perva~~~s~~l~~l~~l~~Plv~lln~it~~llrl~gi~~  157 (423)
T COG4536          78 TILGIRLYGDAGVAIATGVLTFVILVFAEVLPKTIAALYPERVALPSSFILAILVRLFGPLVWLLNAITRRLLRLLGINL  157 (423)
T ss_pred             HHHHHHHhccchHHHHHHHHHHHHHHHHHhcchHHhhhChhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcCc
Confidence                344543   4778889999999999999999999999999999999999999999999999988775   46754 


Q ss_pred             ----cccccHHHHHHHHHHhhhhhccCCCCChhHHHHHHHhhcCcccccccccccCccEEEEeCCCCccHHHHHHHHhcC
Q 010325          184 ----EALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARG  259 (513)
Q Consensus       184 ----~~~~s~eeL~~lv~~~~~e~~~~g~L~~~E~~~I~~vl~l~~~~V~dIMtPr~~vv~v~~d~sl~~eal~~i~~~~  259 (513)
                          +...+.||++.+++    +++..|...+++++|+.+++++++.+|.|||+||+++..++.|++.+ +.++.+..+.
T Consensus       158 ~~~~~~~~s~EElR~~v~----~~~~e~~~~~~~rdmL~gvLDLe~~tV~DIMvpR~~i~~id~d~~~e-~iv~ql~~s~  232 (423)
T COG4536         158 DQAVSQLSSKEELRTAVN----ESGSEGSVNKIDRDMLLGVLDLENLTVSDIMVPRNEIIGIDIDDPWE-EIVRQLLHSP  232 (423)
T ss_pred             ccccccccCHHHHHHHHH----HhhcccccccccHHHHhcccccccceeeeeeccccceeeecCCCCHH-HHHHHHhhCC
Confidence                25689999999998    44555777778999999999999999999999999999999999998 9999999999


Q ss_pred             CceeeeeeCCCCcEEEEEEhhhhhccCCCCc-ccccccc--cccceeeCCCCCHHHHHHHHHhCCceEEEEEecCCCccc
Q 010325          260 HSRVPVYSGNPKNIIGLLLVKSLLTVRPETE-TPVSAVS--IRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKT  336 (513)
Q Consensus       260 ~sr~PV~~~~~d~ivGiV~~kDLl~~~~~~~-~~v~dim--~~~~~~Vpe~~~l~d~L~~m~~~~~~~a~VVDE~G~~~G  336 (513)
                      |+|+|+|.++.|+++|++|.||++++..+.+ ..-.+++  ..++.|||+++++.+.|..|++++.|+++||||||.+.|
T Consensus       233 HtRiplyr~~~DnIiGvlh~r~llr~l~e~~~~~k~d~~~~a~epyFVPe~Tpl~~QL~~F~~~k~hialVVDEYG~i~G  312 (423)
T COG4536         233 HTRIPLYRDDLDNIIGVLHVRDLLRLLNEKNEFTKEDILRAADEPYFVPEGTPLSDQLVAFQRNKKHIALVVDEYGDIQG  312 (423)
T ss_pred             CCceeeecCChhHhhhhhhHHHHHHHhhccCcccHhHHHHHhcCCeecCCCCcHHHHHHHHHHhcceEEEEEeccCcEEe
Confidence            9999999999999999999999998776543 2222322  478899999999999999999999999999999999999


Q ss_pred             CCCCCCCCCccccccCCCCCCCCccccccccccCCceEecCCCCCccccccccccccCC-CCccccccc-cccccCCCc
Q 010325          337 LPPMTDGKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRS-DSTTNGLIY-ASEDIEDGE  413 (513)
Q Consensus       337 iv~~T~~dile~i~g~~~~s~~~~p~~~~~~~~~~~~~vd~~~~i~~~~~~~~~~l~~~-~~t~~gl~~-~~~~~e~g~  413 (513)
                      +|  |.|||+|||+|++.+.. +.-...+.+..++++.+|+..+++++|+.++|++|.+ +.|++|+++ ..|.||+-.
T Consensus       313 LV--TLEDIlEEIVGdftde~-d~~~~ev~~q~dgs~iidGs~~iRdlNr~l~W~Lp~e~a~TinGLvle~le~IP~~~  388 (423)
T COG4536         313 LV--TLEDILEEIVGDFTDEH-DTLAKEVIPQSDGSFIIDGSANVRDLNRALDWNLPDEDARTINGLVLEELEEIPEEG  388 (423)
T ss_pred             ee--eHHHHHHHHhccccccC-cccchhhcccCCCcEEEeCCCcHHHHHHhcCCCCCCCcchhHHHHHHHHHHhCCCCC
Confidence            99  99999999999999543 2334468889999999999999999999999999987 999999988 777777643



>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01595 DUF21: Domain of unknown function DUF21; InterPro: IPR002550 This transmembrane region has no known function Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03471 CorC_HlyC: Transporter associated domain; InterPro: IPR005170 This small domain is found in a family of proteins with the CBS IPR002550 from INTERPRO domain and two CBS domains with this domain found at the C terminus of the proteins, the domain is also found at the C terminus of some Na+/H+ antiporters Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
4hg0_A292 Crystal Structure Of Magnesium And Cobalt Efflux Pr 1e-06
3jtf_A129 The Cbs Domain Pair Structure Of A Magnesium And Co 3e-06
3lhh_A172 The Crystal Structure Of Cbs Domain Protein From Sh 9e-06
>pdb|4HG0|A Chain A, Crystal Structure Of Magnesium And Cobalt Efflux Protein Corc, Northeast Structural Genomics Consortium (nesg) Target Er40 Length = 292 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 42/158 (26%), Positives = 67/158 (42%), Gaps = 12/158 (7%) Query: 189 RAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLD 248 R +L AL+ +++G+ + D + G D+ ++ + P +L N LD Sbjct: 34 RDELLALI----RDSGQNDLIDEDTRDXLEGVXDIADQRVRDIXIPRSQXITLKRNQTLD 89 Query: 249 WEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRRIPR----V 304 E + I+ HSR PV S + +I G+L K LL P + A S ++ R V Sbjct: 90 -ECLDVIIESAHSRFPVISEDKDHIEGILXAKDLL---PFXRSDAEAFSXDKVLRQAVVV 145 Query: 305 PSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTD 342 P + L EF+ H A V+ G L + D Sbjct: 146 PESKRVDRXLKEFRSQRYHXAIVIDEFGGVSGLVTIED 183
>pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 Back     alignment and structure
>pdb|3LHH|A Chain A, The Crystal Structure Of Cbs Domain Protein From Shewanella Oneidensis Mr-1 Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 1e-27
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 1e-26
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 6e-26
3ocm_A173 Putative membrane protein; structural genomics, PS 2e-25
3oco_A153 Hemolysin-like protein containing CBS domains; str 5e-24
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 1e-22
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 2e-21
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 3e-21
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 1e-20
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 9e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 1e-05
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 2e-05
3lqn_A150 CBS domain protein; csgid, structural genomics, un 5e-04
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 6e-04
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 8e-04
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 Back     alignment and structure
 Score =  107 bits (271), Expect = 1e-27
 Identities = 37/148 (25%), Positives = 65/148 (43%), Gaps = 5/148 (3%)

Query: 181 GHNEALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFS 240
           GH +    +  ++A++    QE    G + H+E  ++     L E+T    M P      
Sbjct: 1   GHLDDNVTQEDIQAML----QEGSSAGVIEHNEHAMVKNVFRLDERTISSLMVPRSDIVF 56

Query: 241 LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPETETPVSAVSIRR 300
           LD+N  LD   +  ++   HSR PV   N  +++G++  K LL+     E       ++ 
Sbjct: 57  LDLNLPLD-ANLRTVMQSPHSRFPVCRNNVDDMVGIISAKQLLSESIAGERLELVDLVKN 115

Query: 301 IPRVPSDMPLYDILNEFQKGSSHMAAVV 328
              VP+ +   ++L  F+   S M  VV
Sbjct: 116 CNFVPNSLSGMELLEHFRTTGSQMVFVV 143


>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.94
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.92
3ocm_A173 Putative membrane protein; structural genomics, PS 99.92
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.9
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.89
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.87
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.85
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.85
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.84
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.83
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.82
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.81
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.79
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.78
4esy_A170 CBS domain containing membrane protein; structural 99.78
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.76
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 99.76
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.76
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.72
3ddj_A296 CBS domain-containing protein; structural genomics 99.71
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.7
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.69
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.69
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.68
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.68
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.68
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.68
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.66
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.66
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.66
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.66
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.65
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.64
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.64
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.64
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.64
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.63
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.63
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.63
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.62
3ddj_A296 CBS domain-containing protein; structural genomics 99.62
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.61
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.61
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.61
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.6
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.6
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.59
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.59
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.59
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.59
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.58
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.56
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.55
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.54
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.54
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.53
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.52
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.52
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.51
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.46
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.45
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.44
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.43
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.43
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.4
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.22
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.16
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.05
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.49
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.41
3fio_A70 A cystathionine beta-synthase domain protein fused 98.36
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.35
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.06
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.03
4esy_A170 CBS domain containing membrane protein; structural 98.02
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 97.92
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.91
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 97.91
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 97.84
3fio_A70 A cystathionine beta-synthase domain protein fused 97.81
1pbj_A125 Hypothetical protein; structural genomics, domain, 97.75
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 97.75
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 97.74
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 97.74
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 97.73
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 97.72
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 97.72
1pvm_A184 Conserved hypothetical protein TA0289; structural 97.72
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 97.71
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 97.71
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 97.69
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 97.69
3oco_A153 Hemolysin-like protein containing CBS domains; str 97.68
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 97.68
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 97.67
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 97.66
2o16_A160 Acetoin utilization protein ACUB, putative; struct 97.66
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 97.66
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 97.65
1o50_A157 CBS domain-containing predicted protein TM0935; CB 97.62
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.61
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.59
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 97.59
3lqn_A150 CBS domain protein; csgid, structural genomics, un 97.56
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.56
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 97.56
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 97.55
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 97.53
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.53
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 97.52
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 97.49
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 97.49
3kxr_A205 Magnesium transporter, putative; cystathionine bet 97.48
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 97.48
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 97.47
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 97.44
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 97.43
3ocm_A173 Putative membrane protein; structural genomics, PS 97.4
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 97.32
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.17
2oux_A286 Magnesium transporter; 10001B, structural genomics 97.02
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.88
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 96.86
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 96.78
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.6
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 96.43
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.32
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 95.91
3lae_A81 UPF0053 protein HI0107; APC85784.2, conserved prot 90.85
3llb_A83 Uncharacterized protein; protein PA3983, unknown f 90.7
2rk5_A87 Putative hemolysin; structural genomics, PSI-2, MC 90.64
2pli_A91 Uncharacterized protein; CORC-associated region, M 89.56
2oai_A94 Hemolysin; PFAM03471, xylella fastidiosa temecula1 89.39
2r2z_A93 Hemolysin; APC85144, enterococcus faecalis V583, S 89.31
2p13_A90 CBS domain; alpha-beta structure, structural genom 88.64
2pls_A86 CBS domain protein; APC86064.2, CORC/HLYC transpor 88.2
2p4p_A86 Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03 87.3
2p3h_A101 Uncharacterized CBS domain-containing protein; str 87.07
2o3g_A92 Putative protein; APC85631.1, neisseria meningitid 86.8
3ded_A113 Probable hemolysin; structural genomics, P protein 85.36
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
Probab=99.94  E-value=4.8e-27  Score=218.04  Aligned_cols=167  Identities=25%  Similarity=0.468  Sum_probs=114.5

Q ss_pred             cccccHHHHHHHHHHhhhhhccCCCCChhHHHHHHHhhcCcccccccccccCccEEEEeCCCCccHHHHHHHHhcCCcee
Q 010325          184 EALFRRAQLKALVTIHSQEAGKGGELTHDETTIISGALDLTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRV  263 (513)
Q Consensus       184 ~~~~s~eeL~~lv~~~~~e~~~~g~L~~~E~~~I~~vl~l~~~~V~dIMtPr~~vv~v~~d~sl~~eal~~i~~~~~sr~  263 (513)
                      ...++++||+.+++    ++.+.|.++++|++++++++++.+.+|+++|+|+.+++++++++++. ++++.|.+++++++
T Consensus         4 ~~~~t~~el~~l~~----~~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~v~-~a~~~m~~~~~~~~   78 (172)
T 3lhh_A            4 DDNVTQEDIQAMLQ----EGSSAGVIEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRF   78 (172)
T ss_dssp             -------------------------------------------CTTTTSEEGGGCCCEETTSCHH-HHHHHHHTCCCSEE
T ss_pred             cccCCHHHHHHHHH----HHHHcCCCCHHHHHHHHHHhccCCCCHHHhCccHHHeEEEcCCCCHH-HHHHHHHhCCCCEE
Confidence            45689999999997    44567999999999999999999999999999988999999999999 99999999999999


Q ss_pred             eeeeCCCCcEEEEEEhhhhhccCCC-CcccccccccccceeeCCCCCHHHHHHHHHhCCceEEEEEecCCCcccCCCCCC
Q 010325          264 PVYSGNPKNIIGLLLVKSLLTVRPE-TETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVKAKGKSKTLPPMTD  342 (513)
Q Consensus       264 PV~~~~~d~ivGiV~~kDLl~~~~~-~~~~v~dim~~~~~~Vpe~~~l~d~L~~m~~~~~~~a~VVDE~G~~~Giv~~T~  342 (513)
                      ||++++.++++|+|+.+|++..... ...+++++| +++++|++++++.++++.|.+++.+.+||+|             
T Consensus        79 pVvd~~~~~lvGivt~~dl~~~~~~~~~~~v~~im-~~~~~v~~~~~l~~a~~~m~~~~~~~~pVvd-------------  144 (172)
T 3lhh_A           79 PVCRNNVDDMVGIISAKQLLSESIAGERLELVDLV-KNCNFVPNSLSGMELLEHFRTTGSQMVFVVD-------------  144 (172)
T ss_dssp             EEESSSTTSEEEEEEHHHHHHHHHTTCCCCGGGGC-BCCEEEETTCCHHHHHHHHHHHTCSEEEEEC-------------
T ss_pred             EEEeCCCCeEEEEEEHHHHHHHHhhcCcccHHHHh-cCCeEeCCCCCHHHHHHHHHHcCCeEEEEEe-------------
Confidence            9998655799999999999975432 256899998 9999999999999999999999999999999             


Q ss_pred             CCCccccccCCCCCCCCccccccccccCCceEecCCCCCccccccccccccCCCCccccccccccccCCCccceecchHH
Q 010325          343 GKKPKLNEAKGGDCDLTAPLLSKQDEKTESVVVDVDRPLSSGSMNRLSSSQRSDSTTNGLIYASEDIEDGEVIGIITLED  422 (513)
Q Consensus       343 ~dile~i~g~~~~s~~~~p~~~~~~~~~~~~~vd~~~~i~~~~~~~~~~l~~~~~t~~gl~~~~~~~e~g~liGIITleD  422 (513)
                                                                                         ++|+++||||.+|
T Consensus       145 -------------------------------------------------------------------~~g~lvGiit~~D  157 (172)
T 3lhh_A          145 -------------------------------------------------------------------EYGDLKGLVTLQD  157 (172)
T ss_dssp             -------------------------------------------------------------------TTSCEEEEEEHHH
T ss_pred             -------------------------------------------------------------------CCCCEEEEeeHHH
Confidence                                                                               5789999999999


Q ss_pred             HHHHHhcCccCCCCc
Q 010325          423 VFEELLQEEIVDETD  437 (513)
Q Consensus       423 v~eel~~~ei~de~d  437 (513)
                      +++++.| ++.||+|
T Consensus       158 il~~l~~-~~~de~~  171 (172)
T 3lhh_A          158 MMDALTG-EFFQEDG  171 (172)
T ss_dssp             HHHHHHT-TCC----
T ss_pred             HHHHHhC-CCccccC
Confidence            9999996 9988875



>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3lae_A UPF0053 protein HI0107; APC85784.2, conserved protein, haemophilus influenzae RD KW20, structural genomics, PSI-2; HET: MSE; 1.45A {Haemophilus influenzae} SCOP: d.145.1.4 PDB: 2o1r_A* Back     alignment and structure
>3llb_A Uncharacterized protein; protein PA3983, unknown function, structural genomics, PSI2, MCSG, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: d.145.1.0 Back     alignment and structure
>2rk5_A Putative hemolysin; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics, membrane; 1.50A {Streptococcus mutans UA159} SCOP: d.145.1.4 Back     alignment and structure
>2pli_A Uncharacterized protein; CORC-associated region, MCSG, PSI2, structural genomics, Pro structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.145.1.4 Back     alignment and structure
>2oai_A Hemolysin; PFAM03471, xylella fastidiosa temecula1, structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; HET: MLY; 1.80A {Xylella fastidiosa} SCOP: d.145.1.4 PDB: 2r8d_A* Back     alignment and structure
>2r2z_A Hemolysin; APC85144, enterococcus faecalis V583, STRU initiative, midwest center for structural genomics, MCSG; 1.20A {Enterococcus faecalis} SCOP: d.145.1.4 Back     alignment and structure
>2p13_A CBS domain; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; 1.65A {Nitrosomonas europaea} SCOP: d.145.1.4 Back     alignment and structure
>2pls_A CBS domain protein; APC86064.2, CORC/HLYC transporter associated domain, CBS DOM protein, structural genomics, PSI-2 structure initiative; 2.15A {Chlorobium tepidum tls} SCOP: d.145.1.4 Back     alignment and structure
>2p4p_A Hypothetical protein HD1797; CORC_HLYC, PFAM: PF03471, structural GE PSI-2, protein structure initiative, midwest center for STR genomics; HET: MLY MSE; 1.80A {Haemophilus ducreyi} SCOP: d.145.1.4 Back     alignment and structure
>2p3h_A Uncharacterized CBS domain-containing protein; structural genomics, CORC_HLYC, PFAM03471, putative transpor protein; 1.80A {Corynebacterium glutamicum} SCOP: d.145.1.4 Back     alignment and structure
>2o3g_A Putative protein; APC85631.1, neisseria meningitid structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis} SCOP: d.145.1.4 Back     alignment and structure
>3ded_A Probable hemolysin; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG, membrane; HET: MSE; 2.14A {Chromobacterium violaceum} SCOP: d.145.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 1e-07
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 2e-06
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 8e-06
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 3e-04
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 5e-04
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 0.002
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 0.003
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 0.003
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 49.4 bits (117), Expect = 1e-07
 Identities = 11/125 (8%), Positives = 38/125 (30%), Gaps = 20/125 (16%)

Query: 223 LTEKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSL 282
           +      + +         D + ++  +A   ++  G    P++    ++ +G+L +   
Sbjct: 10  MKSHRCYDLIPTSSKLVVFDTSLQVK-KAFFALVTNGVRAAPLWDSKKQSFVGMLTITDF 68

Query: 283 LTV-------------------RPETETPVSAVSIRRIPRVPSDMPLYDILNEFQKGSSH 323
           + +                              S + +  +  +  L+D ++   +   H
Sbjct: 69  INILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIH 128

Query: 324 MAAVV 328
              V+
Sbjct: 129 RLPVI 133


>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.77
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.72
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.72
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.71
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.71
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.7
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.7
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.68
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.68
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.68
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.68
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.68
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.68
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.66
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.65
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.65
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.65
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.65
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.61
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.59
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.59
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.58
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.58
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.56
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.54
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.49
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.13
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 98.11
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 98.0
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.0
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.98
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 97.97
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 97.88
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 97.87
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 97.87
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 97.85
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 97.84
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 97.82
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 97.8
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 97.77
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.66
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 97.63
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 97.63
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 97.62
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 97.59
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 97.59
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 97.56
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 97.41
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 97.33
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 97.24
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 97.15
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 96.83
d2o1ra178 Hypothetical protein HI0107 {Haemophilus influenza 93.92
d2rk5a184 Putative hemolysin SMU1693 {Streptococcus mutans [ 92.57
d2plia184 Uncharacterized protein NMB0537 {Neisseria meningi 92.2
d2p13a185 Uncharacterized protein NE2227 {Nitrosomonas europ 91.77
d2r2za184 Putative hemolysin EF0700 {Enterococcus faecalis [ 91.56
d2p3ha198 Uncharacterized protein Cgl1194/Cg1349 {Corynebact 91.18
d3deda187 Probable hemolysin CV0231 {Chromobacterium violace 89.87
d2oaia187 Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} 89.42
d2p4pa182 Hypothetical protein HD1797 {Haemophilus ducreyi [ 88.05
d2plsa184 Hypothetical protein CT0541 {Chlorobium tepidum [T 87.79
d2nqwa187 Hypothetical protein PG0272 {Porphyromonas gingiva 86.13
d2o3ga176 Putative protein NMB1485 {Neisseria meningitidis [ 85.69
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 83.98
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=99.77  E-value=2.2e-19  Score=157.40  Aligned_cols=101  Identities=18%  Similarity=0.270  Sum_probs=89.5

Q ss_pred             ccccccccccCccEEEEeCCCCccHHHHHHHHhcCCceeeeeeCCCCcEEEEEEhhhhhccCCC---------Ccccccc
Q 010325          225 EKTAEEAMTPIESTFSLDVNSKLDWEAMGKILARGHSRVPVYSGNPKNIIGLLLVKSLLTVRPE---------TETPVSA  295 (513)
Q Consensus       225 ~~~V~dIMtPr~~vv~v~~d~sl~~eal~~i~~~~~sr~PV~~~~~d~ivGiV~~kDLl~~~~~---------~~~~v~d  295 (513)
                      |.+|+++|+|.+++++++.+++++ ++++.|.+++++++||++++ ++++|+++.+|++.....         ...++++
T Consensus         1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s~~pVvd~~-~~~vGiit~~di~~~~~~~~~~~~~~~~~~~v~~   78 (132)
T d1yava3           1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYTAIPVLDPS-YRLHGLIGTNMIMNSIFGLERIEFEKLDQITVEE   78 (132)
T ss_dssp             TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCSEEEEECTT-CBEEEEEEHHHHHHHHBCSSSBCGGGTTTSBHHH
T ss_pred             CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCCceEEeecc-cccccEEEcchhHHHhhccccccccccccccccc
Confidence            568999999999999999999999 99999999999999999866 899999999999864321         2357888


Q ss_pred             cccccceeeCCCCCHHHHHHHHHhCCceEEEEEe
Q 010325          296 VSIRRIPRVPSDMPLYDILNEFQKGSSHMAAVVK  329 (513)
Q Consensus       296 im~~~~~~Vpe~~~l~d~L~~m~~~~~~~a~VVD  329 (513)
                      +|.++++++++++++.+++..|.+++  .+||+|
T Consensus        79 ~m~~~~~~v~~~~~l~~~~~~~~~~~--~l~Vvd  110 (132)
T d1yava3          79 VMLTDIPRLHINDPIMKGFGMVINNG--FVCVEN  110 (132)
T ss_dssp             HSBCSCCEEETTSBHHHHHHHTTTCS--EEEEEC
T ss_pred             cccccccccccchhHHHHHHHHHhCC--EEEEEc
Confidence            88899999999999999999998764  589999



>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2o1ra1 d.145.1.4 (A:1-78) Hypothetical protein HI0107 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2p3ha1 d.145.1.4 (A:5-102) Uncharacterized protein Cgl1194/Cg1349 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d3deda1 d.145.1.4 (A:341-427) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]} Back     information, alignment and structure
>d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d2plsa1 d.145.1.4 (A:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2o3ga1 d.145.1.4 (A:180-255) Putative protein NMB1485 {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure