Citrus Sinensis ID: 010367

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYSTGQKKLGLGQKGKPKDPSKRHYLFKRRFG
cccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEcccccccccccccEEEEccHHHHcccccccHHHHHHHHHccccccEEEEEccccccHHcHHHHHHHHccccEEEEEEEEEEccccccccccccccEEEEccHHHHHHcccccEEEEEEEEccccHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHcccccEEccccccccccccccEEEEEEccccccccccccccccccccccccccccc
ccHHccccccccccccccccccccEEcHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccHHHHEEEcccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHccccEEEEEccEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccHHHcccHHHHHHcccEEEEEEEEEEccccHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHcccccEcEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHEcccccccHHHccccccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHccHHHHcHHcccccccccccccEEEccccHHHHccccccEEEEEcccccHHHHcccccccccccccHHHHHHcc
mleeydfrndnvnpdlnmelkphaqprpyqekSLSKMfgngrarsgiivlpcgagkslVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTiqddqicrftsdskerfrgnagvVVTTYNMvafggkrseESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLtatlvrederitdlnfligpklyeanwldlvkggfianvqcaevwcpMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLskvgdnsidipeaNVIIQISSHAGSRRQEAQRLGRILRAKGKledrmaggkeEYNAFFYSLVSTDTQEMFYSTKRQQFLidqgysfkvitslpppdsgadlsyHRLDEQLALLGKVLSagddavgleqldedADDIALHKARRIAgsmsamsgaQGMVYMEYStgqkklglgqkgkpkdpskrhylFKRRFG
mleeydfrndnvnpdlnmelkphaqprpyQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFtsdskerfrgnagvvvttynmvafggkrseeseKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLtatlvrederitDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQIsshagsrrqEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYSTGQKklglgqkgkpkdpskrhylfkrrfg
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGkrseesekiieeirnreWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYSTgqkklglgqkgkPKDPSKRHYLFKRRFG
******************************************ARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGK*****EKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQIS******************************KEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLP*****ADLSYHRLDEQLALLGKVLSAGDDAVGLEQL******IAL******************************************************
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPP************EQLALLGKV************************************G********************************LFKRRFG
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISS**********RLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYSTGQK*************SKRHYLFKRRFG
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDR**GGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDD****************HKARRIAGSMSAMSGAQGMVYMEYSTG***************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYSTGQKKLGLGQKGKPKDPSKRHYLFKRRFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
Q9FUG4766 DNA repair helicase XPB2 yes no 0.994 0.664 0.898 0.0
Q38861767 DNA repair helicase XPB1 yes no 0.996 0.664 0.909 0.0
O00835800 TFIIH basal transcription yes no 0.962 0.616 0.636 0.0
Q5RA62782 TFIIH basal transcription yes no 0.941 0.616 0.608 1e-179
P19447782 TFIIH basal transcription yes no 0.941 0.616 0.608 1e-178
Q60HG1782 TFIIH basal transcription N/A no 0.941 0.616 0.608 1e-178
Q1RMT1782 TFIIH basal transcription yes no 0.955 0.625 0.605 1e-178
Q7ZVV1782 TFIIH basal transcription yes no 0.945 0.618 0.603 1e-177
P49135783 TFIIH basal transcription yes no 0.941 0.615 0.600 1e-176
Q4G005782 TFIIH basal transcription yes no 0.943 0.617 0.596 1e-176
>sp|Q9FUG4|XPB2_ARATH DNA repair helicase XPB2 OS=Arabidopsis thaliana GN=XPB2 PE=2 SV=1 Back     alignment and function desciption
 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/511 (89%), Positives = 488/511 (95%), Gaps = 2/511 (0%)

Query: 1   MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 60
           MLEEYDFRNDNVNPDL+MELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG
Sbjct: 257 MLEEYDFRNDNVNPDLDMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 316

Query: 61  VSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTT 120
           VSAA RIKKSCLCLATNAVSVDQWA+QFKLWSTI+DDQICRFTSDSKERFRGNAGVVVTT
Sbjct: 317 VSAAARIKKSCLCLATNAVSVDQWAYQFKLWSTIKDDQICRFTSDSKERFRGNAGVVVTT 376

Query: 121 YNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTAT 180
           YNM+AFGGKRSEE+EKIIEE+RNREWGLLLMDEVHVVPAHMFRKVIS+TKSHCKLGLTAT
Sbjct: 377 YNMIAFGGKRSEEAEKIIEEMRNREWGLLLMDEVHVVPAHMFRKVISITKSHCKLGLTAT 436

Query: 181 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSK 240
           LVREDE+ITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFF+EYLKKENSK
Sbjct: 437 LVREDEKITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFAEYLKKENSK 496

Query: 241 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV 300
           KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSH+
Sbjct: 497 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHI 556

Query: 301 ERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 360
           ERTKIL+AFK S+ +NT+FLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK
Sbjct: 557 ERTKILEAFKTSKTVNTVFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 616

Query: 361 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGAD 420
           GKLEDRMAGGKEEYNAFFYSLVSTDTQEM+YSTKRQQFLIDQGYSFKVITSLPPPD+G+ 
Sbjct: 617 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMYYSTKRQQFLIDQGYSFKVITSLPPPDAGSS 676

Query: 421 LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYM 480
           L YH  +EQL+LLGKVL+AGDD VGLEQL+ED D  AL K RR  GSMSAMSGA G VYM
Sbjct: 677 LGYHSQEEQLSLLGKVLNAGDDMVGLEQLEEDTDGKAL-KTRRSMGSMSAMSGANGRVYM 735

Query: 481 EYSTGQKKLGLGQKGKPKDPSKRHYLFKRRF 511
           EY++G++K G  Q  KPKDP+KRH +FK+R+
Sbjct: 736 EYNSGRQKSG-NQSKKPKDPTKRHNIFKKRY 765
Putative ATP-dependent 3'-5' DNA helicase involved in nucleotide excision repair (NER) of DNA. May be involved in RNA transcription by RNA polymerase II. Acts by opening DNA around either the RNA transcription start site or the DNA damage.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q38861|XPB1_ARATH DNA repair helicase XPB1 OS=Arabidopsis thaliana GN=XPB1 PE=2 SV=3 Back     alignment and function description
>sp|O00835|ERCC3_DICDI TFIIH basal transcription factor complex helicase repB subunit OS=Dictyostelium discoideum GN=repB PE=2 SV=1 Back     alignment and function description
>sp|Q5RA62|ERCC3_PONAB TFIIH basal transcription factor complex helicase XPB subunit OS=Pongo abelii GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|P19447|ERCC3_HUMAN TFIIH basal transcription factor complex helicase XPB subunit OS=Homo sapiens GN=ERCC3 PE=1 SV=1 Back     alignment and function description
>sp|Q60HG1|ERCC3_MACFA TFIIH basal transcription factor complex helicase XPB subunit OS=Macaca fascicularis GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|Q1RMT1|ERCC3_BOVIN TFIIH basal transcription factor complex helicase XPB subunit OS=Bos taurus GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVV1|ERCC3_DANRE TFIIH basal transcription factor complex helicase XPB subunit OS=Danio rerio GN=ercc3 PE=2 SV=1 Back     alignment and function description
>sp|P49135|ERCC3_MOUSE TFIIH basal transcription factor complex helicase XPB subunit OS=Mus musculus GN=Ercc3 PE=2 SV=1 Back     alignment and function description
>sp|Q4G005|ERCC3_RAT TFIIH basal transcription factor complex helicase XPB subunit OS=Rattus norvegicus GN=Ercc3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
225426192 771 PREDICTED: DNA repair helicase XPB1-like 0.998 0.662 0.939 0.0
297742218 850 unnamed protein product [Vitis vinifera] 0.998 0.601 0.939 0.0
255537537 768 rad25/xp-B DNA repair helicase, putative 1.0 0.666 0.931 0.0
297805512 767 DNA repair and transcription factor XPB1 0.998 0.666 0.898 0.0
449530460 725 PREDICTED: DNA repair helicase XPB1-like 1.0 0.706 0.922 0.0
356513365 768 PREDICTED: DNA repair helicase XPB1-like 0.998 0.665 0.925 0.0
449452290 768 PREDICTED: DNA repair helicase XPB1-like 1.0 0.666 0.922 0.0
9758045 754 DNA excision repair cross-complementing 0.994 0.675 0.898 0.0
18422089 766 DNA repair helicase XPB2 [Arabidopsis th 0.994 0.664 0.898 0.0
356528573 768 PREDICTED: DNA repair helicase XPB1-like 1.0 0.666 0.919 0.0
>gi|225426192|ref|XP_002273444.1| PREDICTED: DNA repair helicase XPB1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/515 (93%), Positives = 501/515 (97%), Gaps = 4/515 (0%)

Query: 1   MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 60
           MLEEYDFRND VNPDL+MELKP AQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG
Sbjct: 258 MLEEYDFRNDTVNPDLDMELKPQAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 317

Query: 61  VSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTT 120
           VSAACRI+KSCLCLATNAVSVDQWAFQFKLWSTI+D+QICRFTSDSKERFRGNAGVVVTT
Sbjct: 318 VSAACRIRKSCLCLATNAVSVDQWAFQFKLWSTIRDEQICRFTSDSKERFRGNAGVVVTT 377

Query: 121 YNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTAT 180
           YNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVIS+TKSHCKLGLTAT
Sbjct: 378 YNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISITKSHCKLGLTAT 437

Query: 181 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSK 240
           LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFF+EYLKKENSK
Sbjct: 438 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFAEYLKKENSK 497

Query: 241 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV 300
           KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV
Sbjct: 498 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV 557

Query: 301 ERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 360
           ERTKIL+AFK  +D+NTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK
Sbjct: 558 ERTKILEAFKTHKDVNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 617

Query: 361 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGAD 420
           G+L+DR+AGGKEEYNAFFYSLVSTDTQEM+YSTKRQQFLIDQGYSFK+ITSLPPPDSGAD
Sbjct: 618 GRLQDRLAGGKEEYNAFFYSLVSTDTQEMYYSTKRQQFLIDQGYSFKIITSLPPPDSGAD 677

Query: 421 LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYM 480
           LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIAL KARR  GSMSAMSGA GMVYM
Sbjct: 678 LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALQKARRSVGSMSAMSGASGMVYM 737

Query: 481 EYSTGQKKLGLGQ---KGKPKDPSKRHYLFKRRFG 512
           EY+TG+ K G GQ   KGKPKDPSKRH+LFKRRFG
Sbjct: 738 EYNTGRNKHG-GQGQIKGKPKDPSKRHHLFKRRFG 771

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742218|emb|CBI34367.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537537|ref|XP_002509835.1| rad25/xp-B DNA repair helicase, putative [Ricinus communis] gi|223549734|gb|EEF51222.1| rad25/xp-B DNA repair helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297805512|ref|XP_002870640.1| DNA repair and transcription factor XPB1 [Arabidopsis lyrata subsp. lyrata] gi|297316476|gb|EFH46899.1| DNA repair and transcription factor XPB1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449530460|ref|XP_004172213.1| PREDICTED: DNA repair helicase XPB1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513365|ref|XP_003525384.1| PREDICTED: DNA repair helicase XPB1-like [Glycine max] Back     alignment and taxonomy information
>gi|449452290|ref|XP_004143892.1| PREDICTED: DNA repair helicase XPB1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|9758045|dbj|BAB08508.1| DNA excision repair cross-complementing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18422089|ref|NP_568591.1| DNA repair helicase XPB2 [Arabidopsis thaliana] gi|57013267|sp|Q9FUG4.1|XPB2_ARATH RecName: Full=DNA repair helicase XPB2; AltName: Full=ERCC3 homolog 2; AltName: Full=RAD25 homolog 2; Short=AtXPB2; AltName: Full=XPB homolog 2 gi|11037022|gb|AAG27465.1|AF308595_1 putative DNA repair protein and transcription factor [Arabidopsis thaliana] gi|47606402|gb|AAT36214.1| putative DNA repair and transcription factor XBP2 [Arabidopsis thaliana] gi|332007286|gb|AED94669.1| DNA repair helicase XPB2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356528573|ref|XP_003532875.1| PREDICTED: DNA repair helicase XPB1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
TAIR|locus:2177901767 XPB1 "homolog of xeroderma pig 0.996 0.664 0.868 5.8e-240
TAIR|locus:2177891766 XPB2 "homolog of Xeroderma pig 0.994 0.664 0.859 2.3e-236
DICTYBASE|DDB_G0278729800 repB "transcription factor IIH 0.925 0.592 0.640 1.2e-159
UNIPROTKB|G3V1S1718 ERCC3 "Excision repair cross-c 0.919 0.655 0.616 7.4e-153
UNIPROTKB|P19447782 ERCC3 "TFIIH basal transcripti 0.919 0.602 0.616 7.4e-153
UNIPROTKB|Q5RA62782 ERCC3 "TFIIH basal transcripti 0.919 0.602 0.616 7.4e-153
UNIPROTKB|Q60HG1782 ERCC3 "TFIIH basal transcripti 0.919 0.602 0.616 7.4e-153
UNIPROTKB|Q1RMT1782 ERCC3 "TFIIH basal transcripti 0.919 0.602 0.614 1.2e-152
UNIPROTKB|F1NZ23787 ERCC3 "TFIIH basal transcripti 0.957 0.622 0.590 3.2e-152
UNIPROTKB|E2RN68779 ERCC3 "Uncharacterized protein 0.919 0.604 0.612 3.2e-152
TAIR|locus:2177901 XPB1 "homolog of xeroderma pigmentosum complementation group B 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2313 (819.3 bits), Expect = 5.8e-240, P = 5.8e-240
 Identities = 444/511 (86%), Positives = 469/511 (91%)

Query:     1 MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 60
             MLEEYDFRNDNVNPDL+MELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG
Sbjct:   257 MLEEYDFRNDNVNPDLDMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 316

Query:    61 VSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTT 120
             VSAA RIKKSCLCLATNAVSVDQWAFQFKLWSTI+DDQICRFTSDSKERFRGNAGVVVTT
Sbjct:   317 VSAAARIKKSCLCLATNAVSVDQWAFQFKLWSTIRDDQICRFTSDSKERFRGNAGVVVTT 376

Query:   121 YNMVAFGGXXXXXXXXXXXXXXXXXWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTAT 180
             YNMVAFGG                 WGLLLMDEVHVVPAHMFRKVIS+TKSHCKLGLTAT
Sbjct:   377 YNMVAFGGKRSEESEKIIEEMRNREWGLLLMDEVHVVPAHMFRKVISITKSHCKLGLTAT 436

Query:   181 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSK 240
             LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFF+EYLKKENSK
Sbjct:   437 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFAEYLKKENSK 496

Query:   241 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV 300
             KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSH+
Sbjct:   497 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHI 556

Query:   301 ERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 360
             ERTKIL+AFK S+D+NT+FLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK
Sbjct:   557 ERTKILEAFKTSKDVNTVFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 616

Query:   361 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGAD 420
             GKLEDRMAGGKEEYNAFFYSLVSTDTQEM+YSTKRQQFLIDQGYSFKVITSLPPPD+G+ 
Sbjct:   617 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMYYSTKRQQFLIDQGYSFKVITSLPPPDAGSS 676

Query:   421 LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYM 480
             LSYH  +EQL+LLGKV++AGDD VGLEQL+ED D +AL KARR  GSMS MSG++GMVYM
Sbjct:   677 LSYHSQEEQLSLLGKVMNAGDDLVGLEQLEEDTDGMALQKARRSMGSMSVMSGSKGMVYM 736

Query:   481 EYSTXXXXXXXXXXXXPKDPSKRHYLFKRRF 511
             EY++            PKDP+KRH LFK+R+
Sbjct:   737 EYNSGRHKSGQQFKK-PKDPTKRHNLFKKRY 766
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006289 "nucleotide-excision repair" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0009636 "response to toxic substance" evidence=IMP
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009411 "response to UV" evidence=IEP
TAIR|locus:2177891 XPB2 "homolog of Xeroderma pigmentosum complementation group B 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278729 repB "transcription factor IIH subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1S1 ERCC3 "Excision repair cross-complementing rodent repair deficiency, complementation group 3 (Xeroderma pigmentosum group B complementing), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P19447 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RA62 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q60HG1 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMT1 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ23 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN68 ERCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FUG4XPB2_ARATH3, ., 6, ., 4, ., 1, 20.89820.99410.6644yesno
Q8SSK1RAD25_ENCCU3, ., 6, ., 4, ., 1, 20.58080.83980.6178yesno
Q38861XPB1_ARATH3, ., 6, ., 4, ., 1, 20.90990.99600.6649yesno
Q5ZKK7ERCC3_CHICK3, ., 6, ., 4, ., 1, 20.60760.94920.6167yesno
Q7ZVV1ERCC3_DANRE3, ., 6, ., 4, ., 1, 20.60380.94530.6189yesno
Q5RA62ERCC3_PONAB3, ., 6, ., 4, ., 1, 20.60850.94140.6163yesno
Q1RMT1ERCC3_BOVIN3, ., 6, ., 4, ., 1, 20.60510.95500.6253yesno
O13768ERCC3_SCHPO3, ., 6, ., 4, ., 1, 20.58460.96090.6119yesno
O00835ERCC3_DICDI3, ., 6, ., 4, ., 1, 20.63650.96280.6162yesno
Q4G005ERCC3_RAT3, ., 6, ., 4, ., 1, 20.59610.94330.6176yesno
P49135ERCC3_MOUSE3, ., 6, ., 4, ., 1, 20.60070.94140.6155yesno
P19447ERCC3_HUMAN3, ., 6, ., 4, ., 1, 20.60850.94140.6163yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_703813.1
annotation not avaliable (767 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.1__253__AT1G03190.1
annotation not avaliable (758 aa)
    ••• 0.793
fgenesh2_kg.7__2607__AT4G17020.2
annotation not avaliable (452 aa)
    ••• 0.649
fgenesh2_kg.1__2008__AT1G18340.1
annotation not avaliable (301 aa)
    ••• 0.538
fgenesh2_kg.7__493__AT4G35800.1
annotation not avaliable (1839 aa)
    ••• 0.503
fgenesh2_kg.1__1344__AT1G12400.1
annotation not avaliable (71 aa)
    ••• 0.490
fgenesh2_kg.1__449__AT1G05055.1
annotation not avaliable (421 aa)
    ••• 0.473

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
TIGR00603732 TIGR00603, rad25, DNA repair helicase rad25 0.0
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 8e-99
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-11
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-10
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-09
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-08
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-04
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 0.003
>gnl|CDD|233046 TIGR00603, rad25, DNA repair helicase rad25 Back     alignment and domain information 
 Score =  929 bits (2404), Expect = 0.0
 Identities = 354/519 (68%), Positives = 410/519 (78%), Gaps = 27/519 (5%)

Query: 1   MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 60
           +LEEYDFRND VNPDLN++LKP  Q RPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG
Sbjct: 231 LLEEYDFRNDTVNPDLNIDLKPTTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVG 290

Query: 61  VSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTT 120
           V+AAC +KKSCL L T+AVSV+QW  QFK+WSTI D QICRFTSD+KERF G AGVVV+T
Sbjct: 291 VTAACTVKKSCLVLCTSAVSVEQWKQQFKMWSTIDDSQICRFTSDAKERFHGEAGVVVST 350

Query: 121 YNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTAT 180
           Y+MVA  GKRS ESEK++E + NREWGL+L+DEVHVVPA MFR+V+++ ++HCKLGLTAT
Sbjct: 351 YSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRRVLTIVQAHCKLGLTAT 410

Query: 181 LVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSK 240
           LVRED++ITDLNFLIGPKLYEANW++L K GFIANVQCAEVWCPMT EF+ EYL +ENS+
Sbjct: 411 LVREDDKITDLNFLIGPKLYEANWMELQKKGFIANVQCAEVWCPMTPEFYREYL-RENSR 469

Query: 241 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHV 300
           K+  LYVMNPNKFRAC+FLIRFHE QRGDKIIVF+DN+FAL EYA+KL KP IYG TS  
Sbjct: 470 KRMLLYVMNPNKFRACQFLIRFHE-QRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQQ 528

Query: 301 ERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAK 360
           ER +ILQ F+ +  +NTIFLSKVGD SID+PEANV+IQISSH GSRRQEAQRLGRILRAK
Sbjct: 529 ERMQILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHYGSRRQEAQRLGRILRAK 588

Query: 361 GKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGAD 420
              +       EEYNAFFYSLVS DTQEM+YSTKRQ+FL+DQGYSFKVIT LP  D+ ++
Sbjct: 589 KGSDA------EEYNAFFYSLVSKDTQEMYYSTKRQRFLVDQGYSFKVITHLPGMDNESN 642

Query: 421 LSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALH----------KARRIAGSMSA 470
           L+Y   +EQL LL KVL AGD    LE L+ +    AL           KA R  GS+S+
Sbjct: 643 LAYSSKEEQLELLQKVLLAGDLDAELEVLEGEFGSRALGASRSMSSASGKAVRRGGSLSS 702

Query: 471 MSGAQGMVYMEYSTGQKKLGLGQKGKPKDPSKRHYLFKR 509
           +SG   M YMEY     K         K   + H LFK+
Sbjct: 703 LSGGDDMAYMEYRKPAIK---------KSKKEVHPLFKK 732

All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 732
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
KOG1123776 consensus RNA polymerase II transcription initiati 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 100.0
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 100.0
KOG0387 923 consensus Transcription-coupled repair protein CSB 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 100.0
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG4439901 consensus RNA polymerase II transcription terminat 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG1002791 consensus Nucleotide excision repair protein RAD16 100.0
PRK00254 720 ski2-like helicase; Provisional 99.98
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 99.98
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.97
PRK01172 674 ski2-like helicase; Provisional 99.97
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.97
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.97
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.97
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.97
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.97
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.97
COG4096 875 HsdR Type I site-specific restriction-modification 99.97
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.97
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.96
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.96
COG1204 766 Superfamily II helicase [General function predicti 99.96
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.96
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.96
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.96
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.96
COG1202 830 Superfamily II helicase, archaea-specific [General 99.96
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.95
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.95
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.95
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.95
KOG0347731 consensus RNA helicase [RNA processing and modific 99.95
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.95
PHA02653675 RNA helicase NPH-II; Provisional 99.95
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.94
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.94
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.94
PRK09401 1176 reverse gyrase; Reviewed 99.94
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.94
KOG4284 980 consensus DEAD box protein [Transcription] 99.94
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.94
COG1205 851 Distinct helicase family with a unique C-terminal 99.94
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.94
KOG0346569 consensus RNA helicase [RNA processing and modific 99.93
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.93
PRK05580679 primosome assembly protein PriA; Validated 99.93
COG4889 1518 Predicted helicase [General function prediction on 99.92
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.92
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.91
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.91
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.91
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.91
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.91
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 99.91
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.91
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.9
PRK14701 1638 reverse gyrase; Provisional 99.9
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.89
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.89
PRK09694878 helicase Cas3; Provisional 99.89
KOG0327397 consensus Translation initiation factor 4F, helica 99.89
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.88
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.87
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.87
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.87
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.85
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.85
KOG1001674 consensus Helicase-like transcription factor HLTF/ 99.85
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.85
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.85
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.83
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.81
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.81
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.8
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.8
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.8
PRK05298652 excinuclease ABC subunit B; Provisional 99.79
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.78
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.77
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.76
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.75
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.74
COG0610 962 Type I site-specific restriction-modification syst 99.73
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.73
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.71
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.67
smart00487201 DEXDc DEAD-like helicases superfamily. 99.67
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.66
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.66
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.64
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.64
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.64
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.63
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.63
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.62
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.6
KOG0383696 consensus Predicted helicase [General function pre 99.59
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.59
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.57
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.55
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.55
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.51
PRK15483 986 type III restriction-modification system StyLTI en 99.5
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.48
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.44
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.43
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.42
smart0049082 HELICc helicase superfamily c-terminal domain. 99.36
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.32
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.31
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.3
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.24
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.22
PRK14873665 primosome assembly protein PriA; Provisional 99.19
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.15
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.13
COG3587 985 Restriction endonuclease [Defense mechanisms] 99.11
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 99.07
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.06
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.05
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.05
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.98
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 98.91
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.7
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.67
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.62
KOG0298 1394 consensus DEAD box-containing helicase-like transc 98.61
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.54
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 98.48
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.43
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.38
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.22
PRK10536262 hypothetical protein; Provisional 98.14
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.14
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.05
KOG1803649 consensus DNA helicase [Replication, recombination 98.03
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.97
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.94
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.91
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.91
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.9
TIGR00376637 DNA helicase, putative. The gene product may repre 97.89
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.82
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.81
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.81
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.81
KOG02981394 consensus DEAD box-containing helicase-like transc 97.8
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.74
PF13871278 Helicase_C_4: Helicase_C-like 97.64
PF1324576 AAA_19: Part of AAA domain 97.63
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.62
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.61
PRK04296190 thymidine kinase; Provisional 97.45
PRK13342413 recombination factor protein RarA; Reviewed 97.42
PRK06526254 transposase; Provisional 97.41
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 97.35
PRK08181269 transposase; Validated 97.29
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.29
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.27
KOG18051100 consensus DNA replication helicase [Replication, r 97.27
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.24
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.24
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.23
PRK05707328 DNA polymerase III subunit delta'; Validated 97.23
PRK13341 725 recombination factor protein RarA/unknown domain f 97.2
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.16
smart00382148 AAA ATPases associated with a variety of cellular 97.16
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.1
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.09
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.08
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.08
PLN03025319 replication factor C subunit; Provisional 97.02
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 97.02
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.98
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.96
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.96
PHA02544316 44 clamp loader, small subunit; Provisional 96.96
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.94
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.93
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.93
KOG2028554 consensus ATPase related to the helicase subunit o 96.84
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.76
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.72
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.71
PRK12402337 replication factor C small subunit 2; Reviewed 96.64
PRK08084235 DNA replication initiation factor; Provisional 96.59
PRK08727233 hypothetical protein; Validated 96.59
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.57
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.56
PHA02533534 17 large terminase protein; Provisional 96.55
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 96.54
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.54
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.53
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.46
PHA03333752 putative ATPase subunit of terminase; Provisional 96.44
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.4
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.4
PRK07952244 DNA replication protein DnaC; Validated 96.39
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.38
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.38
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.37
PF00004132 AAA: ATPase family associated with various cellula 96.37
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.33
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.33
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 96.32
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.31
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.28
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.27
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.26
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.25
PRK07940394 DNA polymerase III subunit delta'; Validated 96.25
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 96.23
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.22
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.22
PRK06835329 DNA replication protein DnaC; Validated 96.18
PRK14974336 cell division protein FtsY; Provisional 96.18
KOG1131 755 consensus RNA polymerase II transcription initiati 96.17
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.15
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.14
PRK08116268 hypothetical protein; Validated 96.14
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 96.13
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 96.13
PRK06893229 DNA replication initiation factor; Validated 96.12
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.1
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.03
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.01
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.01
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.98
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.94
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.93
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.89
PRK12377248 putative replication protein; Provisional 95.89
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.89
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.86
PRK04195482 replication factor C large subunit; Provisional 95.84
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.83
PRK04328249 hypothetical protein; Provisional 95.83
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.83
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 95.82
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.8
PRK05642234 DNA replication initiation factor; Validated 95.79
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 95.77
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 95.76
PHA02244383 ATPase-like protein 95.76
PRK06871325 DNA polymerase III subunit delta'; Validated 95.74
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 95.66
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.65
PRK06921266 hypothetical protein; Provisional 95.65
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.64
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.64
PRK00149450 dnaA chromosomal replication initiation protein; R 95.64
PRK03992389 proteasome-activating nucleotidase; Provisional 95.63
PRK08769319 DNA polymerase III subunit delta'; Validated 95.63
PRK00440319 rfc replication factor C small subunit; Reviewed 95.59
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.59
CHL00181287 cbbX CbbX; Provisional 95.58
PRK11054684 helD DNA helicase IV; Provisional 95.56
PRK11823446 DNA repair protein RadA; Provisional 95.56
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.5
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.42
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.42
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.41
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.4
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.39
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.37
PRK06964342 DNA polymerase III subunit delta'; Validated 95.36
PF13173128 AAA_14: AAA domain 95.36
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.33
PTZ00293211 thymidine kinase; Provisional 95.32
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 95.31
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.29
PRK09112351 DNA polymerase III subunit delta'; Validated 95.28
PRK06067234 flagellar accessory protein FlaH; Validated 95.28
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.27
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.24
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.24
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.23
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 95.19
PHA03368738 DNA packaging terminase subunit 1; Provisional 95.18
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.16
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 95.15
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.15
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.05
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.04
CHL00095 821 clpC Clp protease ATP binding subunit 95.03
PRK06090319 DNA polymerase III subunit delta'; Validated 94.98
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.98
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.93
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.91
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.88
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 94.87
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 94.87
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.86
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.86
PRK09354349 recA recombinase A; Provisional 94.84
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.77
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 94.76
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.76
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.73
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.7
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.68
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.67
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.67
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.64
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.63
PTZ001121164 origin recognition complex 1 protein; Provisional 94.62
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.62
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.6
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.6
cd01393226 recA_like RecA is a bacterial enzyme which has rol 94.59
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 94.59
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.57
PRK10865 857 protein disaggregation chaperone; Provisional 94.52
PRK07471365 DNA polymerase III subunit delta'; Validated 94.51
PRK07993334 DNA polymerase III subunit delta'; Validated 94.51
PRK08699325 DNA polymerase III subunit delta'; Validated 94.51
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 94.48
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.47
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.45
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.43
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.43
KOG2340698 consensus Uncharacterized conserved protein [Funct 94.42
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 94.39
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.36
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 94.35
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.3
CHL00176638 ftsH cell division protein; Validated 94.25
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 94.2
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 94.04
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 94.03
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 94.01
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 94.0
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 93.97
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.95
PRK14087450 dnaA chromosomal replication initiation protein; P 93.94
PRK12422445 chromosomal replication initiation protein; Provis 93.87
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.86
COG2255332 RuvB Holliday junction resolvasome, helicase subun 93.8
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.8
PRK07399314 DNA polymerase III subunit delta'; Validated 93.78
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 93.77
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.7
PRK08939306 primosomal protein DnaI; Reviewed 93.67
PRK14086617 dnaA chromosomal replication initiation protein; P 93.64
PRK06620214 hypothetical protein; Validated 93.51
PRK08058329 DNA polymerase III subunit delta'; Validated 93.51
CHL00195489 ycf46 Ycf46; Provisional 93.48
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 93.42
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 93.42
PRK14088440 dnaA chromosomal replication initiation protein; P 93.42
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.34
PRK09183259 transposase/IS protein; Provisional 93.33
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.29
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.27
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.25
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.19
PRK13833323 conjugal transfer protein TrbB; Provisional 93.13
PRK00771437 signal recognition particle protein Srp54; Provisi 93.08
PRK10416318 signal recognition particle-docking protein FtsY; 93.06
PRK04301317 radA DNA repair and recombination protein RadA; Va 92.93
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 92.92
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.89
PRK10867433 signal recognition particle protein; Provisional 92.84
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 92.78
COG4626546 Phage terminase-like protein, large subunit [Gener 92.72
PRK10865857 protein disaggregation chaperone; Provisional 92.7
CHL00095821 clpC Clp protease ATP binding subunit 92.66
KOG1807 1025 consensus Helicases [Replication, recombination an 92.66
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.6
PHA03372668 DNA packaging terminase subunit 1; Provisional 92.52
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 92.47
PRK05564313 DNA polymerase III subunit delta'; Validated 92.47
CHL00206 2281 ycf2 Ycf2; Provisional 92.42
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 92.4
COG3973747 Superfamily I DNA and RNA helicases [General funct 92.35
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 92.33
PRK04132846 replication factor C small subunit; Provisional 92.29
KOG0734752 consensus AAA+-type ATPase containing the peptidas 92.28
TIGR02236310 recomb_radA DNA repair and recombination protein R 92.18
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 92.13
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.09
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 92.08
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 92.01
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.95
TIGR00064272 ftsY signal recognition particle-docking protein F 91.93
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 91.82
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 91.81
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 91.77
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 91.57
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 91.54
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.43
KOG0745564 consensus Putative ATP-dependent Clp-type protease 91.41
PLN03186342 DNA repair protein RAD51 homolog; Provisional 91.39
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 91.35
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 91.3
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 91.29
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 91.23
TIGR00959428 ffh signal recognition particle protein. This mode 91.22
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 91.2
PRK09302509 circadian clock protein KaiC; Reviewed 91.13
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.1
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 91.03
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 90.98
TIGR00767415 rho transcription termination factor Rho. Members 90.98
PTZ00035337 Rad51 protein; Provisional 90.82
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.76
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 90.74
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 90.71
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 90.69
PF00154322 RecA: recA bacterial DNA recombination protein; In 90.67
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 90.55
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 90.38
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 90.3
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 90.28
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 90.2
KOG2543438 consensus Origin recognition complex, subunit 5 [R 90.18
PRK09519 790 recA DNA recombination protein RecA; Reviewed 90.15
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 90.02
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.82
cd01394218 radB RadB. The archaeal protein radB shares simila 89.8
PLN02165334 adenylate isopentenyltransferase 89.77
cd03115173 SRP The signal recognition particle (SRP) mediates 89.72
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 89.6
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 89.59
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 89.51
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 89.42
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 89.42
TIGR00595 505 priA primosomal protein N'. All proteins in this f 89.34
KOG0731774 consensus AAA+-type ATPase containing the peptidas 89.32
PF11496297 HDA2-3: Class II histone deacetylase complex subun 89.27
PF04364137 DNA_pol3_chi: DNA polymerase III chi subunit, HolC 89.26
PRK05973237 replicative DNA helicase; Provisional 89.22
COG0593408 DnaA ATPase involved in DNA replication initiation 89.13
PRK09376416 rho transcription termination factor Rho; Provisio 89.07
PRK12608380 transcription termination factor Rho; Provisional 88.83
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 88.77
COG0703172 AroK Shikimate kinase [Amino acid transport and me 88.62
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 88.59
PRK10436462 hypothetical protein; Provisional 88.52
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 88.41
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 88.35
TIGR02974329 phageshock_pspF psp operon transcriptional activat 88.21
TIGR02688449 conserved hypothetical protein TIGR02688. Members 88.1
PRK13851344 type IV secretion system protein VirB11; Provision 88.06
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 88.03
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 88.0
PRK05580 679 primosome assembly protein PriA; Validated 87.92
PRK14873 665 primosome assembly protein PriA; Provisional 87.89
PRK05917290 DNA polymerase III subunit delta'; Validated 87.87
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 87.76
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.51
PHA02774613 E1; Provisional 87.46
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 87.27
PRK04841 903 transcriptional regulator MalT; Provisional 87.21
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 87.07
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-123  Score=907.44  Aligned_cols=477  Identities=73%  Similarity=1.166  Sum_probs=465.5

Q ss_pred             CccccccccCCCCCCCccCCCCCCCCcHHHHHHHHHHHhCCCCcceEEEcCCCCcHHHHHHHHHHhcCCCEEEEEcChhh
Q 010367            1 MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVS   80 (512)
Q Consensus         1 ~l~~yd~~~~~~~~~~~~~l~~~~~Lr~yQ~~al~~~~~~~~~~~~il~~~tG~GKTl~~i~~i~~~~~~~Lvl~P~~~L   80 (512)
                      ||+||||+||+.||+++|+|||..++||||++++++||+|+++|+|||++|||+|||+++++++++++++|||+|.+.+.
T Consensus       278 lLeEYDFRND~~npdl~idLKPst~iRpYQEksL~KMFGNgRARSGiIVLPCGAGKtLVGvTAa~tikK~clvLcts~VS  357 (776)
T KOG1123|consen  278 LLEEYDFRNDNVNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGVTAACTIKKSCLVLCTSAVS  357 (776)
T ss_pred             hhhhhccccCCCCCCCCcCcCcccccCchHHHHHHHHhCCCcccCceEEEecCCCCceeeeeeeeeecccEEEEecCccC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhCCCCCcEEEEcCCccccccCCCeEEEEchhhhhccCCCchhHHHHHHHHhcCCccEEEEcCCCCCCch
Q 010367           81 VDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAH  160 (512)
Q Consensus        81 ~~Qw~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~Ivv~T~~~l~~~~~r~~~~~~~~~~l~~~~~~lvIiDEaH~~~~~  160 (512)
                      ++||..+|..|+++.+..|++|+++.++.+..+++|+|+||.|+.+..+|+++++++++++..++||++|+||+|.+++.
T Consensus       358 VeQWkqQfk~wsti~d~~i~rFTsd~Ke~~~~~~gvvvsTYsMva~t~kRS~eaek~m~~l~~~EWGllllDEVHvvPA~  437 (776)
T KOG1123|consen  358 VEQWKQQFKQWSTIQDDQICRFTSDAKERFPSGAGVVVTTYSMVAYTGKRSHEAEKIMDFLRGREWGLLLLDEVHVVPAK  437 (776)
T ss_pred             HHHHHHHHHhhcccCccceEEeeccccccCCCCCcEEEEeeehhhhcccccHHHHHHHHHHhcCeeeeEEeehhccchHH
Confidence            99999999999999999999999999998899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcccceEEEEcccCCCCcchHhhhHhhhCCceeeecHHHHHhCCCcccceeEEEEcCCCHHHHHHHHHhhchH
Q 010367          161 MFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSK  240 (512)
Q Consensus       161 ~~~~~l~~~~~~~~l~LTATp~~~~~~~~~l~~l~gp~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~  240 (512)
                      +|++++..+.+|++||||||.+|+|+++.+|++++||++|+++|+++.+.|+|++++|.++||||+++||++|+ +...+
T Consensus       438 MFRRVlsiv~aHcKLGLTATLvREDdKI~DLNFLIGPKlYEAnWmdL~~kGhIA~VqCaEVWCpMt~eFy~eYL-~~~t~  516 (776)
T KOG1123|consen  438 MFRRVLSIVQAHCKLGLTATLVREDDKITDLNFLIGPKLYEANWMDLQKKGHIAKVQCAEVWCPMTPEFYREYL-RENTR  516 (776)
T ss_pred             HHHHHHHHHHHHhhccceeEEeeccccccccceeecchhhhccHHHHHhCCceeEEeeeeeecCCCHHHHHHHH-hhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999 79999


Q ss_pred             HHHHHhhcCcchHHHHHHHHHHhhhcCCCeEEEEecCHHHHHHHHHHhCCCceeCCCCHHHHHHHHHHhhCCCCccEEEE
Q 010367          241 KKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFL  320 (512)
Q Consensus       241 ~~~~~~~~~~~k~~~l~~ll~~~~~~~g~k~iVf~~~~~~~~~l~~~L~~~~i~g~~~~~eR~~il~~F~~~~~~~vlv~  320 (512)
                      ++.++++|||+||++|++|+++|+ .+|+|+|||++++..+..+|-+|+.++|+|.+++.||++|+++|+.++.+++||.
T Consensus       517 kr~lLyvMNP~KFraCqfLI~~HE-~RgDKiIVFsDnvfALk~YAikl~KpfIYG~Tsq~ERm~ILqnFq~n~~vNTIFl  595 (776)
T KOG1123|consen  517 KRMLLYVMNPNKFRACQFLIKFHE-RRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQNERMKILQNFQTNPKVNTIFL  595 (776)
T ss_pred             hhheeeecCcchhHHHHHHHHHHH-hcCCeEEEEeccHHHHHHHHHHcCCceEECCCchhHHHHHHHhcccCCccceEEE
Confidence            999999999999999999999999 8999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCcccccCccccEEEEecCCCCCHHHHHHHhhcccccCCCccccccCCCCceeEEEEEEEeCCcHhhHHHHHHHHHHH
Q 010367          321 SKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLI  400 (512)
Q Consensus       321 t~~~~~GlDlp~~~~vI~~~~~~~s~~~~~Q~~GR~~R~g~~~~~~~~~~~~~~~~~~y~lv~~~t~e~~~~~~r~~~l~  400 (512)
                      +++|+++||+|+|+|+|++++|.||+++.+||+||++|++++++       +++++|||+||++||.||+|+.+||+||+
T Consensus       596 SKVgDtSiDLPEAnvLIQISSH~GSRRQEAQRLGRILRAKk~~d-------e~fnafFYSLVS~DTqEM~YStKRQ~FLi  668 (776)
T KOG1123|consen  596 SKVGDTSIDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKRND-------EEFNAFFYSLVSKDTQEMYYSTKRQQFLI  668 (776)
T ss_pred             eeccCccccCCcccEEEEEcccccchHHHHHHHHHHHHHhhcCc-------cccceeeeeeeecchHHHHhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999998       99999999999999999999999999999


Q ss_pred             hcCCceEEeeCCCCCCCCCCCcCCCHHHHHHHHHHHHhcCCccccccccCCchhhhhhhhhhhcccccccccCCCCceee
Q 010367          401 DQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYM  480 (512)
Q Consensus       401 ~~g~~~~~i~~~~~~~~~~~~~~~~~~e~~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (512)
                      +|||+|+||+++++|++.+++.|.+++||++||+.||.++|.+.++|..++++  ...+++.|+.|+|++||||++|+||
T Consensus       669 dQGYsfkVit~L~gme~~~~l~y~skeeq~~LLq~Vl~a~d~~~e~E~~~~~~--~~~~~a~r~~gslssmsGgd~m~Y~  746 (776)
T KOG1123|consen  669 DQGYSFKVITNLPGMENLEDLAYASKEEQLELLQKVLLASDLDAELEDLEDES--RASSKAVRSEGSLSSMSGGDDMAYM  746 (776)
T ss_pred             hcCceEEEeecCCCcCcCcccccCCHHHHHHHHHHHHhcchhhhccccccccc--cccccceecccccccccCCCcceee
Confidence            99999999999999999999999999999999999999999999888775542  3356788999999999999999999


Q ss_pred             eeecCccc
Q 010367          481 EYSTGQKK  488 (512)
Q Consensus       481 ~~~~~~~~  488 (512)
                      ||+.+++|
T Consensus       747 ey~~~~~k  754 (776)
T KOG1123|consen  747 EYNSSRNK  754 (776)
T ss_pred             eecccccc
Confidence            99999993

>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
4ern_A289 Crystal Structure Of The C-terminal Domain Of Human 8e-89
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 3e-28
2fzl_A219 Structure Of C-Terminal Domain Of Archaeoglobus Ful 8e-11
2fz4_A237 Crystal Structure Of The N-Terminal Half Of Archaeo 1e-09
>pdb|4ERN|A Chain A, Crystal Structure Of The C-terminal Domain Of Human Xpb/ercc-3 Excision Repair Protein At 1.80 A Length = 289 Back     alignment and structure 
Iteration: 1

 Score =  324 bits (830), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 216/312 (69%), Gaps = 33/312 (10%)
Query: 205 LDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHE 264
           ++L   G+IA VQCAEVWCPM+ EF+ EY+  + +KK+  LY MNPNKFRAC+FLI+FHE
Sbjct: 1   MELQNNGYIAKVQCAEVWCPMSPEFYREYVAIK-TKKRILLYTMNPNKFRACQFLIKFHE 59
Query: 265 QQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVG 324
           + R DKIIVFADN+FAL EYA++L KP IYG TS  ER +ILQ FK +  +NTIF+SKVG
Sbjct: 60  R-RNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVG 118
Query: 325 DNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVST 384
           D S D+PEANV+IQISSH GSRRQEAQRLGR+LRAK  +        EEYNAFFYSLVS 
Sbjct: 119 DTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGM------VAEEYNAFFYSLVSQ 172
Query: 385 DTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAV 444
           DTQEM YSTKRQ+FL+DQGYSFKVIT L   +   DL++   +EQ  LL KVL+A D   
Sbjct: 173 DTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEE-EDLAFSTKEEQQQLLQKVLAATD--- 228
Query: 445 GLEQLDEDADDIA------LHKARRIAGSMSAMSGAQGMVYMEYSTXXXXXXXXXXXXPK 498
               LD + + +A        +A R  G+MS+MSGA   VYMEY +             K
Sbjct: 229 ----LDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRS----------K 274
Query: 499 DPSKR-HYLFKR 509
            PSK  H LFKR
Sbjct: 275 APSKHVHPLFKR 286
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure
>pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 Back     alignment and structure
>pdb|2FZ4|A Chain A, Crystal Structure Of The N-Terminal Half Of Archaeoglobus Fulgidus Xpb Length = 237 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-130
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-62
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 6e-12
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-09
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 8e-04
3h1t_A590 Type I site-specific restriction-modification syst 2e-06
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 3e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 9e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-04
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-04
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
 Score =  385 bits (990), Expect = e-130
 Identities = 112/441 (25%), Positives = 186/441 (42%), Gaps = 77/441 (17%)

Query: 3   EEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVS 62
              +F ++  +P            R YQEK+L +   + R   G IVLP G+GK+ V ++
Sbjct: 71  NGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKR---GCIVLPTGSGKTHVAMA 127

Query: 63  AACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYN 122
           A   +    L +       +QW  +  ++    ++ +  F+   KE       + V+TY+
Sbjct: 128 AINELSTPTLIVVPTLALAEQWKERLGIFG---EEYVGEFSGRIKE----LKPLTVSTYD 180

Query: 123 MVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLV 182
                         +  E     + LL+ DEVH +PA  + ++  ++ +  +LGLTAT  
Sbjct: 181 SA-----------YVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE 229

Query: 183 REDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKK 242
           RED R   L  ++G K++E    D + G  +A      ++ P+ ++   EY K+E   K+
Sbjct: 230 REDGRHEILKEVVGGKVFELFP-DSLAGKHLAKYTIKRIFVPLAEDERVEYEKREKVYKQ 288

Query: 243 QA--------------------------------------LYVMNPNKFRACEFLIRFHE 264
                                                   +   + NK R    ++  H 
Sbjct: 289 FLRARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARRIAFNSKNKIRKLREILERH- 347

Query: 265 QQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVG 324
             R DKII+F  +   +   +     P I   TS  ER +IL+ F+ +     I  S+V 
Sbjct: 348 --RKDKIIIFTRHNELVYRISKVFLIPAITHRTSREEREEILEGFR-TGRFRAIVSSQVL 404

Query: 325 DNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVST 384
           D  ID+P+ANV + +S   GS R+  QRLGRILR           GK+E  A  Y L+S 
Sbjct: 405 DEGIDVPDANVGVIMSGS-GSAREYIQRLGRILRPS--------KGKKE--AVLYELISR 453

Query: 385 DTQEMFYSTKRQQFLIDQGYS 405
            T E+  + +R+     +G +
Sbjct: 454 GTGEVNTARRRK--NAAKGAA 472
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Length = 282 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Length = 590 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.95
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.95
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.95
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.95
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.95
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.94
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.94
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.94
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.93
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.92
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.92
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.91
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.9
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.88
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.88
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.84
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.83
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.83
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.82
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.82
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.82
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.82
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.81
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.81
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.81
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.81
3jux_A822 Protein translocase subunit SECA; protein transloc 99.81
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.8
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.8
3bor_A237 Human initiation factor 4A-II; translation initiat 99.8
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.8
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.79
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.79
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.79
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.77
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.77
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.77
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.76
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.75
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.72
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.7
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.53
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.69
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.63
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.58
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.46
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.32
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.39
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.31
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.29
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.23
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.22
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.18
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 98.1
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.76
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.71
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.62
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.53
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.34
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.33
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.22
3pvs_A447 Replication-associated recombination protein A; ma 97.15
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.12
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.1
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.06
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.98
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.95
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.93
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.92
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.82
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.74
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.73
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.71
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.59
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.55
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.49
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.47
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.46
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 96.46
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.43
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.41
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.41
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.38
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.33
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.31
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.3
3co5_A143 Putative two-component system transcriptional RES 96.3
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.29
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.27
3bos_A242 Putative DNA replication factor; P-loop containing 96.26
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.24
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.21
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.19
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.17
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.13
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.11
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.09
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.04
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.99
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.89
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.87
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.85
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.81
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.79
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 95.75
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.65
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.55
2chq_A319 Replication factor C small subunit; DNA-binding pr 95.52
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.49
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.49
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.46
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.33
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.31
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.3
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.26
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.21
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.16
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.15
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.12
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.92
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.85
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.74
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.66
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.56
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.49
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.46
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.27
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 94.26
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.2
2z43_A324 DNA repair and recombination protein RADA; archaea 94.05
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.41
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.31
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.22
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.22
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.18
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.15
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 93.11
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 93.04
1u94_A356 RECA protein, recombinase A; homologous recombinat 93.0
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 92.86
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.83
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.74
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.57
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 92.35
3io5_A333 Recombination and repair protein; storage dimer, i 92.18
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 91.66
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.46
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.38
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 91.22
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 91.09
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 91.0
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 90.79
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 90.17
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 89.83
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 89.74
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 89.68
1tue_A212 Replication protein E1; helicase, replication, E1E 89.63
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 89.56
4a74_A231 DNA repair and recombination protein RADA; hydrola 89.03
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 88.76
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 88.59
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 88.33
1vma_A306 Cell division protein FTSY; TM0570, structural gen 88.26
2xxa_A433 Signal recognition particle protein; protein trans 88.08
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 88.08
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 88.01
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.72
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.54
2r44_A331 Uncharacterized protein; putative ATPase, structur 87.27
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 87.25
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 86.71
2qgz_A308 Helicase loader, putative primosome component; str 86.45
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 86.32
2r62_A268 Cell division protease FTSH homolog; ATPase domain 86.04
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 85.52
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 85.2
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.0
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 84.91
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.47
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 84.44
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 84.19
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 84.15
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 83.63
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 83.4
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 83.28
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 82.85
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 82.55
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 82.48
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 82.25
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 82.2
1p9r_A418 General secretion pathway protein E; bacterial typ 81.96
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 81.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 81.52
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 81.48
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 81.42
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 81.26
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 81.03
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 80.9
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 80.85
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 80.64
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 80.38
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 80.32
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 80.25
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-49  Score=419.38  Aligned_cols=342  Identities=30%  Similarity=0.455  Sum_probs=282.8

Q ss_pred             CCCCCCCCcHHHHHHHHHHHhCCCCcceEEEcCCCCcHHHHHHHHHHhcCCCEEEEEcChhhHHHHHHHHHHhhCCCCCc
Q 010367           19 ELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQ   98 (512)
Q Consensus        19 ~l~~~~~Lr~yQ~~al~~~~~~~~~~~~il~~~tG~GKTl~~i~~i~~~~~~~Lvl~P~~~L~~Qw~~~~~~~~~~~~~~   98 (512)
                      .++..++|+|||.++++.++.++   ++++++|||+|||++++.++...++++|||||+++|+.||.++|.+| +   ..
T Consensus        87 ~~~~~~~l~~~Q~~ai~~i~~~~---~~ll~~~TGsGKT~~~l~~i~~~~~~~Lvl~P~~~L~~Q~~~~~~~~-~---~~  159 (472)
T 2fwr_A           87 YFDAEISLRDYQEKALERWLVDK---RGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIF-G---EE  159 (472)
T ss_dssp             CCCCCCCBCHHHHHHHHHHTTTT---EEEEECCTTSCHHHHHHHHHHHHCSCEEEEESSHHHHHHHHHHGGGG-C---GG
T ss_pred             cccCCCCcCHHHHHHHHHHHhcC---CEEEEeCCCCCHHHHHHHHHHHcCCCEEEEECCHHHHHHHHHHHHhC-C---Cc
Confidence            45567899999999999988775   79999999999999999999999999999999999999999999995 3   35


Q ss_pred             -EEEEcCCccccccCCCeEEEEchhhhhccCCCchhHHHHHHHHhcCCccEEEEcCCCCCCchHHHHHHHhcccceEEEE
Q 010367           99 -ICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGL  177 (512)
Q Consensus        99 -v~~~~~~~~~~~~~~~~Ivv~T~~~l~~~~~r~~~~~~~~~~l~~~~~~lvIiDEaH~~~~~~~~~~l~~~~~~~~l~L  177 (512)
                       +..++|+.+.    ..+|+|+||+++...          .+.+ ...|++||+||||++.++.|..++..+...++|+|
T Consensus       160 ~v~~~~g~~~~----~~~Ivv~T~~~l~~~----------~~~~-~~~~~liIvDEaH~~~~~~~~~~~~~~~~~~~l~l  224 (472)
T 2fwr_A          160 YVGEFSGRIKE----LKPLTVSTYDSAYVN----------AEKL-GNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGL  224 (472)
T ss_dssp             GEEEBSSSCBC----CCSEEEEEHHHHHHT----------HHHH-TTTCSEEEEETGGGTTSTTTHHHHHTCCCSEEEEE
T ss_pred             ceEEECCCcCC----cCCEEEEEcHHHHHH----------HHHh-cCCCCEEEEECCcCCCChHHHHHHHhcCCCeEEEE
Confidence             8888888654    478999999988653          2233 25699999999999999999999999999999999


Q ss_pred             cccCCCCcchHhhhHhhhCCceeeecHHHHHhCCCcccceeEEEEcCCCHHHHHHHHHhhc-------------------
Q 010367          178 TATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKEN-------------------  238 (512)
Q Consensus       178 TATp~~~~~~~~~l~~l~gp~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~-------------------  238 (512)
                      ||||.++++....+..++||..+...+.++ ..+++.++.+..+.+++++.....|-....                   
T Consensus       225 SATp~~~~~~~~~l~~~~~~~~~~~~~~~l-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  303 (472)
T 2fwr_A          225 TATFEREDGRHEILKEVVGGKVFELFPDSL-AGKHLAKYTIKRIFVPLAEDERVEYEKREKVYKQFLRARGITLRRAEDF  303 (472)
T ss_dssp             ESCCCCTTSGGGSHHHHTCCEEEECCHHHH-TSCCCCSEEECCEEECCCHHHHHHTTTTTHHHHSCSSSCCCTTTCCSSS
T ss_pred             ecCccCCCCHHHHHHHHhCCeEeecCHHHH-hcCcCCCeEEEEEEcCCCHHHHHHHHHHHHHHHHHHHhcCccccchhhH
Confidence            999999998888899999999999999998 677888888888888888765443210000                   


Q ss_pred             -------------------hHHHHHHhhcCcchHHHHHHHHHHhhhcCCCeEEEEecCHHHHHHHHHHhCCCceeCCCCH
Q 010367          239 -------------------SKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSH  299 (512)
Q Consensus       239 -------------------~~~~~~~~~~~~~k~~~l~~ll~~~~~~~g~k~iVf~~~~~~~~~l~~~L~~~~i~g~~~~  299 (512)
                                         ......+......|...+..++..+   .+.++||||+++..++.+++.|++..+||+++.
T Consensus       304 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~l~~~l~~~---~~~k~lvF~~~~~~~~~l~~~l~~~~~~g~~~~  380 (472)
T 2fwr_A          304 NKIVMASGYDERAYEALRAWEEARRIAFNSKNKIRKLREILERH---RKDKIIIFTRHNELVYRISKVFLIPAITHRTSR  380 (472)
T ss_dssp             TTTTTTTCCSSSSSTTTHHHHHHHHHHHSCSHHHHHHHHHHHHT---SSSCBCCBCSCHHHHHHHHHHTTCCBCCSSSCS
T ss_pred             HHHHHHhccCHHHHHHHHHHHHHHHHhhcChHHHHHHHHHHHhC---CCCcEEEEECCHHHHHHHHHHhCcceeeCCCCH
Confidence                               0011122344566888888888764   488999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhCCCCccEEEEeCCCcccccCccccEEEEecCCCCCHHHHHHHhhcccccCCCccccccCCCCceeEEEE
Q 010367          300 VERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFY  379 (512)
Q Consensus       300 ~eR~~il~~F~~~~~~~vlv~t~~~~~GlDlp~~~~vI~~~~~~~s~~~~~Q~~GR~~R~g~~~~~~~~~~~~~~~~~~y  379 (512)
                      .+|.+++++|+++ +++|||+|+++++|+|+|++++||+++.++ |+..+.|++||+||.|+++          ..+++|
T Consensus       381 ~~R~~~~~~F~~g-~~~vLv~T~~~~~Gldlp~~~~Vi~~~~~~-s~~~~~Q~~GR~~R~g~~k----------~~~~i~  448 (472)
T 2fwr_A          381 EEREEILEGFRTG-RFRAIVSSQVLDEGIDVPDANVGVIMSGSG-SAREYIQRLGRILRPSKGK----------KEAVLY  448 (472)
T ss_dssp             HHHHTHHHHHHHS-SCSBCBCSSCCCSSSCSCCBSEEEEECCSS-CCHHHHHHHHHSBCCCTTT----------CCEEEE
T ss_pred             HHHHHHHHHHhCC-CCCEEEEcCchhcCcccccCcEEEEECCCC-CHHHHHHHHhhccCCCCCC----------ceEEEE
Confidence            9999999999997 999999999999999999999999998876 9999999999999999431          579999


Q ss_pred             EEEeCCcHhhHHHHHHHHH
Q 010367          380 SLVSTDTQEMFYSTKRQQF  398 (512)
Q Consensus       380 ~lv~~~t~e~~~~~~r~~~  398 (512)
                      .+++.+|.|+.++++|++.
T Consensus       449 ~lv~~~t~ee~~~~~r~~~  467 (472)
T 2fwr_A          449 ELISRGTGEVNTARRRKNA  467 (472)
T ss_dssp             EEEECSCC-----------
T ss_pred             EEEeCCCchHHHHHHHHHh
Confidence            9999999999999888743
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 8e-24
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 4e-12
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 2e-11
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-07
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-07
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 5e-06
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 1e-05
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 1e-05
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 4e-04
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.004
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 96.9 bits (240), Expect = 8e-24
 Identities = 40/178 (22%), Positives = 72/178 (40%), Gaps = 21/178 (11%)

Query: 4   EYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSA 63
             +F ++  +P            R YQEK+L +   + R   G IVLP G+GK+ V ++A
Sbjct: 49  GIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKR---GCIVLPTGSGKTHVAMAA 105

Query: 64  ACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNM 123
              +    L +       +QW  +  ++      +            +    + V+TY+ 
Sbjct: 106 INELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGR-------IKELKPLTVSTYDS 158

Query: 124 VAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATL 181
                           E     + LL+ DEVH +PA  + ++  ++ +  +LGLTAT 
Sbjct: 159 AYV-----------NAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATF 205
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.95
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.93
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.93
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.9
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.88
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.88
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.84
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.83
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.83
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.83
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.83
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.82
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.82
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.81
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.79
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.79
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.79
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.77
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.77
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.77
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.76
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.74
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.74
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.72
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.71
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.71
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.69
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.67
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.67
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.66
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.64
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.62
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.61
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.57
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.52
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.52
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.49
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.46
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.24
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.8
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.73
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.24
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.07
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.92
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.83
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.67
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.59
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.58
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.27
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 96.85
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.67
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 96.66
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.66
d2qy9a2211 GTPase domain of the signal recognition particle r 96.62
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.53
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.5
d1okkd2207 GTPase domain of the signal recognition particle r 96.49
d1vmaa2213 GTPase domain of the signal recognition particle r 96.44
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.38
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.37
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.35
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.26
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.17
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.07
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.05
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 96.0
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.95
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.88
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.77
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.66
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.53
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.39
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.47
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.46
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.32
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.17
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.04
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.84
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.71
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.62
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.52
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.41
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.41
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.35
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.28
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.07
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 92.94
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.34
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.24
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.96
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.68
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.38
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.33
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.29
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.26
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 90.42
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 90.38
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.37
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.37
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.32
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.21
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.2
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 90.13
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.07
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.95
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.95
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 89.48
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.32
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.11
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 88.54
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.37
d1tuea_205 Replication protein E1 helicase domain {Human papi 87.47
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 86.84
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 86.83
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.55
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 86.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.45
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 86.2
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.97
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 85.96
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.89
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.12
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 84.75
d1em8a_147 DNA polymerase III chi subunit {Escherichia coli [ 84.52
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.21
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.93
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 83.85
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 83.62
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 83.5
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 83.11
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 82.3
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 81.92
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.91
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.72
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 80.05
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.95  E-value=1.5e-27  Score=220.19  Aligned_cols=155  Identities=27%  Similarity=0.487  Sum_probs=128.7

Q ss_pred             ccccCCCCCCCccCCCCCCCCcHHHHHHHHHHHhCCCCcceEEEcCCCCcHHHHHHHHHHhcCCCEEEEEcChhhHHHHH
Q 010367            6 DFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWA   85 (512)
Q Consensus         6 d~~~~~~~~~~~~~l~~~~~Lr~yQ~~al~~~~~~~~~~~~il~~~tG~GKTl~~i~~i~~~~~~~Lvl~P~~~L~~Qw~   85 (512)
                      +|.++..++......+..++|||||++|++.++.++   ++++++|||+|||++++.+++..++++|||||+++|+.||.
T Consensus        51 ~~~d~~~~~~~~~~~~~~~~Lr~yQ~eav~~~~~~~---~~ll~~~tG~GKT~~a~~~~~~~~~~~Liv~p~~~L~~q~~  127 (206)
T d2fz4a1          51 EFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDK---RGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWK  127 (206)
T ss_dssp             CEEEESCCCCCCCCCCCCCCCCHHHHHHHHHHTTTS---EEEEEESSSTTHHHHHHHHHHHSCSCEEEEESSHHHHHHHH
T ss_pred             ceeeccccccCCCCCCCCCCcCHHHHHHHHHHHhCC---CcEEEeCCCCCceehHHhHHHHhcCceeEEEcccchHHHHH
Confidence            445444444444456677899999999999998775   79999999999999999999999999999999999999999


Q ss_pred             HHHHHhhCCCCCcEEEEcCCccccccCCCeEEEEchhhhhccCCCchhHHHHHHHHhcCCccEEEEcCCCCCCchHHHHH
Q 010367           86 FQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKV  165 (512)
Q Consensus        86 ~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~Ivv~T~~~l~~~~~r~~~~~~~~~~l~~~~~~lvIiDEaH~~~~~~~~~~  165 (512)
                      ++|..|..   ..+..+.+..+.    ...|+|+|++.+...          .+.+ ..+|++||+||||+++++.+.++
T Consensus       128 ~~~~~~~~---~~~~~~~~~~~~----~~~i~i~t~~~~~~~----------~~~~-~~~~~lvIiDEaH~~~a~~~~~i  189 (206)
T d2fz4a1         128 ERLGIFGE---EYVGEFSGRIKE----LKPLTVSTYDSAYVN----------AEKL-GNRFMLLIFDEVHHLPAESYVQI  189 (206)
T ss_dssp             HHHGGGCG---GGEEEESSSCBC----CCSEEEEEHHHHHHT----------HHHH-TTTCSEEEEECSSCCCTTTHHHH
T ss_pred             HHHHhhcc---cchhhccccccc----ccccccceehhhhhh----------hHhh-CCcCCEEEEECCeeCCcHHHHHH
Confidence            99998743   356777776543    367999999988654          1222 26799999999999999999999


Q ss_pred             HHhcccceEEEEcccC
Q 010367          166 ISLTKSHCKLGLTATL  181 (512)
Q Consensus       166 l~~~~~~~~l~LTATp  181 (512)
                      +..++++++||||||+
T Consensus       190 ~~~~~~~~~lgLTATl  205 (206)
T d2fz4a1         190 AQMSIAPFRLGLTATF  205 (206)
T ss_dssp             HHTCCCSEEEEEEESC
T ss_pred             HhccCCCcEEEEecCC
Confidence            9999899999999998
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure