Citrus Sinensis ID: 010384

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--

MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAMYT

cccccccccccccccHHHHHHHHHHHHEHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEHHHHHHHHccccccccccccccccccHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccEEEEEEEEEEEccccEEEEEccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccEEccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHHHHcccHHHHHHHcccEEEcccccccccccccccccHHHHHcc

cccccccccccccHHHHHHHHHHHHHcHEEHcccccEEEEEcccccccccccccccccccccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEccccccEEEHHHHHHHccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHccccccHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEEEEcccccEEccEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHccHHHHHHHHHHHHHHHHHHcEcccEEccEcccccHHHHHHHHHHHHHHHcccccHHccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccEEEEccccccHHHHHHHHHHHHHHccHHHHHHHccccEEcccccccEEEEEcccccccccccc

mllpvgglgmnstmdDMNLIQQAQRHHLVVRElgeeidleigpgdddpsfannplmggprepsaeehdqnkqmgmvsqlpnddqdmsktqpakrKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREygrkhrrnpygnegsrnMQMSALEEHNNSLLHKEALRLQMASkdkiiadkPIYVKALMSKTAGSIVEAalkrdpheIEFIQSVQESLHALERVIAKNSHYVNIMERLlepermivfrvpwvddrgethvnrGFRVQFsqalgpcrgglrfhpsmnLSIAKFLGFEQTLKNalspyklggaaggsdfdpkgksdnEIMRFCQSFMNEIHrylgpdkdlpseemgvgtreMGYLFGQYRRlaghfqgsftgprifwsgsslrteatgYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAygaipvsvsdakgylvdedgfdymKISFLRDIKSQQRSLRDYSKTYarskyydeakpwneRLSYTCRRFKYAMYT

MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSqlpnddqdmsktqpakrkkkvvkrwreewadtykwayvdvkegTARIFCSVCReygrkhrrnpygnegsRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLrdiksqqrslrdysktyarskyydeakpwnerlsyTCRRFKYAMYT

MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAkrkkkvvkrwreewADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAMYT

************************RHHLVVRELG***************************************************************VVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYG**************************************ASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG*****************IMRFCQSFMNEIHRYLG**********GVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAM**

********GMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPL**********************************************WREEWADTYKWAYVDVKEGTARIFCSVCREYG****************************L*KEAL**********************SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAMY*

MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP************QMGMVSQLP**********************REEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAMYT

*LLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPL**********************QLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGS*NMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERLSYTCRRFKYAMYT

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		512	2.2.26 [Sep-21-2011]
P28724		449	NADP-specific glutamate d	N/A	no	0.597	0.681	0.501	9e-91
P95544		444	NAD(P)-specific glutamate	no	no	0.595	0.686	0.472	1e-83
P55990		448	NADP-specific glutamate d	yes	no	0.566	0.647	0.489	2e-82
P15111		447	NADP-specific glutamate d	yes	no	0.574	0.657	0.486	4e-82
Q8Z6F6		447	NADP-specific glutamate d	N/A	no	0.574	0.657	0.486	4e-82
P28998		523	NADP-specific glutamate d	N/A	no	0.570	0.558	0.488	6e-82
Q9ZKD8		448	NADP-specific glutamate d	yes	no	0.566	0.647	0.486	8e-82
Q8RQP4		447	NADP-specific glutamate d	yes	no	0.572	0.655	0.506	3e-81
P43793		449	NADP-specific glutamate d	yes	no	0.597	0.681	0.467	9e-81
P00370		447	NADP-specific glutamate d	N/A	no	0.574	0.657	0.483	2e-80

>sp\|P28724\|DHE4_GIAIN NADP-specific glutamate dehydrogenase OS=Giardia intestinalis PE=2 SV=1	Back alignment and function desciption

 Score =  334 bits (857), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 216/307 (70%), Gaps = 1/307 (0%)

Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRV 249
           ++T   ++    +RD H  EF Q+V+E + +L+ +  +   Y+ I ER+LEPER+I+FRV
Sbjct: 3   AQTIEELIAVIKQRDGHMTEFRQAVEEVVDSLKVIFEREPKYIPIFERMLEPERVIIFRV 62

Query: 250 PWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG 309
           PW+DD G  +VNRGFRVQ++ ALGP +GGLRFHPS+NLSI KFLGFEQ LKN+L+   +G
Sbjct: 63  PWMDDAGRINVNRGFRVQYNSALGPYKGGLRFHPSVNLSILKFLGFEQILKNSLTTLPMG 122

Query: 310 GAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRR 369
           G  GGSDFDPKGKSDNE+MRFCQSFM E+ R++G D D+P+ ++GVG RE+GYL+GQY+R
Sbjct: 123 GGKGGSDFDPKGKSDNEVMRFCQSFMTELQRHVGADTDVPAGDIGVGAREIGYLYGQYKR 182

Query: 370 LAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM 429
           L   F G  TG  + W GS +R EATGYG V+F + +  D N  ++G   ++SGSG +A 
Sbjct: 183 LRNEFTGVLTGKNVKWGGSFIRPEATGYGAVYFLEEMCKDNNTVIRGKNVLLSGSGNVAQ 242

Query: 430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRS-LRDYSKTYARSKY 488
              EKLI  GA  ++ SD+ G +VD+DGF+  K++ L  +K+++R  + ++   Y    Y
Sbjct: 243 FACEKLIQLGAKVLTFSDSNGTIVDKDGFNEEKLAHLMYLKNEKRGRVSEFKDKYPSVAY 302

Query: 489 YDEAKPW 495
           Y+  KPW
Sbjct: 303 YEGKKPW 309

Giardia intestinalis (taxid: 5741)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 4

>sp\|P95544\|DHE4_PRERU NAD(P)-specific glutamate dehydrogenase OS=Prevotella ruminicola GN=gdhA PE=1 SV=1	Back alignment and function description

>sp\|P55990\|DHE4_HELPY NADP-specific glutamate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gdhA PE=3 SV=1	Back alignment and function description

>sp\|P15111\|DHE4_SALTY NADP-specific glutamate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gdhA PE=3 SV=2	Back alignment and function description

>sp\|Q8Z6F6\|DHE4_SALTI NADP-specific glutamate dehydrogenase OS=Salmonella typhi GN=gdhA PE=3 SV=1	Back alignment and function description

>sp\|P28998\|DHE4_CHLSO NADP-specific glutamate dehydrogenase (Fragment) OS=Chlorella sorokiniana PE=2 SV=1	Back alignment and function description

>sp\|Q9ZKD8\|DHE4_HELPJ NADP-specific glutamate dehydrogenase OS=Helicobacter pylori (strain J99) GN=gdhA PE=3 SV=1	Back alignment and function description

>sp\|Q8RQP4\|DHE4_COREF NADP-specific glutamate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gdh PE=3 SV=2	Back alignment and function description

>sp\|P43793\|DHE4_HAEIN NADP-specific glutamate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gdhA PE=3 SV=1	Back alignment and function description

>sp\|P00370\|DHE4_ECOLI NADP-specific glutamate dehydrogenase OS=Escherichia coli (strain K12) GN=gdhA PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		512
449458193		637	PREDICTED: NADP-specific glutamate dehyd	0.982	0.789	0.911	0.0
225442347		635	PREDICTED: NADP-specific glutamate dehyd	0.978	0.788	0.913	0.0
356526047		637	PREDICTED: NADP-specific glutamate dehyd	0.982	0.789	0.869	0.0
255549662		636	glutamate dehydrogenase, putative [Ricin	0.982	0.790	0.895	0.0
356522684		637	PREDICTED: NADP-specific glutamate dehyd	0.982	0.789	0.865	0.0
30695050		637	glutamate dehydrogenase (NADP+) [Arabido	0.982	0.789	0.849	0.0
297847546		624	hypothetical protein ARALYDRAFT_474290 [	0.957	0.785	0.860	0.0
12321666		624	NADP-specific glutatamate dehydrogenase,	0.957	0.785	0.855	0.0
224128524		621	predicted protein [Populus trichocarpa]	0.951	0.784	0.876	0.0
147768438		638	hypothetical protein VITISV_043645 [Viti	0.953	0.764	0.831	0.0

>gi\|449458193\|ref\|XP_004146832.1\| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] gi\|449527615\|ref\|XP_004170805.1\| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/506 (91%), Positives = 493/506 (97%), Gaps = 3/506 (0%)

Query: 1   MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
           MLLPVGGLGMN++MDDMNLIQQAQRHHLVVRELGEEIDLEIG GDDDPSFA+ P++GGP 
Sbjct: 1   MLLPVGGLGMNTSMDDMNLIQQAQRHHLVVRELGEEIDLEIGHGDDDPSFASTPIIGGPV 60

Query: 60  REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKE 119
           REPSAE+HD++K + +VSQL NDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVK+
Sbjct: 61  REPSAEDHDESKHVVLVSQLSNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKD 120

Query: 120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
           GTARIFCSVC+EYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKII 
Sbjct: 121 GTARIFCSVCKEYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIV 180

Query: 180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
           DKPIYVKALMSKTAGSI+EAALKRDP+E+EFIQ+VQE++HALERVIAKNSHYVNIMERLL
Sbjct: 181 DKPIYVKALMSKTAGSIIEAALKRDPNEVEFIQAVQEAVHALERVIAKNSHYVNIMERLL 240

Query: 240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
           EPERM++FRVPWVDDRGETHVNRGFRVQF+QALGPCRGGLRFHPSMNLSI KFLGFEQTL
Sbjct: 241 EPERMVLFRVPWVDDRGETHVNRGFRVQFNQALGPCRGGLRFHPSMNLSITKFLGFEQTL 300

Query: 300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
           KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSF+NEI+RYLGPDKDLPSEEMGVGTRE
Sbjct: 301 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFINEIYRYLGPDKDLPSEEMGVGTRE 360

Query: 360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
           MGYLFGQYRRLAGHF+GSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC
Sbjct: 361 MGYLFGQYRRLAGHFEGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 420

Query: 420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
            VSGSGKIAMHVLEKLIAYGA+P++VSD+KGYLVDEDGFDYMKISFLRDIK+QQRSLRDY
Sbjct: 421 AVSGSGKIAMHVLEKLIAYGALPITVSDSKGYLVDEDGFDYMKISFLRDIKAQQRSLRDY 480

Query: 480 SKTYARSKYYDEAKPWNER--LSYTC 503
           SKTYARSKYYDE KPWNER  +++ C
Sbjct: 481 SKTYARSKYYDEGKPWNERCDVAFPC 506

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225442347\|ref\|XP_002281123.1\| PREDICTED: NADP-specific glutamate dehydrogenase-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356526047\|ref\|XP_003531631.1\| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max]	Back alignment and taxonomy information

>gi\|255549662\|ref\|XP_002515882.1\| glutamate dehydrogenase, putative [Ricinus communis] gi\|223544787\|gb\|EEF46302.1\| glutamate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356522684\|ref\|XP_003529976.1\| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max]	Back alignment and taxonomy information

>gi\|30695050\|ref\|NP_175583.2\| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] gi\|332194586\|gb\|AEE32707.1\| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297847546\|ref\|XP_002891654.1\| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] gi\|297337496\|gb\|EFH67913.1\| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|12321666\|gb\|AAG50868.1\|AC025294_6 NADP-specific glutatamate dehydrogenase, putative [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224128524\|ref\|XP_002329025.1\| predicted protein [Populus trichocarpa] gi\|222839696\|gb\|EEE78019.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147768438\|emb\|CAN69269.1\| hypothetical protein VITISV_043645 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		512
TAIR\|locus:2017542		637	AT1G51720 [Arabidopsis thalian	0.982	0.789	0.822	3.3e-230
GENEDB_PFALCIPARUM\|PF14_0286		510	PF14_0286 "glutamate dehydroge	0.583	0.586	0.506	5.3e-88
UNIPROTKB\|Q8ILF7		510	PF14_0286 "Glutamate dehydroge	0.583	0.586	0.506	5.3e-88
GENEDB_PFALCIPARUM\|PF14_0164		470	PF14_0164 "NADP-specific gluta	0.648	0.706	0.447	1.5e-81
UNIPROTKB\|Q8ILT0		470	PF14_0164 "Glutamate dehydroge	0.648	0.706	0.447	1.5e-81
UNIPROTKB\|Q8RQP4		447	gdh "NADP-specific glutamate d	0.572	0.655	0.506	1.4e-78
UNIPROTKB\|P95544		444	gdhA "NAD(P)-specific glutamat	0.595	0.686	0.472	1.8e-78
UNIPROTKB\|P31026		447	gdh "NADP-specific glutamate d	0.572	0.655	0.503	1.3e-77
UNIPROTKB\|P15111		447	gdhA "NADP-specific glutamate	0.587	0.673	0.478	1.1e-76
UNIPROTKB\|P55990		448	gdhA "NADP-specific glutamate	0.566	0.647	0.489	1.5e-76

TAIR\|locus:2017542 AT1G51720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2221 (786.9 bits), Expect = 3.3e-230, P = 3.3e-230
 Identities = 416/506 (82%), Positives = 461/506 (91%)

Query:     1 MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
             M  P GGLGMN +MDDMNLIQQAQRH LVV  LGEEIDLEIGPG+DD +FANN L+GGP 
Sbjct:     1 MFGPTGGLGMNPSMDDMNLIQQAQRHQLVVSNLGEEIDLEIGPGEDDAAFANNSLIGGPP 60

Query:    60 REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAXXXXXXXXXXXXXXADTYKWAYVDVKE 119
             REPS  EHD+ K M +VS LP++DQD+SK  PA              ADTYKWAYVD+K+
Sbjct:    61 REPSTGEHDETKHMVLVSDLPSEDQDISKGTPAKRKKKVVKRWREEWADTYKWAYVDMKD 120

Query:   120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
             GTARIFCS+CREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQ ASKDKI+ 
Sbjct:   121 GTARIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKDKIVV 180

Query:   180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
             DKPIYVK +MSK+AGSIVE ALKRDP+EIEF+QSVQES+HALERVIAKNSHYVNIMERLL
Sbjct:   181 DKPIYVKTVMSKSAGSIVEGALKRDPNEIEFVQSVQESVHALERVIAKNSHYVNIMERLL 240

Query:   240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
             EPERMIVFRVPW+DDRGETHVNRGFRVQF+QALGPCRGG+RFHPSMNLSIAKFLGF+QTL
Sbjct:   241 EPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFLGFQQTL 300

Query:   300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
             KNALSPYKLGGA+GGSDFDPKGKSDNEIMRFCQSFMNE++RY+GPDKDLPSEE+GVGTRE
Sbjct:   301 KNALSPYKLGGASGGSDFDPKGKSDNEIMRFCQSFMNEMYRYMGPDKDLPSEEVGVGTRE 360

Query:   360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
             MGYLFGQYRRLAG FQGSFTGPRI+W+ SSLRTEA+GYG+V+FA+LILADMNKE+KGLRC
Sbjct:   361 MGYLFGQYRRLAGQFQGSFTGPRIYWAASSLRTEASGYGVVYFARLILADMNKEIKGLRC 420

Query:   420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
             VVSG GKIAMHV+EKLIA GA PV+VSD+KGYLVD+DGFDYMK++FLRDIKSQQRSLRDY
Sbjct:   421 VVSGCGKIAMHVVEKLIACGAHPVTVSDSKGYLVDDDGFDYMKLAFLRDIKSQQRSLRDY 480

Query:   480 SKTYARSKYYDEAKPWNER--LSYTC 503
             SKTYAR+KY+DE KPWNER  +++ C
Sbjct:   481 SKTYARAKYFDELKPWNERCDVAFPC 506

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0006520 "cellular amino acid metabolic process" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA;ISS

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0008295 "spermidine biosynthetic process" evidence=RCA

GO:0010413 "glucuronoxylan metabolic process" evidence=RCA

GO:0045492 "xylan biosynthetic process" evidence=RCA

GENEDB_PFALCIPARUM\|PF14_0286 PF14_0286 "glutamate dehydrogenase, putative" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8ILF7 PF14_0286 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF14_0164 PF14_0164 "NADP-specific glutamate dehydrogenase" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8ILT0 PF14_0164 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8RQP4 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium efficiens YS-314 (taxid:196164)]	Back alignment and assigned GO terms

UNIPROTKB\|P95544 gdhA "NAD(P)-specific glutamate dehydrogenase" [Prevotella ruminicola (taxid:839)]	Back alignment and assigned GO terms

UNIPROTKB\|P31026 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium glutamicum ATCC 13032 (taxid:196627)]	Back alignment and assigned GO terms

UNIPROTKB\|P15111 gdhA "NADP-specific glutamate dehydrogenase" [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 (taxid:99287)]	Back alignment and assigned GO terms

UNIPROTKB\|P55990 gdhA "NADP-specific glutamate dehydrogenase" [Helicobacter pylori 26695 (taxid:85962)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.4.1	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		512
PRK09414		445	PRK09414, PRK09414, glutamate dehydrogenase; Provi	1e-160
PTZ00079		454	PTZ00079, PTZ00079, NADP-specific glutamate dehydr	1e-148
PRK14030		445	PRK14030, PRK14030, glutamate dehydrogenase; Provi	1e-112
PRK14031		444	PRK14031, PRK14031, glutamate dehydrogenase; Provi	1e-108
COG0334		411	COG0334, GdhA, Glutamate dehydrogenase/leucine deh	1e-94
pfam02812		131	pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr	1e-61
cd05313		254	cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain	5e-57
PLN02477		410	PLN02477, PLN02477, glutamate dehydrogenase	1e-36
pfam00208		237	pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl	4e-23
cd01076		227	cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain	2e-09

>gnl\|CDD\|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional	Back alignment and domain information

 Score =  461 bits (1188), Expect = e-160
 Identities = 164/305 (53%), Positives = 222/305 (72%), Gaps = 7/305 (2%)

Query: 195 SIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWV 252
           S++E   KR+P + EF Q+V+E L +L  V+ KN  Y    I+ERL+EPER+I+FRVPWV
Sbjct: 9   SVLEQVKKRNPGQPEFHQAVREVLESLWPVLEKNPEYAEAGILERLVEPERVIIFRVPWV 68

Query: 253 DDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAA 312
           DD+G+  VNRGFRVQF+ A+GP +GGLRFHPS+NLSI KFLGFEQ  KNAL+   +GG  
Sbjct: 69  DDKGQVQVNRGFRVQFNSAIGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLPIGGGK 128

Query: 313 GGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAG 372
           GGSDFDPKGKSD EIMRFCQSFM E++R++GPD D+P+ ++GVG RE+GYLFGQY+RL  
Sbjct: 129 GGSDFDPKGKSDAEIMRFCQSFMTELYRHIGPDTDVPAGDIGVGGREIGYLFGQYKRLTN 188

Query: 373 HFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVL 432
            F+G  TG  + + GS +RTEATGYGLV+FA+ +L       +G R VVSGSG +A++ +
Sbjct: 189 RFEGVLTGKGLSFGGSLIRTEATGYGLVYFAEEMLKARGDSFEGKRVVVSGSGNVAIYAI 248

Query: 433 EKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDE 491
           EK    GA  V+ SD+ GY+ DE+G D  K   L++IK  +R  + +Y++ +  ++Y + 
Sbjct: 249 EKAQQLGAKVVTCSDSSGYVYDEEGIDLEK---LKEIKEVRRGRISEYAEEFG-AEYLEG 304

Query: 492 AKPWN 496
             PW+
Sbjct: 305 GSPWS 309

Length = 445

>gnl\|CDD\|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain	Back alignment and domain information

>gnl\|CDD\|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2	Back alignment and domain information

>gnl\|CDD\|178095 PLN02477, PLN02477, glutamate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase	Back alignment and domain information

>gnl\|CDD\|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		512
PTZ00079		454	NADP-specific glutamate dehydrogenase; Provisional	100.0
PRK14030		445	glutamate dehydrogenase; Provisional	100.0
PRK14031		444	glutamate dehydrogenase; Provisional	100.0
COG0334		411	GdhA Glutamate dehydrogenase/leucine dehydrogenase	100.0
PRK09414		445	glutamate dehydrogenase; Provisional	100.0
PLN02477		410	glutamate dehydrogenase	100.0
KOG2250		514	consensus Glutamate/leucine/phenylalanine/valine d	100.0
PTZ00324		1002	glutamate dehydrogenase 2; Provisional	100.0
PF02812		131	ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di	100.0
cd05313		254	NAD_bind_2_Glu_DH NAD(P) binding domain of glutama	100.0
PF00208		244	ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val	99.94
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	99.94
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	99.92
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	99.5
COG2902		1592	NAD-specific glutamate dehydrogenase [Amino acid t	98.69
PRK06392		326	homoserine dehydrogenase; Provisional	98.65
PRK08374		336	homoserine dehydrogenase; Provisional	98.64
PF05088		1528	Bac_GDH: Bacterial NAD-glutamate dehydrogenase	98.54
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	98.03
PRK06270		341	homoserine dehydrogenase; Provisional	97.76
PLN02700		377	homoserine dehydrogenase family protein	97.23
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	97.13
PRK06813		346	homoserine dehydrogenase; Validated	96.52
smart00597		90	ZnF_TTF zinc finger in transposases and transcript	96.5
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	96.18
PRK08306		296	dipicolinate synthase subunit A; Reviewed	96.13
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	96.12
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	96.11
PRK09436		819	thrA bifunctional aspartokinase I/homoserine dehyd	96.1
PRK09466		810	metL bifunctional aspartate kinase II/homoserine d	95.99
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	95.98
PTZ00075		476	Adenosylhomocysteinase; Provisional	95.96
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	95.87
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	95.85
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	95.84
PLN02494		477	adenosylhomocysteinase	95.71
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	95.68
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	95.68
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.67
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	95.63
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.61
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	95.56
PRK06487		317	glycerate dehydrogenase; Provisional	95.15
PF02882		160	THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl	95.01
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	94.94
PLN03129		581	NADP-dependent malic enzyme; Provisional	94.86
PRK13243		333	glyoxylate reductase; Reviewed	94.81
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	94.81
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.75
PRK14176		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.67
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	94.66
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.64
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	94.64
PLN02928		347	oxidoreductase family protein	94.63
PRK06932		314	glycerate dehydrogenase; Provisional	94.57
PRK07232		752	bifunctional malic enzyme oxidoreductase/phosphotr	94.54
PRK12861		764	malic enzyme; Reviewed	94.38
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.31
PRK06436		303	glycerate dehydrogenase; Provisional	94.23
COG0499		420	SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me	94.21
PTZ00317		559	NADP-dependent malic enzyme; Provisional	94.14
PRK13529		563	malate dehydrogenase; Provisional	94.11
PRK14191		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.03
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	93.99
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	93.89
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	93.87
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	93.84
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.81
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	93.75
COG0281		432	SfcA Malic enzyme [Energy production and conversio	93.74
PRK06719		157	precorrin-2 dehydrogenase; Validated	93.69
cd01079		197	NAD_bind_m-THF_DH NAD binding domain of methylene-	93.6
PRK12480		330	D-lactate dehydrogenase; Provisional	93.53
PRK00676		338	hemA glutamyl-tRNA reductase; Validated	93.52
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	93.52
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	93.48
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	93.26
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	93.23
PLN02306		386	hydroxypyruvate reductase	93.21
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	93.2
PRK14179		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.14
cd00762		254	NAD_bind_malic_enz NAD(P) binding domain of malic	93.1
PLN03139		386	formate dehydrogenase; Provisional	92.9
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	92.75
PRK14177		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	92.54
PRK13940		414	glutamyl-tRNA reductase; Provisional	92.48
PRK07574		385	formate dehydrogenase; Provisional	92.43
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	92.4
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	92.38
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	92.28
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	92.16
COG0460		333	ThrA Homoserine dehydrogenase [Amino acid transpor	92.0
PRK14183		281	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.92
PRK14190		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.92
PRK13403		335	ketol-acid reductoisomerase; Provisional	91.69
PRK14172		278	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.67
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	91.66
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	91.66
PF03949		255	Malic_M: Malic enzyme, NAD binding domain; InterPr	91.63
PRK12862		763	malic enzyme; Reviewed	91.59
PRK14169		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.59
PLN02616		364	tetrahydrofolate dehydrogenase/cyclohydrolase, put	91.52
PRK14173		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.49
PRK14170		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.48
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	91.43
PRK14186		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.4
PRK14180		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.23
COG0190		283	FolD 5,10-methylene-tetrahydrofolate dehydrogenase	91.14
PLN02516		299	methylenetetrahydrofolate dehydrogenase (NADP+)	91.04
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	91.02
PRK14171		288	bifunctional 5,10-methylene-tetrahydrofolate dehyd	90.96
PRK14178		279	bifunctional 5,10-methylene-tetrahydrofolate dehyd	90.94
PRK12548		289	shikimate 5-dehydrogenase; Provisional	90.82
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	90.81
PRK14166		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	90.79
PRK08605		332	D-lactate dehydrogenase; Validated	90.75
PRK05472		213	redox-sensing transcriptional repressor Rex; Provi	90.73
PRK14187		294	bifunctional 5,10-methylene-tetrahydrofolate dehyd	90.69
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	90.56
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	90.56
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	90.44
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	90.39
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	90.35
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	90.33
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	90.27
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	90.24
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	90.15
PRK14182		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	90.15
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	90.08
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	89.88
PRK09310		477	aroDE bifunctional 3-dehydroquinate dehydratase/sh	89.85
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	89.8
PRK05479		330	ketol-acid reductoisomerase; Provisional	89.77
PRK15116		268	sulfur acceptor protein CsdL; Provisional	89.7
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	89.68
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	89.47
PRK14193		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	89.26
PRK14982		340	acyl-ACP reductase; Provisional	89.18
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.1
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.04
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	88.88
PRK08289		477	glyceraldehyde-3-phosphate dehydrogenase; Reviewed	88.88
PRK14167		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	88.71
COG0569		225	TrkA K+ transport systems, NAD-binding component [	88.37
PRK14181		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	88.33
PLN02897		345	tetrahydrofolate dehydrogenase/cyclohydrolase, put	88.27
PRK08328		231	hypothetical protein; Provisional	88.23
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	88.19
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	88.08
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	87.9
PRK07060		245	short chain dehydrogenase; Provisional	87.9
PRK05717		255	oxidoreductase; Validated	87.9
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	87.89
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	87.81
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	87.73
PLN00203		519	glutamyl-tRNA reductase	87.71
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	87.61
PRK08628		258	short chain dehydrogenase; Provisional	87.54
PRK14184		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	87.54
PRK05225		487	ketol-acid reductoisomerase; Validated	87.5
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	87.38
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	87.32
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	87.28
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	87.23
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	87.2
smart00846		149	Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase,	87.12
PLN02712		667	arogenate dehydrogenase	87.06
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	87.01
KOG0022		375	consensus Alcohol dehydrogenase, class III [Second	86.98
PRK12828		239	short chain dehydrogenase; Provisional	86.98
PRK14168		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	86.94
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	86.91
PRK14174		295	bifunctional 5,10-methylene-tetrahydrofolate dehyd	86.83
PLN02586		360	probable cinnamyl alcohol dehydrogenase	86.8
PRK14185		293	bifunctional 5,10-methylene-tetrahydrofolate dehyd	86.67
KOG2380		480	consensus Prephenate dehydrogenase (NADP+) [Amino	86.57
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	86.37
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	86.32
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	86.25
PRK07523		255	gluconate 5-dehydrogenase; Provisional	86.22
PLN02240		352	UDP-glucose 4-epimerase	85.85
PRK06125		259	short chain dehydrogenase; Provisional	85.76
COG1179		263	Dinucleotide-utilizing enzymes involved in molybdo	85.66
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.61
PF00044		151	Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase,	85.6
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.58
PRK04148		134	hypothetical protein; Provisional	85.52
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	85.51
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	85.49
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.41
PRK08223		287	hypothetical protein; Validated	85.38
PRK06138		252	short chain dehydrogenase; Provisional	85.35
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	85.27
KOG1370		434	consensus S-adenosylhomocysteine hydrolase [Coenzy	85.26
PLN02358		338	glyceraldehyde-3-phosphate dehydrogenase	85.25
PRK05562		223	precorrin-2 dehydrogenase; Provisional	85.19
PRK06841		255	short chain dehydrogenase; Provisional	85.13
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.12
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.12
TIGR01921		324	DAP-DH diaminopimelate dehydrogenase. This model r	85.03
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	84.98
PRK13535		336	erythrose 4-phosphate dehydrogenase; Provisional	84.98
COG0057		335	GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt	84.84
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	84.7
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.68
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	84.67
PRK06949		258	short chain dehydrogenase; Provisional	84.58
PRK06523		260	short chain dehydrogenase; Provisional	84.55
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.51
KOG0069		336	consensus Glyoxylate/hydroxypyruvate reductase (D-	84.5
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	84.39
PRK07774		250	short chain dehydrogenase; Provisional	84.35
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	84.25
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.24
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	84.22
PRK12938		246	acetyacetyl-CoA reductase; Provisional	84.18
PRK06153		393	hypothetical protein; Provisional	83.99
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	83.84
PRK12742		237	oxidoreductase; Provisional	83.78
PRK06300		299	enoyl-(acyl carrier protein) reductase; Provisiona	83.65
PRK09072		263	short chain dehydrogenase; Provisional	83.65
COG2344		211	AT-rich DNA-binding protein [General function pred	83.62
PRK06172		253	short chain dehydrogenase; Provisional	83.43
PRK08642		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	83.33
KOG0068		406	consensus D-3-phosphoglycerate dehydrogenase, D-is	83.26
PRK05875		276	short chain dehydrogenase; Provisional	83.24
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	83.1
PRK08264		238	short chain dehydrogenase; Validated	83.08
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	83.04
COG0059		338	IlvC Ketol-acid reductoisomerase [Amino acid trans	83.0
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	82.98
PRK08703		239	short chain dehydrogenase; Provisional	82.96
PRK06057		255	short chain dehydrogenase; Provisional	82.96
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	82.95
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	82.78
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	82.78
PRK10637		457	cysG siroheme synthase; Provisional	82.67
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	82.64
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	82.56
PRK12939		250	short chain dehydrogenase; Provisional	82.53
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	82.49
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	82.44
PRK07411		390	hypothetical protein; Validated	82.38
PRK09186		256	flagellin modification protein A; Provisional	82.37
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	82.34
PRK07576		264	short chain dehydrogenase; Provisional	82.18
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	82.14
PLN02256		304	arogenate dehydrogenase	82.04
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	82.03
PRK05876		275	short chain dehydrogenase; Provisional	81.99
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	81.98
PRK07806		248	short chain dehydrogenase; Provisional	81.93
PLN02178		375	cinnamyl-alcohol dehydrogenase	81.75
PRK08339		263	short chain dehydrogenase; Provisional	81.74
PRK08936		261	glucose-1-dehydrogenase; Provisional	81.67
PRK05867		253	short chain dehydrogenase; Provisional	81.65
PRK12829		264	short chain dehydrogenase; Provisional	81.64
COG5322		351	Predicted dehydrogenase [General function predicti	81.64
PLN02514		357	cinnamyl-alcohol dehydrogenase	81.6
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	81.51
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	81.43
PRK12748		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	81.33
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	81.32
PLN02896		353	cinnamyl-alcohol dehydrogenase	81.3
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	81.26
PRK07062		265	short chain dehydrogenase; Provisional	81.15
KOG1196		343	consensus Predicted NAD-dependent oxidoreductase [	81.1
TIGR03628		114	arch_S11P archaeal ribosomal protein S11P. This mo	81.03
PRK06197		306	short chain dehydrogenase; Provisional	81.01
PLN02272		421	glyceraldehyde-3-phosphate dehydrogenase	80.98
TIGR01532		325	E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas	80.97
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	80.84
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	80.79
PRK05579		399	bifunctional phosphopantothenoylcysteine decarboxy	80.75
PRK06398		258	aldose dehydrogenase; Validated	80.68
PRK06124		256	gluconate 5-dehydrogenase; Provisional	80.68
PRK12937		245	short chain dehydrogenase; Provisional	80.66
PLN03096		395	glyceraldehyde-3-phosphate dehydrogenase A; Provis	80.63
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	80.61
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	80.6
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	80.51
PRK07326		237	short chain dehydrogenase; Provisional	80.36
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	80.35
cd08231		361	MDR_TM0436_like Hypothetical enzyme TM0436 resembl	80.35
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	80.34
PRK08213		259	gluconate 5-dehydrogenase; Provisional	80.27
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	80.26
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	80.25
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	80.23
PLN02653		340	GDP-mannose 4,6-dehydratase	80.23
PRK07890		258	short chain dehydrogenase; Provisional	80.1
PRK09607		132	rps11p 30S ribosomal protein S11P; Reviewed	80.08
PRK09135		249	pteridine reductase; Provisional	80.04
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	80.02

>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional	Back alignment and domain information

Probab=100.00  E-value=5e-102  Score=817.42  Aligned_cols=319  Identities=50%  Similarity=0.952  Sum_probs=311.2

Q ss_pred             hhHHHHHHHHhhcCCCCccHHHHHHHHHHHHHHHHHhCCccHHHHHHhcCCceEEEEEEeeEcCCCceEEEEEEEEEecC
Q 010384          191 KTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQ  270 (512)
Q Consensus       191 ~~~~~~~~~~~~~~p~~~ef~qav~e~~~~~~~~l~~~p~y~~i~e~L~~PeR~i~~~vp~~~D~G~~~v~~GyRVqHs~  270 (512)
                      ..++++++.+.+++|+|+||+|+|+|+++++.|+|+++|+|.+++++|++|+|+|+|+|||+||+|++++|+|||||||+
T Consensus        12 ~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~~~~~~~~~~~y~~i~e~l~~Per~i~~~vp~~~D~G~v~v~~GyRVqhn~   91 (454)
T PTZ00079         12 QEMDALRKRVKSRDPNQPEFLQAFHEVMTSLKPLFQKNPKYLGVLERLVEPERVIQFRVPWVDDKGEQRVNRGFRVQYNS   91 (454)
T ss_pred             HHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHhChhHHHHHHHhccCceEEEEEEEEEECCCCEEEEeeEEEEEcC
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCeEEecCCCHHHHHHHHHHHHHHHhhcCCCCCCceeEecCCCCCCCHHHHHHHHHHHHHHHHHhcCCCCCCCC
Q 010384          271 ALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPS  350 (512)
Q Consensus       271 alGPaKGGiRfhp~V~ldEvkaLA~~MT~KnALagLP~GGaKGGI~~DPk~~S~~EleR~~r~f~~eL~~~IGp~~DVPA  350 (512)
                      ++|||||||||||+||++|+++||++|||||||++||||||||||+|||+++|+.|+|||||+||++|.+||||++||||
T Consensus        92 alGP~kGGlRfhp~v~~~~vk~La~~mt~KnAl~gLP~GGgKGGi~~dPk~~s~~El~r~~r~f~~eL~~~IGp~~DvpA  171 (454)
T PTZ00079         92 ALGPYKGGLRFHPSVNLSILKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELYRHIGPDTDVPA  171 (454)
T ss_pred             CCCCCCCCEEeeCCCCHHHHHHHHHHHHHHHHhcCCCCCCcceeeecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCChhhHHHHHHHHhhHhCCCCcccCCcccccCCCCCCCCCchhHHHHHHHHHHHHcCCCCCCcEEEEecccHHHHH
Q 010384          351 EEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMH  430 (512)
Q Consensus       351 pDvGT~~reMawm~d~Y~~~~g~~~g~vTGKpl~~GGs~gR~eATG~GV~~~i~eal~~lg~~L~GkrVaIQGfGNVG~~  430 (512)
                      |||||+++||+||+|+|++++++++|++||||+.+|||.+|++||||||+|++++++++++.+|+|+||+||||||||++
T Consensus       172 ~DvGt~~rem~~~~~~y~~~~~~~~gv~TGK~~~~GGs~~r~eATG~Gv~~~~~~~l~~~~~~l~Gk~VaVqG~GnVg~~  251 (454)
T PTZ00079        172 GDIGVGGREIGYLFGQYKKLRNNFEGTLTGKNVKWGGSNIRPEATGYGLVYFVLEVLKKLNDSLEGKTVVVSGSGNVAQY  251 (454)
T ss_pred             hhcCCCHHHHHHHHHHHHHHhCCCCceeCCCCCCCCCCCCCCcccHHHHHHHHHHHHHHcCCCcCCCEEEEECCCHHHHH
Confidence            99999999999999999999998899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCCEEEEEeCCCceeeCCCCCCHhhHHHHHHHHHhc-CccccccccCCCcEEeCCCCccccch--hccccccc
Q 010384          431 VLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERL--SYTCRRFK  507 (512)
Q Consensus       431 aAe~L~e~GakVVaVSDs~G~Iydp~GLDie~L~~L~e~K~~~-G~l~~y~~~~pgA~~i~~~~i~~~~c--l~PcAt~~  507 (512)
                      +|++|++.|+|||||||++|+||||+|||+++|..|+++|+.+ ++|.+|.+.++++++++++++|+++|  ++|||+++
T Consensus       252 aa~~L~e~GakVVavSD~~G~iy~~~Gld~~~l~~l~~~k~~~~g~i~~~~~~~~~a~~~~~~~~~~~~cDI~iPcA~~n  331 (454)
T PTZ00079        252 AVEKLLQLGAKVLTMSDSDGYIHEPNGFTKEKLAYLMDLKNVKRGRLKEYAKHSSTAKYVPGKKPWEVPCDIAFPCATQN  331 (454)
T ss_pred             HHHHHHHCCCEEEEEEcCCCcEECCCCCCHHHHHHHHHHHhhcCCcHHhhhhccCCcEEeCCcCcccCCccEEEeccccc
Confidence            9999999999999999999999999999999998899999876 78999977678899999999999999  99999999


Q ss_pred             cc
Q 010384          508 YA  509 (512)
Q Consensus       508 ~~  509 (512)
                      .+
T Consensus       332 ~I  333 (454)
T PTZ00079        332 EI  333 (454)
T ss_pred             cC
Confidence            75

>PRK14030 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PRK14031 glutamate dehydrogenase; Provisional	Back alignment and domain information

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09414 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PLN02477 glutamate dehydrogenase	Back alignment and domain information

>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PTZ00324 glutamate dehydrogenase 2; Provisional	Back alignment and domain information

>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related	Back alignment and domain information

>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2	Back alignment and domain information

>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06392 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK08374 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PLN02700 homoserine dehydrogenase family protein	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>PRK06813 homoserine dehydrogenase; Validated	Back alignment and domain information

>smart00597 ZnF_TTF zinc finger in transposases and transcription factors	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional	Back alignment and domain information

>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF)	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PLN03129 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed	Back alignment and domain information

>PRK12861 malic enzyme; Reviewed	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]	Back alignment and domain information

>PTZ00317 NADP-dependent malic enzyme; Provisional	Back alignment and domain information

>PRK13529 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>COG0281 SfcA Malic enzyme [Energy production and conversion]	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>PRK00676 hemA glutamyl-tRNA reductase; Validated	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PLN02306 hydroxypyruvate reductase	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e	Back alignment and domain information

>PRK12862 malic enzyme; Reviewed	Back alignment and domain information

>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]	Back alignment and domain information

>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+)	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>PRK05472 redox-sensing transcriptional repressor Rex; Provisional	Back alignment and domain information

>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02586 probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02358 glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01921 DAP-DH diaminopimelate dehydrogenase	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK06153 hypothetical protein; Provisional	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2344 AT-rich DNA-binding protein [General function prediction only]	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>PRK10637 cysG siroheme synthase; Provisional	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02178 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG5322 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PLN02514 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR03628 arch_S11P archaeal ribosomal protein S11P	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02272 glyceraldehyde-3-phosphate dehydrogenase	Back alignment and domain information

>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02653 GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		512
3r3j_A		456	Kinetic And Structural Characterization Of Plasmodi		2e-97
2bma_A		470	The Crystal Structure Of Plasmodium Falciparum Glut		2e-85
2yfh_A		448	Structure Of A Chimeric Glutamate Dehydrogenase Len		6e-83
4fcc_A		450	Glutamate Dehydrogenase From E. Coli Length = 450		4e-82
3sbo_A		447	Structure Of E.Coli Gdh From Native Source Length =		6e-82
2yfg_E		447	Structural Determinants Of Cofactor Specificity And		8e-82
1hrd_A		449	Glutamate Dehydrogenase Length = 449		2e-76
1k89_A		449	K89l Mutant Of Glutamate Dehydrogenase Length = 449		5e-76
1aup_A		449	Glutamate Dehydrogenase Length = 449		6e-76
3k92_A		424	Crystal Structure Of A E93k Mutant Of The Majour Ba		3e-28
1b3b_A		415	Thermotoga Maritima Glutamate Dehydrogenase Mutant		5e-28
1b26_A		416	Glutamate Dehydrogenase Length = 416		6e-28
1euz_A		419	Glutamate Dehydrogenase From Thermococcus Profundus		2e-26
3aoe_E		419	Crystal Structure Of Hetero-Hexameric Glutamate Deh		2e-26
3aog_A		440	Crystal Structure Of Glutamate Dehydrogenase (Gdhb)		3e-26
3aoe_A		424	Crystal Structure Of Hetero-Hexameric Glutamate Deh		4e-26
1bvu_A		418	Glutamate Dehydrogenase From Thermococcus Litoralis		4e-26
3k8z_A		423	Crystal Structure Of Gudb1 A Decryptified Secondary		1e-25
1gtm_A		419	Structure Of Glutamate Dehydrogenase Length = 419		2e-25
2tmg_A		415	Thermotoga Maritima Glutamate Dehydrogenase Mutant		5e-25
1v9l_A		421	L-Glutamate Dehydrogenase From Pyrobaculum Islandic		2e-23
1l1f_A		505	Structure Of Human Glutamate Dehydrogenase-Apo Form		2e-23
3mw9_A		501	Bovine Glutamate Dehydrogenase Complexed With Nadh,		2e-23
1nr1_A		496	Crystal Structure Of The R463a Mutant Of Human Glut		3e-23
3etd_A		501	Structure Of Glutamate Dehydrogenase Complexed With		1e-22
1nqt_A		496	Crystal Structure Of Bovine Glutamate Dehydrogenase		1e-22
2yfq_A		421	Crystal Structure Of Glutamate Dehydrogenase From P		6e-21
1hwy_A		501	Bovine Glutamate Dehydrogenase Complexed With Nad A		1e-20

>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456