Citrus Sinensis ID: 010406
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 511 | 2.2.26 [Sep-21-2011] | |||||||
| Q9UGP5 | 575 | DNA polymerase lambda OS= | yes | no | 0.690 | 0.613 | 0.317 | 1e-52 | |
| Q4R380 | 575 | DNA polymerase lambda OS= | N/A | no | 0.943 | 0.838 | 0.283 | 3e-52 | |
| Q5RKI3 | 573 | DNA polymerase lambda OS= | yes | no | 0.966 | 0.862 | 0.267 | 4e-52 | |
| Q9QXE2 | 573 | DNA polymerase lambda OS= | yes | no | 0.949 | 0.846 | 0.263 | 5e-51 | |
| P06766 | 335 | DNA polymerase beta OS=Ra | no | no | 0.579 | 0.883 | 0.348 | 3e-48 | |
| Q27958 | 335 | DNA polymerase beta OS=Bo | no | no | 0.579 | 0.883 | 0.348 | 7e-48 | |
| O57383 | 334 | DNA polymerase beta OS=Xe | N/A | no | 0.577 | 0.883 | 0.344 | 3e-47 | |
| P06746 | 335 | DNA polymerase beta OS=Ho | no | no | 0.579 | 0.883 | 0.348 | 7e-47 | |
| Q8K409 | 335 | DNA polymerase beta OS=Mu | no | no | 0.579 | 0.883 | 0.342 | 2e-46 | |
| Q6DRD3 | 336 | DNA polymerase beta OS=Da | no | no | 0.579 | 0.880 | 0.349 | 2e-44 |
| >sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 207 bits (528), Expect = 1e-52, Method: Compositional matrix adjust.
Identities = 129/406 (31%), Positives = 202/406 (49%), Gaps = 53/406 (13%)
Query: 133 SDGESSHRKKIKSSTEDVE-----HFQAESKGDVETNALSEAPNSPMSSESLTNTLSTAS 187
SD E+S ++ + S D+E H+ +GD E P + ++ + A
Sbjct: 194 SDDEASDGEETQVSAADLEALISGHYPTSLEGDCE----------PSPAPAVLDKWVCAQ 243
Query: 188 ASPDFSSHHITDPSLLYNPPDLNKNITEIFGKLINIYRALGEDRRSFSYYKAIPVIEKLP 247
S +++H N +ITE L Y G+ R+ Y KAI ++
Sbjct: 244 PSSQKATNH-------------NLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFH 290
Query: 248 FKIESADQVKGLPGIGKSMQDHIQEIVTTGKLSKLEHFEKDEKVRTISLFGEVWGIGPAT 307
+ S + +PGIGK M + I EI+ +G L KL+H E V + LF +WG G T
Sbjct: 291 KPVTSYQEACSIPGIGKRMAEKIIEILESGHLRKLDHI--SESVPVLELFSNIWGAGTKT 348
Query: 308 AQKLYEKGHRTLDDLKNEDSLTHSQRLGLKYFDDIKTRIPRHEVEQMERLLQKAGEEVLP 367
AQ Y++G R+L+D++++ SLT Q +GLK++ D R+PR E ++E+ +QKA +
Sbjct: 349 AQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNS 408
Query: 368 EVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLSKYVKKLKEMKFLREDLIFSTHSE 427
++ + GSYRRGKA+CGD+DV+I HPD +SH+G S+ + L++ FL +DL+ +
Sbjct: 409 GLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENG 468
Query: 428 E-----------------------VYPRDIYAFGLIAWTGNDVLNRRLRLLAESKGYRLD 464
+ V P +A L+ +TG+ NR +R LA++KG L
Sbjct: 469 QQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLS 528
Query: 465 DTGLFPATYGSGGKQGVRARTSLKFDTEKEVFDFLGFPWLEPHERN 510
+ L A + V L TEK+VF LG P+ EP ER+
Sbjct: 529 EHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD 574
|
Repair polymerase. Involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity. Homo sapiens (taxid: 9606) EC: 4EC: .EC: 2EC: .EC: 9EC: 9EC: .EC: - |
| >sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P06766|DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus GN=Polb PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q27958|DPOLB_BOVIN DNA polymerase beta OS=Bos taurus GN=POLB PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|O57383|DPOLB_XENLA DNA polymerase beta OS=Xenopus laevis GN=polb PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P06746|DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens GN=POLB PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q8K409|DPOLB_MOUSE DNA polymerase beta OS=Mus musculus GN=Polb PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q6DRD3|DPOLB_DANRE DNA polymerase beta OS=Danio rerio GN=polb PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 511 | ||||||
| 296086508 | 547 | unnamed protein product [Vitis vinifera] | 0.994 | 0.928 | 0.652 | 0.0 | |
| 359473414 | 543 | PREDICTED: DNA polymerase lambda-like [V | 0.992 | 0.933 | 0.658 | 0.0 | |
| 224108111 | 508 | predicted protein [Populus trichocarpa] | 0.921 | 0.927 | 0.691 | 0.0 | |
| 356502249 | 534 | PREDICTED: DNA polymerase lambda-like [G | 0.992 | 0.949 | 0.631 | 0.0 | |
| 30681747 | 529 | DNA polymerase lambda subunit [Arabidops | 0.980 | 0.947 | 0.636 | 0.0 | |
| 449435380 | 521 | PREDICTED: DNA polymerase lambda-like [C | 0.960 | 0.942 | 0.643 | 0.0 | |
| 357486897 | 531 | DNA polymerase beta [Medicago truncatula | 0.972 | 0.935 | 0.637 | 0.0 | |
| 297843866 | 529 | DNA polymerase lambda [Arabidopsis lyrat | 0.972 | 0.939 | 0.637 | 0.0 | |
| 357124685 | 552 | PREDICTED: DNA polymerase lambda-like [B | 0.980 | 0.907 | 0.542 | 1e-164 | |
| 47232548 | 552 | DNA polymerase lambda [Oryza sativa Japo | 0.966 | 0.894 | 0.564 | 1e-160 |
| >gi|296086508|emb|CBI32097.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 706 bits (1822), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 359/550 (65%), Positives = 420/550 (76%), Gaps = 42/550 (7%)
Query: 1 MAPKTTRKPTPALDSNGIFAGMRVFLVEKGVQNRRLQIWRQKLVQMGATVEEKLSKKVTH 60
MAPK + P D NG+FAGM VFLVE GVQ RRL+IW+QKLVQMGAT+ ++LSK+V+H
Sbjct: 1 MAPKAKKSRAPTSDPNGMFAGMVVFLVEYGVQTRRLEIWKQKLVQMGATIADRLSKRVSH 60
Query: 61 VLAMDLEALLQQVSKQHLARFKGSVIRYQWLEDSLRLGEKVSEDLYRIKLDPE---GENI 117
V A++ +ALL+QV ++HL RF+G+V++YQWLEDSLRLGEK+SED Y +K D E G
Sbjct: 61 VFAVNRDALLRQVGREHLERFQGNVLQYQWLEDSLRLGEKISEDSYNLKFDSEVQDGPGN 120
Query: 118 ADRVLSQIQGNGNTSSDGESSHRKKIKSSTEDVEHFQAESKGDVETNALSEAPNSPMSSE 177
+ Q N+ DG + K++KSS E ++ ES+ + + E ++ S+
Sbjct: 121 TSEIFPQPSQLNNSREDG-APQNKRMKSSPE--KNMNEESRENKRNSTAHETSDTVQGSD 177
Query: 178 SLTNTLSTASASPDFSSHHIT---------DPSLLYNPPDLNKNITEIFGKLINIYRALG 228
T S ++ + + + T D SL Y+PPDLNKNITEIFGKLINIYRALG
Sbjct: 178 ESFRTPSPENSGSNTLAEYFTISFNQVGTLDSSLPYSPPDLNKNITEIFGKLINIYRALG 237
Query: 229 EDRRSFSYYKAIPVIEKLPFKIESADQVKGLPGIGKSMQDHIQEIVTTGKLSKLEHFEKD 288
+DRRSFSY+KAI VIEKLPFKIESADQVK LP IGKSMQDHIQEIVTTGKLSKLEHFE D
Sbjct: 238 DDRRSFSYHKAIGVIEKLPFKIESADQVKDLPTIGKSMQDHIQEIVTTGKLSKLEHFETD 297
Query: 289 EKVRTISLFGEVWGIGPATAQKLYEKGHRTLDDLKNEDSLTHSQRLGLKYFDDIKTRIPR 348
EKVRTI+LFGEVWGIGPATA KLYEKG+RTLDDLKNEDSLT++Q+LGLKYFDDIK R+PR
Sbjct: 298 EKVRTINLFGEVWGIGPATALKLYEKGYRTLDDLKNEDSLTNAQKLGLKYFDDIKKRVPR 357
Query: 349 HEVEQMERLLQKAGEEVLPEVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLSKYVK 408
HEV++ME LLQKAGEEVLP V I+CGGSYRRGKASCGDLD++I HPD KSH+GFL +YVK
Sbjct: 358 HEVQEMELLLQKAGEEVLPGVSIVCGGSYRRGKASCGDLDIIITHPDGKSHRGFLPRYVK 417
Query: 409 KLKEMKFLREDLIFSTHSEE---------------------------VYPRDIYAFGLIA 441
LK+MKFLREDLIFSTHSEE VYPR+IYAFGLIA
Sbjct: 418 HLKDMKFLREDLIFSTHSEEGTDSGVDTYFGLCTYPARELRHRIDLKVYPRNIYAFGLIA 477
Query: 442 WTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSGGKQGVRARTSLKFDTEKEVFDFLGF 501
WTGNDVLNRRLR+LAESKGYRLDDTGLF AT GSGGK+G RA TSL F TE+EVF+FLGF
Sbjct: 478 WTGNDVLNRRLRILAESKGYRLDDTGLFLATQGSGGKRGSRATTSLSFRTEQEVFEFLGF 537
Query: 502 PWLEPHERNL 511
PWLEPHERNL
Sbjct: 538 PWLEPHERNL 547
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359473414|ref|XP_002266446.2| PREDICTED: DNA polymerase lambda-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224108111|ref|XP_002314725.1| predicted protein [Populus trichocarpa] gi|222863765|gb|EEF00896.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356502249|ref|XP_003519932.1| PREDICTED: DNA polymerase lambda-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30681747|ref|NP_172522.2| DNA polymerase lambda subunit [Arabidopsis thaliana] gi|12053869|emb|CAC21394.1| DNA polymerase lambda [Arabidopsis thaliana] gi|91805767|gb|ABE65612.1| DNA polymerase lambda [Arabidopsis thaliana] gi|304440990|gb|ADM33939.1| DNA pol lambda [Arabidopsis thaliana] gi|332190467|gb|AEE28588.1| DNA polymerase lambda subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449435380|ref|XP_004135473.1| PREDICTED: DNA polymerase lambda-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357486897|ref|XP_003613736.1| DNA polymerase beta [Medicago truncatula] gi|355515071|gb|AES96694.1| DNA polymerase beta [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297843866|ref|XP_002889814.1| DNA polymerase lambda [Arabidopsis lyrata subsp. lyrata] gi|297335656|gb|EFH66073.1| DNA polymerase lambda [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357124685|ref|XP_003564028.1| PREDICTED: DNA polymerase lambda-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|47232548|dbj|BAD18976.1| DNA polymerase lambda [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 511 | ||||||
| TAIR|locus:2194610 | 529 | Pol{lambda} "DNA polymerase {l | 0.859 | 0.829 | 0.622 | 3.1e-179 | |
| UNIPROTKB|E1BHH1 | 575 | POLL "Uncharacterized protein" | 0.469 | 0.417 | 0.382 | 9.6e-60 | |
| ZFIN|ZDB-GENE-040426-2712 | 618 | poll "polymerase (DNA directed | 0.870 | 0.720 | 0.282 | 4.2e-59 | |
| UNIPROTKB|E2RBL7 | 576 | POLL "Uncharacterized protein" | 0.469 | 0.416 | 0.386 | 5.2e-59 | |
| UNIPROTKB|F1S8U1 | 575 | POLL "Uncharacterized protein" | 0.469 | 0.417 | 0.361 | 3.9e-57 | |
| RGD|1308053 | 573 | Poll "polymerase (DNA directed | 0.469 | 0.418 | 0.345 | 8.1e-57 | |
| UNIPROTKB|Q9UGP5 | 575 | POLL "DNA polymerase lambda" [ | 0.469 | 0.417 | 0.373 | 4.4e-56 | |
| MGI|MGI:1889000 | 573 | Poll "polymerase (DNA directed | 0.469 | 0.418 | 0.361 | 3.8e-55 | |
| UNIPROTKB|E1BVS4 | 487 | POLL "Uncharacterized protein" | 0.600 | 0.630 | 0.332 | 2.3e-52 | |
| UNIPROTKB|Q5JQP8 | 487 | POLL "DNA polymerase lambda" [ | 0.469 | 0.492 | 0.373 | 1.4e-50 |
| TAIR|locus:2194610 Pol{lambda} "DNA polymerase {lambda}" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1379 (490.5 bits), Expect = 3.1e-179, Sum P(2) = 3.1e-179
Identities = 284/456 (62%), Positives = 346/456 (75%)
Query: 1 MAPKTTRKPTPALDSNGIFAGMRVFLVEKGVQNRRLQIWRQKLVQMGATVEE-KLSKKVT 59
MA K R +P+ D G+FAGM VF+VE GVQ RRLQIW+QKLVQMGA +EE +++KKVT
Sbjct: 1 MAAKRGRNRSPSPDPEGMFAGMVVFMVEIGVQRRRLQIWKQKLVQMGAVIEEDRVTKKVT 60
Query: 60 HVLAMDLEALLQQVSKQHLARFKGSVIRYQWLEDSLRLGEKVSEDLYRIKLDPEGENIAD 119
HVLAM+LEALL + K+ L+ F ++ YQWLEDSL GEK +EDLY +K+D E +
Sbjct: 61 HVLAMNLEALLHKFGKERLSHFTARLMLYQWLEDSLTSGEKANEDLYVLKIDSEEVDKPK 120
Query: 120 RVLSQIQGNGNTSSDGESSHRKKIKSSTEDVEHFQAESKGDVETNALSE-APNSPMXXXX 178
+ L I G S+ +SS +K+ + S D F KG VE+++ ++ +P+SP
Sbjct: 121 KSLPAISG-----SEDQSSPQKRTRYSP-DAGDF----KG-VESHSNTQGSPDSPTSCSV 169
Query: 179 XXXXXXXXXXXPDFSSHHITDPSLLYNPPDLNKNITEIFGKLINIYRALGEDRRSFSYYK 238
+ + ++ + +Y PPDLN+NITEIFGKLINIYRALGEDRRSFSYYK
Sbjct: 170 PSTSASPGEGIAETPTSPQSESTSVYKPPDLNRNITEIFGKLINIYRALGEDRRSFSYYK 229
Query: 239 AIPVIEKLPFKIESADQVKGLPGIGKSMQDHIQEIVTTGKLSKLEHFEKDEKVRTISLFG 298
AIPVIEK P +IES DQ+K LPGIGK+M+DHIQEIVTTGKLSKLEHFE DEKVRTISLFG
Sbjct: 230 AIPVIEKFPTRIESVDQLKHLPGIGKAMRDHIQEIVTTGKLSKLEHFETDEKVRTISLFG 289
Query: 299 EVWGIGPATAQKLYEKGHRTLDDLKNEDSLTHSQRLGLKYFDDIKTRIPRHEVEQMERLL 358
EVWG+GPATA KLYEKGHRTL+DLKNEDSLTH+Q+LGLKYFDDIKTRIPR EV++ME+LL
Sbjct: 290 EVWGVGPATALKLYEKGHRTLEDLKNEDSLTHAQKLGLKYFDDIKTRIPRQEVQEMEQLL 349
Query: 359 QKAGEEVLPEVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLSKYVKKLKEMKFLRE 418
Q+ GEE LP V I+CGGSYRRGKA+CGDLD+V+ HPD +SHKGFL+K+VK+LKEM FLRE
Sbjct: 350 QRVGEETLPGVNIVCGGSYRRGKATCGDLDIVVTHPDGQSHKGFLTKFVKRLKEMNFLRE 409
Query: 419 DLIFSTHSEEVYPR--DIYAFGLIAWTGNDVLNRRL 452
DLIFSTHSEE D Y FGL + G + L RR+
Sbjct: 410 DLIFSTHSEEGTDSGVDTY-FGLCTYPGQE-LRRRI 443
|
|
| UNIPROTKB|E1BHH1 POLL "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2712 poll "polymerase (DNA directed), lambda" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBL7 POLL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8U1 POLL "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1308053 Poll "polymerase (DNA directed), lambda" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UGP5 POLL "DNA polymerase lambda" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1889000 Poll "polymerase (DNA directed), lambda" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVS4 POLL "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5JQP8 POLL "DNA polymerase lambda" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.7 | LOW CONFIDENCE prediction! |
| 4th Layer | 2.7.7.7 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 511 | |||
| cd00141 | 307 | cd00141, NT_POLXc, Nucleotidyltransferase (NT) dom | 1e-102 | |
| smart00483 | 334 | smart00483, POLXc, DNA polymerase X family | 5e-97 | |
| COG1796 | 326 | COG1796, POL4, DNA polymerase IV (family X) [DNA r | 6e-24 | |
| pfam10391 | 52 | pfam10391, DNA_pol_lambd_f, Fingers domain of DNA | 8e-19 | |
| PRK08609 | 570 | PRK08609, PRK08609, hypothetical protein; Provisio | 3e-05 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 9e-05 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 1e-04 | |
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 1e-04 |
| >gnl|CDD|143386 cd00141, NT_POLXc, Nucleotidyltransferase (NT) domain of family X DNA Polymerases | Back alignment and domain information |
|---|
Score = 309 bits (794), Expect = e-102
Identities = 117/319 (36%), Positives = 174/319 (54%), Gaps = 32/319 (10%)
Query: 211 KNITEIFGKLINIYRALGEDR-RSFSYYKAIPVIEKLPFKIESADQVKGLPGIGKSMQDH 269
+ I +I +L ++ LG + R +Y KA +E LP IES ++ K LPGIGK + +
Sbjct: 1 QEIADILEELADLLELLGGNPFRVRAYRKAARALESLPEPIESLEEAKKLPGIGKKIAEK 60
Query: 270 IQEIVTTGKLSKLEHFEKDEKVRTISLFGEVWGIGPATAQKLYEKGHRTLDDLKN--EDS 327
I+EI+ TGKL KLE +D + L V G+GP TA+KLYE G RTL+DL+
Sbjct: 61 IEEILETGKLRKLEELRED-VPPGLLLLLRVPGVGPKTARKLYELGIRTLEDLRKAAGAK 119
Query: 328 LTHSQRLGLKYFDDIKTRIPRHEVEQMERLLQKAGEEVLPEVIILCGGSYRRGKASCGDL 387
L + +GL+Y++D + RIPR E + ++++A EV P + + GSYRRGK + GD+
Sbjct: 120 LEQNILIGLEYYEDFQQRIPREEALAIAEIIKEALREVDPVLQVEIAGSYRRGKETVGDI 179
Query: 388 DVVIMHPDRKSHKGFLSKYVKKLKEMKFLREDLI-----FSTHSEE------------VY 430
D+++ HPD S +G L K V L E+ F+ E L S + V
Sbjct: 180 DILVTHPDATS-RGLLEKVVDALVELGFVTEVLSKGDTKASGILKLPGGWKGRRVDLRVV 238
Query: 431 PRDIYAFGLIAWTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSGGKQGVRARTSLKFD 490
P + + L+ +TG+ NR LR LA+ KG +L++ GLF G L +
Sbjct: 239 PPEEFGAALLYFTGSKQFNRALRRLAKEKGLKLNEYGLFDGVDGE----------RLPGE 288
Query: 491 TEKEVFDFLGFPWLEPHER 509
TE+E+F+ LG P++EP R
Sbjct: 289 TEEEIFEALGLPYIEPELR 307
|
X family polymerases fill in short gaps during DNA repair. They are relatively inaccurate enzymes and play roles in base excision repair, in non-homologous end joining (NHEJ) which acts mainly to repair damage due to ionizing radiation, and in V(D)J recombination. This family includes eukaryotic Pol beta, Pol lambda, Pol mu, and terminal deoxyribonucleotidyl transferase (TdT). Pol beta and Pol lambda are primarily DNA template-dependent polymerases. TdT is a DNA template-independent polymerase. Pol mu has both template dependent and template independent activities. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These three carboxylate residues are fairly well conserved in this family. Length = 307 |
| >gnl|CDD|214688 smart00483, POLXc, DNA polymerase X family | Back alignment and domain information |
|---|
| >gnl|CDD|224709 COG1796, POL4, DNA polymerase IV (family X) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|192565 pfam10391, DNA_pol_lambd_f, Fingers domain of DNA polymerase lambda | Back alignment and domain information |
|---|
| >gnl|CDD|236311 PRK08609, PRK08609, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 511 | |||
| KOG2534 | 353 | consensus DNA polymerase IV (family X) [Replicatio | 100.0 | |
| cd00141 | 307 | NT_POLXc Nucleotidyltransferase (NT) domain of fam | 100.0 | |
| smart00483 | 334 | POLXc DNA polymerase X family. includes vertebrate | 100.0 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 100.0 | |
| COG1796 | 326 | POL4 DNA polymerase IV (family X) [DNA replication | 100.0 | |
| PF14791 | 64 | DNA_pol_B_thumb: DNA polymerase beta thumb ; PDB: | 99.9 | |
| PF14792 | 112 | DNA_pol_B_palm: DNA polymerase beta palm ; PDB: 1R | 99.77 | |
| PF14716 | 68 | HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HU | 99.69 | |
| PF10391 | 52 | DNA_pol_lambd_f: Fingers domain of DNA polymerase | 99.64 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 99.59 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.05 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 99.01 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 98.71 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 98.04 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 97.94 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 97.68 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 97.6 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 97.54 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 97.49 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 97.27 | |
| COG1555 | 149 | ComEA DNA uptake protein and related DNA-binding p | 97.05 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 97.01 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 97.0 | |
| PF11731 | 93 | Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd | 96.97 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 96.94 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 96.89 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 96.81 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 96.75 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 96.58 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 96.52 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 96.52 | |
| PF14229 | 122 | DUF4332: Domain of unknown function (DUF4332) | 96.47 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 96.34 | |
| TIGR00426 | 69 | competence protein ComEA helix-hairpin-helix repea | 96.31 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 96.27 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.27 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 96.17 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.08 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 96.06 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.0 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 95.99 | |
| PRK12766 | 232 | 50S ribosomal protein L32e; Provisional | 95.88 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.84 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.79 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.73 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.68 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 95.54 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 95.38 | |
| COG1555 | 149 | ComEA DNA uptake protein and related DNA-binding p | 95.25 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 95.23 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 95.03 | |
| PRK14973 | 936 | DNA topoisomerase I; Provisional | 95.03 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 94.97 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 94.96 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 94.88 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 94.87 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 94.81 | |
| cd05397 | 49 | NT_Pol-beta-like Nucleotidyltransferase (NT) domai | 94.77 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 94.7 | |
| PF11798 | 32 | IMS_HHH: IMS family HHH motif; InterPro: IPR024728 | 94.69 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 94.41 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 94.29 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 94.26 | |
| TIGR00426 | 69 | competence protein ComEA helix-hairpin-helix repea | 94.2 | |
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 94.05 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 93.98 | |
| cd05402 | 114 | NT_PAP_TUTase Nucleotidyltransferase (NT) domain o | 93.97 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 93.6 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 93.45 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 93.33 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 93.27 | |
| PRK12766 | 232 | 50S ribosomal protein L32e; Provisional | 93.06 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 92.58 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 92.58 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 92.39 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 92.15 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 92.0 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 91.74 | |
| smart00278 | 26 | HhH1 Helix-hairpin-helix DNA-binding motif class 1 | 91.36 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 91.06 | |
| PF04994 | 81 | TfoX_C: TfoX C-terminal domain; InterPro: IPR00707 | 90.91 | |
| COG1796 | 326 | POL4 DNA polymerase IV (family X) [DNA replication | 90.91 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 90.64 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 90.61 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 90.43 | |
| PF01909 | 93 | NTP_transf_2: Nucleotidyltransferase domain A subs | 90.33 | |
| PRK08097 | 562 | ligB NAD-dependent DNA ligase LigB; Reviewed | 90.27 | |
| COG1948 | 254 | MUS81 ERCC4-type nuclease [DNA replication, recomb | 90.2 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 89.8 | |
| PF11731 | 93 | Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd | 89.6 | |
| COG3743 | 133 | Uncharacterized conserved protein [Function unknow | 89.03 | |
| TIGR03252 | 177 | uncharacterized HhH-GPD family protein. This model | 88.89 | |
| PTZ00418 | 593 | Poly(A) polymerase; Provisional | 88.27 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 88.27 | |
| PRK13482 | 352 | DNA integrity scanning protein DisA; Provisional | 88.26 | |
| KOG2245 | 562 | consensus Poly(A) polymerase and related nucleotid | 88.23 | |
| smart00279 | 36 | HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot | 87.82 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 87.69 | |
| TIGR00588 | 310 | ogg 8-oxoguanine DNA-glycosylase (ogg). All protei | 87.62 | |
| KOG2841 | 254 | consensus Structure-specific endonuclease ERCC1-XP | 87.49 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 87.43 | |
| cd00080 | 75 | HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil | 87.26 | |
| PRK14670 | 574 | uvrC excinuclease ABC subunit C; Provisional | 86.55 | |
| smart00278 | 26 | HhH1 Helix-hairpin-helix DNA-binding motif class 1 | 85.63 | |
| cd05400 | 143 | NT_2-5OAS_ClassI-CCAase Nucleotidyltransferase (NT | 85.38 | |
| PRK03352 | 346 | DNA polymerase IV; Validated | 84.98 | |
| PF14490 | 94 | HHH_4: Helix-hairpin-helix containing domain; PDB: | 84.8 | |
| PRK03858 | 396 | DNA polymerase IV; Validated | 84.54 | |
| PRK14667 | 567 | uvrC excinuclease ABC subunit C; Provisional | 84.26 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 83.64 | |
| PRK01216 | 351 | DNA polymerase IV; Validated | 83.44 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 83.3 | |
| PRK14666 | 694 | uvrC excinuclease ABC subunit C; Provisional | 83.03 | |
| cd00424 | 343 | PolY Y-family of DNA polymerases. Y-family DNA pol | 82.98 | |
| PRK03609 | 422 | umuC DNA polymerase V subunit UmuC; Reviewed | 82.52 | |
| PRK14666 | 694 | uvrC excinuclease ABC subunit C; Provisional | 82.41 | |
| COG0122 | 285 | AlkA 3-methyladenine DNA glycosylase/8-oxoguanine | 82.05 | |
| smart00475 | 259 | 53EXOc 5'-3' exonuclease. | 82.04 | |
| PRK09482 | 256 | flap endonuclease-like protein; Provisional | 82.01 | |
| PRK14672 | 691 | uvrC excinuclease ABC subunit C; Provisional | 82.01 | |
| COG0353 | 198 | RecR Recombinational DNA repair protein (RecF path | 81.93 | |
| smart00478 | 149 | ENDO3c endonuclease III. includes endonuclease III | 81.61 | |
| PRK00558 | 598 | uvrC excinuclease ABC subunit C; Validated | 81.56 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 81.34 | |
| PRK14976 | 281 | 5'-3' exonuclease; Provisional | 81.05 | |
| cd01703 | 379 | PolY_Pol_iota DNA Polymerase iota. Pol iota, also | 81.04 | |
| PRK10308 | 283 | 3-methyl-adenine DNA glycosylase II; Provisional | 80.94 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 80.92 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 80.91 | |
| cd00056 | 158 | ENDO3c endonuclease III; includes endonuclease III | 80.73 | |
| cd01701 | 404 | PolY_Rev1 DNA polymerase Rev1. Rev1 is a translesi | 80.65 | |
| PRK08097 | 562 | ligB NAD-dependent DNA ligase LigB; Reviewed | 80.57 | |
| TIGR03671 | 408 | cca_archaeal CCA-adding enzyme. | 80.47 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 80.42 | |
| PRK01810 | 407 | DNA polymerase IV; Validated | 80.1 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 80.06 |
| >KOG2534 consensus DNA polymerase IV (family X) [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-83 Score=623.82 Aligned_cols=295 Identities=37% Similarity=0.650 Sum_probs=275.7
Q ss_pred CCCcHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHhcCCccccchhhhcCCCCCCHHHHHHHHHHHHhCCchhhHHHH
Q 010406 207 PDLNKNITEIFGKLINIYRALGEDRRSFSYYKAIPVIEKLPFKIESADQVKGLPGIGKSMQDHIQEIVTTGKLSKLEHFE 286 (511)
Q Consensus 207 ~~~N~~ia~~l~~la~~~e~~g~~~r~~aY~rAa~~l~~l~~~i~s~~~l~~lpgIG~~ia~kI~Eil~tG~~~~le~l~ 286 (511)
.|+|..++++|+.||+.|++.|+.+|+++|++||++|+++|++|+|++|+++|||||++|+++|+|||+||++++||+++
T Consensus 9 t~~N~~~~~aleiLa~~~ev~g~~~r~~~y~~Aasvlk~~p~~I~S~~ea~~lP~iG~kia~ki~EiletG~l~ele~v~ 88 (353)
T KOG2534|consen 9 TNNNQIFTEALEILAEAYEVEGEEDRARAYRRAASVLKSLPFPITSGEEAEKLPGIGPKIAEKIQEILETGVLRELEAVR 88 (353)
T ss_pred ccccHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHhCCCCcccHHHhcCCCCCCHHHHHHHHHHHHcCCchhHHHHh
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhchhHHHHHHhcccCCCHHHHHHHHHhCCCCHHHHhh-ccCcchhhhhcccchhhhccCcCHHHHHHHHHHHHHHhhhc
Q 010406 287 KDEKVRTISLFGEVWGIGPATAQKLYEKGHRTLDDLKN-EDSLTHSQRLGLKYFDDIKTRIPRHEVEQMERLLQKAGEEV 365 (511)
Q Consensus 287 ~~~~~~~l~lf~~I~GvGpktA~~l~~~Gi~tledL~~-~~~L~~~q~~Glk~~~d~~~~i~r~ea~~~~~iv~~~~~~~ 365 (511)
+|+.+++|++|++|||||++||++||++|+|||+|+++ ..++|++|++|++||+||+.+|+|+||.++.++|++++..+
T Consensus 89 ~de~~~~lklFtnifGvG~ktA~~Wy~~GfrTled~Rk~~~kft~qqk~Gl~yy~Df~~~v~ReE~~~i~~~V~~av~~~ 168 (353)
T KOG2534|consen 89 NDERSQSLKLFTNIFGVGLKTAEKWYREGFRTLEDVRKKPDKFTRQQKAGLKYYEDFLKRVTREEATAIQQTVQEAVWAF 168 (353)
T ss_pred cchhHHHHHHHHHHhccCHHHHHHHHHhhhhHHHHHHhCHHHHHHHHHHhHHHHHHHhhhccHHHHHHHHHHHHHHHhhc
Confidence 99999999999999999999999999999999999994 45899999999999999999999999999999999999999
Q ss_pred CCCeEEEEccceeecCCccCCeeEEEecCCcch-hhhHHHHHHHHHHHhcceee--eeEee-------------------
Q 010406 366 LPEVIILCGGSYRRGKASCGDLDVVIMHPDRKS-HKGFLSKYVKKLKEMKFLRE--DLIFS------------------- 423 (511)
Q Consensus 366 ~p~~~v~~~Gs~RRgke~~gDvDiLit~~~~~~-~~~~l~~~v~~l~~~g~l~~--~l~~~------------------- 423 (511)
+|++.|++||||||||++|||||||||||...+ +.+++..+...|.+.|++.. ++...
T Consensus 169 ~p~~~vt~~GsfRRGk~~ggDvD~LithP~~~s~~~~~~~~l~~~le~~g~il~~~~~~S~~Ek~~l~~~~s~~~~~~~~ 248 (353)
T KOG2534|consen 169 DPEAFVTVTGSFRRGKKMGGDVDFLITHPGSTSTEAKLLQLLMILLEKKGLLLYYDQLHSCGEKLRLPSRKSALDHFKKF 248 (353)
T ss_pred CCCcEEEEeccccCCcccCCCeeEEEeCCCCCchhhhHHHHHHHHHHhcCeEEEEeeeccccccccccchhhhHhhhhhE
Confidence 999999999999999999999999999999888 67888999999999999862 11000
Q ss_pred -----cc----------------------cccccCcchHHHHHHHhcCcHHHHHHHHHHHHHcCCccCCCCCcccccCCC
Q 010406 424 -----TH----------------------SEEVYPRDIYAFGLIAWTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSG 476 (511)
Q Consensus 424 -----~~----------------------~~~~~p~~~~~~aLl~~TGS~~fnr~lR~~A~~kg~~L~~~gL~~~~~~~~ 476 (511)
.. +..+||+++|||||||||||++|||+||++|.+|||+||+||||+.+.
T Consensus 249 mgv~~LPr~~~~~~~~S~n~~~~~~~rRvDivv~P~~~~~~alLgwTGS~~FnR~lR~~A~~kG~~l~~h~L~~~~~--- 325 (353)
T KOG2534|consen 249 MGVFRLPRQRVDSDQSSWNEGKGWKARRVDIVVCPYDEFGFALLGWTGSKEFNRDLRRYATHKGFSLDEHALFDLTV--- 325 (353)
T ss_pred EEEEEcCcccccccccccCCCCCCceeeeEEEEechHHcceeeeeecchHHHHHHHHHHHHhcCceecccccccCCc---
Confidence 00 011999999999999999999999999999999999999999998753
Q ss_pred CcccccccccCCCCCHHHHHhhcCCCCCCCCCcCC
Q 010406 477 GKQGVRARTSLKFDTEKEVFDFLGFPWLEPHERNL 511 (511)
Q Consensus 477 ~~~~~~~~~~~~~~tEedIf~~LGL~yipPe~Rn~ 511 (511)
..++++++|+|||++|||+||||++||.
T Consensus 326 -------~~~l~~~sEkdIFr~l~L~Y~EP~~Rn~ 353 (353)
T KOG2534|consen 326 -------RIFLPVESEKDIFRYLGLKYIEPKERNA 353 (353)
T ss_pred -------ceecCCccHHHHHHHhCCccCChhhcCC
Confidence 2689999999999999999999999995
|
|
| >cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases | Back alignment and domain information |
|---|
| >smart00483 POLXc DNA polymerase X family | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF14791 DNA_pol_B_thumb: DNA polymerase beta thumb ; PDB: 1HUZ_A 3K75_D 1HUO_A 2BPC_A 1RPL_A 1NOM_A 1ZQX_A 1ZQU_A 1ZQZ_A 1ZQV_A | Back alignment and domain information |
|---|
| >PF14792 DNA_pol_B_palm: DNA polymerase beta palm ; PDB: 1RZT_A 3PML_A 2PFN_A 3HX0_K 3HWT_A 2GWS_E 2BCQ_A 3UPQ_A 2BCS_A 3UQ2_A | Back alignment and domain information |
|---|
| >PF14716 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HUZ_A 1HUO_A 2BPG_B 2BPF_A 1DK3_A 1BPE_A 1BNO_A 1BNP_A 1DK2_A | Back alignment and domain information |
|---|
| >PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >PF14229 DUF4332: Domain of unknown function (DUF4332) | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >TIGR00426 competence protein ComEA helix-hairpin-helix repeat region | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12766 50S ribosomal protein L32e; Provisional | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14973 DNA topoisomerase I; Provisional | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >cd05397 NT_Pol-beta-like Nucleotidyltransferase (NT) domain of DNA polymerase beta and similar proteins | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00426 competence protein ComEA helix-hairpin-helix repeat region | Back alignment and domain information |
|---|
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >cd05402 NT_PAP_TUTase Nucleotidyltransferase (NT) domain of poly(A) polymerases and terminal uridylyl transferases | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12766 50S ribosomal protein L32e; Provisional | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF04994 TfoX_C: TfoX C-terminal domain; InterPro: IPR007077 This domain is found in a number of bacterial proteins including the TfoX gene product of Haemophilus influenzae | Back alignment and domain information |
|---|
| >COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >PF01909 NTP_transf_2: Nucleotidyltransferase domain A subset of this Pfam family; InterPro: IPR002934 A small region that overlaps with a nuclear localization signal and binds to the RNA primer contains three aspartates that are essential for catalysis | Back alignment and domain information |
|---|
| >PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed | Back alignment and domain information |
|---|
| >COG1948 MUS81 ERCC4-type nuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] | Back alignment and domain information |
|---|
| >COG3743 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03252 uncharacterized HhH-GPD family protein | Back alignment and domain information |
|---|
| >PTZ00418 Poly(A) polymerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK13482 DNA integrity scanning protein DisA; Provisional | Back alignment and domain information |
|---|
| >KOG2245 consensus Poly(A) polymerase and related nucleotidyltransferases [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg) | Back alignment and domain information |
|---|
| >KOG2841 consensus Structure-specific endonuclease ERCC1-XPF, ERCC1 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif | Back alignment and domain information |
|---|
| >PRK14670 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 | Back alignment and domain information |
|---|
| >cd05400 NT_2-5OAS_ClassI-CCAase Nucleotidyltransferase (NT) domain of 2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I CCA-adding enzyme | Back alignment and domain information |
|---|
| >PRK03352 DNA polymerase IV; Validated | Back alignment and domain information |
|---|
| >PF14490 HHH_4: Helix-hairpin-helix containing domain; PDB: 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK03858 DNA polymerase IV; Validated | Back alignment and domain information |
|---|
| >PRK14667 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK01216 DNA polymerase IV; Validated | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PRK14666 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >cd00424 PolY Y-family of DNA polymerases | Back alignment and domain information |
|---|
| >PRK03609 umuC DNA polymerase V subunit UmuC; Reviewed | Back alignment and domain information |
|---|
| >PRK14666 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00475 53EXOc 5'-3' exonuclease | Back alignment and domain information |
|---|
| >PRK09482 flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14672 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00478 ENDO3c endonuclease III | Back alignment and domain information |
|---|
| >PRK00558 uvrC excinuclease ABC subunit C; Validated | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK14976 5'-3' exonuclease; Provisional | Back alignment and domain information |
|---|
| >cd01703 PolY_Pol_iota DNA Polymerase iota | Back alignment and domain information |
|---|
| >PRK10308 3-methyl-adenine DNA glycosylase II; Provisional | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases | Back alignment and domain information |
|---|
| >cd01701 PolY_Rev1 DNA polymerase Rev1 | Back alignment and domain information |
|---|
| >PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed | Back alignment and domain information |
|---|
| >TIGR03671 cca_archaeal CCA-adding enzyme | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01810 DNA polymerase IV; Validated | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 511 | ||||
| 1xsn_A | 335 | Crystal Structure Of Human Dna Polymerase Lambda In | 9e-53 | ||
| 1xsl_A | 335 | Crystal Structure Of Human Dna Polymerase Lambda In | 1e-52 | ||
| 3mda_A | 325 | Dna Polymerase Lambda In Complex With Arac Length = | 2e-52 | ||
| 1rzt_A | 331 | Crystal Structure Of Dna Polymerase Lambda Complexe | 2e-52 | ||
| 3c5g_A | 335 | Structure Of A Ternary Complex Of The R517k Pol Lam | 3e-52 | ||
| 3uq2_A | 329 | Crystal Structure Of The Post-Catalytic Product Com | 4e-52 | ||
| 3hx0_A | 335 | Ternary Complex Of L277a, H511a, R514 Mutant Pol La | 4e-52 | ||
| 3mgh_A | 329 | Binary Complex Of A Dna Polymerase Lambda Loop Muta | 5e-52 | ||
| 3c5f_B | 335 | Structure Of A Binary Complex Of The R517a Pol Lamb | 7e-52 | ||
| 1bpe_A | 335 | Crystal Structure Of Rat Dna Polymerase Beta; Evide | 2e-49 | ||
| 2bpf_A | 335 | Structures Of Ternary Complexes Of Rat Dna Polymera | 2e-49 | ||
| 3uxo_A | 335 | Crystal Structure Of Rat Dna Polymerase Beta Mutato | 2e-49 | ||
| 3v7k_A | 340 | Co-crystal Structure Of K72e Variant Of Rat Polymer | 2e-49 | ||
| 3v7j_A | 340 | Co-crystal Structure Of Wild Type Rat Polymerase Be | 3e-49 | ||
| 3v72_A | 335 | Crystal Structure Of Rat Dna Polymerase Beta Mutato | 4e-49 | ||
| 3rh5_A | 335 | Dna Polymerase Beta Mutant (Y271) With A Dideoxy-Te | 8e-49 | ||
| 3ogu_A | 335 | Dna Polymerase Beta Mutant 5p20 Complexed With 6bp | 2e-48 | ||
| 9icg_A | 335 | Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed | 5e-48 | ||
| 3gdx_A | 326 | Dna Polymerase Beta With A Gapped Dnd Substrate And | 6e-48 | ||
| 4f5n_A | 335 | Open Ternary Complex Of R283k Dna Polymerase Beta W | 1e-47 | ||
| 1jn3_A | 251 | Fidelity Properties And Structure Of M282l Mutator | 2e-35 | ||
| 1rpl_A | 251 | 2.3 Angstroms Crystal Structure Of The Catalytic Do | 3e-35 | ||
| 1bpb_A | 248 | Crystal Structure Of Rat Dna Polymerase Beta: Evide | 2e-34 | ||
| 2van_A | 245 | Nucleotidyl Transfer Mechanism Of Mismatched Dntp I | 2e-34 | ||
| 3k75_D | 252 | X-Ray Crystal Structure Of Reduced Xrcc1 Bound To D | 2e-34 | ||
| 2ihm_A | 360 | Polymerase Mu In Ternary Complex With Gapped 11mer | 7e-32 | ||
| 1jms_A | 381 | Crystal Structure Of The Catalytic Core Of Murine T | 6e-27 | ||
| 1kdh_A | 363 | Binary Complex Of Murine Terminal Deoxynucleotidyl | 1e-26 | ||
| 3lqc_B | 200 | X-Ray Crystal Structure Of Oxidized Xrcc1 Bound To | 1e-19 | ||
| 3b0y_A | 575 | K263d Mutant Of Polx From Thermus Thermophilus Hb8 | 8e-18 | ||
| 3au2_A | 575 | Dna Polymerase X From Thermus Thermophilus Hb8 Comp | 5e-17 | ||
| 3b0x_A | 575 | K263a Mutant Of Polx From Thermus Thermophilus Hb8 | 5e-17 | ||
| 1dk3_A | 87 | Refined Solution Structure Of The N-Terminal Domain | 2e-07 | ||
| 1dk2_A | 86 | Refined Solution Structure Of The N-Terminal Domain | 2e-07 | ||
| 1nzp_A | 87 | Solution Structure Of The Lyase Domain Of Human Dna | 6e-06 | ||
| 1jaj_A | 174 | Solution Structure Of Dna Polymerase X From The Afr | 1e-04 |
| >pdb|1XSN|A Chain A, Crystal Structure Of Human Dna Polymerase Lambda In Complex With A One Nucleotide Dna Gap And Ddttp Length = 335 | Back alignment and structure |
|
| >pdb|1XSL|A Chain A, Crystal Structure Of Human Dna Polymerase Lambda In Complex With A One Nucleotide Dna Gap Length = 335 | Back alignment and structure |
| >pdb|3MDA|A Chain A, Dna Polymerase Lambda In Complex With Arac Length = 325 | Back alignment and structure |
| >pdb|1RZT|A Chain A, Crystal Structure Of Dna Polymerase Lambda Complexed With A Two Nucleotide Gap Dna Molecule Length = 331 | Back alignment and structure |
| >pdb|3C5G|A Chain A, Structure Of A Ternary Complex Of The R517k Pol Lambda Mutant Length = 335 | Back alignment and structure |
| >pdb|3UQ2|A Chain A, Crystal Structure Of The Post-Catalytic Product Complex Of Polymerase Lambda With An Rcmp Inserted Opposite A Templating G And Damp Inserted Opposite A Templating T At The Primer Terminus. Length = 329 | Back alignment and structure |
| >pdb|3HX0|A Chain A, Ternary Complex Of L277a, H511a, R514 Mutant Pol Lambda Bound To A 2 Nucleotide Gapped Dna Substrate With A Scrunched Da Length = 335 | Back alignment and structure |
| >pdb|3MGH|A Chain A, Binary Complex Of A Dna Polymerase Lambda Loop Mutant Length = 329 | Back alignment and structure |
| >pdb|1BPE|A Chain A, Crystal Structure Of Rat Dna Polymerase Beta; Evidence For A Common Polymerase Mechanism Length = 335 | Back alignment and structure |
| >pdb|2BPF|A Chain A, Structures Of Ternary Complexes Of Rat Dna Polymerase Beta, A Dna Template-Primer, And Ddctp Length = 335 | Back alignment and structure |
| >pdb|3UXO|A Chain A, Crystal Structure Of Rat Dna Polymerase Beta Mutator I260q Apoenzyme Length = 335 | Back alignment and structure |
| >pdb|3V7K|A Chain A, Co-crystal Structure Of K72e Variant Of Rat Polymerase Beta: Enzyme- Dna Binary Complex Length = 340 | Back alignment and structure |
| >pdb|3V7J|A Chain A, Co-crystal Structure Of Wild Type Rat Polymerase Beta: Enzyme-dna Binary Complex Length = 340 | Back alignment and structure |
| >pdb|3V72|A Chain A, Crystal Structure Of Rat Dna Polymerase Beta Mutator E295k: Enzyme- Dsdna Length = 335 | Back alignment and structure |
| >pdb|3RH5|A Chain A, Dna Polymerase Beta Mutant (Y271) With A Dideoxy-Terminated Primer With An Incoming Deoxynucleotide (Dctp) Length = 335 | Back alignment and structure |
| >pdb|3OGU|A Chain A, Dna Polymerase Beta Mutant 5p20 Complexed With 6bp Of Dna Length = 335 | Back alignment and structure |
| >pdb|9ICG|A Chain A, Dna Polymerase Beta (pol B) (e.c.2.7.7.7) Complexed With Seven Base Pairs Of Dna; Soaked In The Presence Of Dctp (1 Millimolar) And Zncl2 (1 Millimolar) Length = 335 | Back alignment and structure |
| >pdb|3GDX|A Chain A, Dna Polymerase Beta With A Gapped Dnd Substrate And Dtmp(Cf2)pp Length = 326 | Back alignment and structure |
| >pdb|4F5N|A Chain A, Open Ternary Complex Of R283k Dna Polymerase Beta With A Metal Free Dctp Analog Length = 335 | Back alignment and structure |
| >pdb|1JN3|A Chain A, Fidelity Properties And Structure Of M282l Mutator Mutant Of Dna Polymerase: Subtle Structural Changes Influence The Mechanism Of Nucleotide Discrimination Length = 251 | Back alignment and structure |
| >pdb|1RPL|A Chain A, 2.3 Angstroms Crystal Structure Of The Catalytic Domain Of Dna Polymerase Beta Length = 251 | Back alignment and structure |
| >pdb|1BPB|A Chain A, Crystal Structure Of Rat Dna Polymerase Beta: Evidence For A Common Polymerase Mechanism Length = 248 | Back alignment and structure |
| >pdb|2VAN|A Chain A, Nucleotidyl Transfer Mechanism Of Mismatched Dntp Incorporation By Dna Polymerase B By Structural And Kinetic Analyses Length = 245 | Back alignment and structure |
| >pdb|3K75|D Chain D, X-Ray Crystal Structure Of Reduced Xrcc1 Bound To Dna Pol Beta Catalytic Domain Length = 252 | Back alignment and structure |
| >pdb|2IHM|A Chain A, Polymerase Mu In Ternary Complex With Gapped 11mer Dna Duplex And Bound Incoming Nucleotide Length = 360 | Back alignment and structure |
| >pdb|1JMS|A Chain A, Crystal Structure Of The Catalytic Core Of Murine Terminal Deoxynucleotidyl Transferase Length = 381 | Back alignment and structure |
| >pdb|1KDH|A Chain A, Binary Complex Of Murine Terminal Deoxynucleotidyl Transferase With A Primer Single Stranded Dna Length = 363 | Back alignment and structure |
| >pdb|3LQC|B Chain B, X-Ray Crystal Structure Of Oxidized Xrcc1 Bound To Dna Pol B Thumb Domain Length = 200 | Back alignment and structure |
| >pdb|3B0Y|A Chain A, K263d Mutant Of Polx From Thermus Thermophilus Hb8 Complexed With Ca- Dgtp Length = 575 | Back alignment and structure |
| >pdb|3AU2|A Chain A, Dna Polymerase X From Thermus Thermophilus Hb8 Complexed With Ca-Dgtp Length = 575 | Back alignment and structure |
| >pdb|3B0X|A Chain A, K263a Mutant Of Polx From Thermus Thermophilus Hb8 Complexed With Ca- Dgtp Length = 575 | Back alignment and structure |
| >pdb|1DK3|A Chain A, Refined Solution Structure Of The N-Terminal Domain Of Dna Polymerase Beta Length = 87 | Back alignment and structure |
| >pdb|1DK2|A Chain A, Refined Solution Structure Of The N-Terminal Domain Of Dna Polymerase Beta Length = 86 | Back alignment and structure |
| >pdb|1NZP|A Chain A, Solution Structure Of The Lyase Domain Of Human Dna Polymerase Lambda Length = 87 | Back alignment and structure |
| >pdb|1JAJ|A Chain A, Solution Structure Of Dna Polymerase X From The African Swine Fever Virus Length = 174 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... Length = 335 | Back alignment and structure |
|---|
Score = 247 bits (632), Expect = 2e-78
Identities = 113/329 (34%), Positives = 173/329 (52%), Gaps = 25/329 (7%)
Query: 205 NPPDLNKNITEIFGKLINIYRALGEDRRSFSYYKAIPVIEKLPFKIESADQVKGLPGIGK 264
+ N +ITE L Y G+ R+ Y KAI ++ + S + +PGIGK
Sbjct: 8 KATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGK 67
Query: 265 SMQDHIQEIVTTGKLSKLEHFEKDEKVRTISLFGEVWGIGPATAQKLYEKGHRTLDDLKN 324
M + I EI+ +G L KL+H E V + LF +WG G TAQ Y++G R+L+D+++
Sbjct: 68 RMAEKIIEILESGHLRKLDHI--SESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRS 125
Query: 325 EDSLTHSQRLGLKYFDDIKTRIPRHEVEQMERLLQKAGEEVLPEVIILCGGSYRRGKASC 384
+ SLT Q +GLK++ D R+PR E ++E+ +QKA + ++ + GSYRRGKA+C
Sbjct: 126 QASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATC 185
Query: 385 GDLDVVIMHPDRKSHKGFLSKYVKKLKEMKFLREDLIFSTHSEEV--------------- 429
GD+DV+I HPD +SH+G S+ + L++ FL +DL+ + +
Sbjct: 186 GDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRR 245
Query: 430 --------YPRDIYAFGLIAWTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSGGKQGV 481
P +A L+ +TG+ NR +R LA++KG L + L A + V
Sbjct: 246 HRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKV 305
Query: 482 RARTSLKFDTEKEVFDFLGFPWLEPHERN 510
L TEK+VF LG P+ EP ER+
Sbjct: 306 GPGRVLPTPTEKDVFRLLGLPYREPAERD 334
|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... Length = 335 | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} Length = 360 | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* Length = 381 | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* Length = 575 | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Length = 578 | Back alignment and structure |
|---|
| >1jaj_A DNA polymerase beta-like protein; CIS peptide, viral protein; HET: DNA; NMR {African swine fever virus} SCOP: d.218.1.2 PDB: 1jqr_A* Length = 174 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Length = 133 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Length = 264 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 511 | |||
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 100.0 | |
| 2bcq_A | 335 | DNA polymerase lambda; misalignment, extrahelical, | 100.0 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 100.0 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 100.0 | |
| 3b0x_A | 575 | DNA polymerase beta family (X family); structural | 100.0 | |
| 2w9m_A | 578 | Polymerase X; SAXS, DNA repair, DNA polymerase, DN | 100.0 | |
| 1jaj_A | 174 | DNA polymerase beta-like protein; CIS peptide, vir | 100.0 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 99.93 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 99.89 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 99.82 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.6 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.58 | |
| 1vq8_Y | 241 | 50S ribosomal protein L32E; ribosome 50S, protein- | 99.54 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.5 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.49 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.44 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.39 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.37 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.32 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.27 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.26 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 99.15 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 99.13 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.05 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.02 | |
| 2kp7_A | 87 | Crossover junction endonuclease MUS81; helix-hairp | 99.02 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.99 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 98.91 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 98.87 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 98.85 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 98.78 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.78 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 98.76 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 98.76 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.75 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 98.74 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 98.73 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 98.53 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 98.51 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.44 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 98.35 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 98.33 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.26 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 98.23 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.13 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 98.01 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 97.89 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 97.82 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 97.82 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 97.72 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 97.62 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 97.62 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 97.56 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 97.36 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 97.2 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 97.19 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 97.1 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 96.99 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 96.71 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 96.53 | |
| 2i5h_A | 205 | Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s | 96.46 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 96.41 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 96.32 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 96.29 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 96.25 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 96.24 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 96.17 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 96.16 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 96.14 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 96.1 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 96.06 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 95.56 | |
| 3qbz_A | 160 | DDK kinase regulatory subunit DBF4; FHA domain,RAD | 95.42 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 95.3 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 95.19 | |
| 3bqs_A | 93 | Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s | 95.09 | |
| 3oq0_A | 151 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 95.07 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 94.78 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 94.7 | |
| 2bgw_A | 219 | XPF endonuclease; hydrolase, structure specific en | 94.7 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 94.61 | |
| 2i5h_A | 205 | Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s | 94.12 | |
| 4b21_A | 232 | Probable DNA-3-methyladenine glycosylase 2; hydrol | 94.12 | |
| 2w9m_A | 578 | Polymerase X; SAXS, DNA repair, DNA polymerase, DN | 94.06 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 93.95 | |
| 3mab_A | 93 | Uncharacterized protein; NYSGXRC, PSI-2, structura | 93.84 | |
| 1vq8_Y | 241 | 50S ribosomal protein L32E; ribosome 50S, protein- | 93.66 | |
| 3s6i_A | 228 | DNA-3-methyladenine glycosylase 1; DNA glycosylase | 93.65 | |
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 93.6 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 93.54 | |
| 3b0x_A | 575 | DNA polymerase beta family (X family); structural | 93.0 | |
| 1u9l_A | 70 | Transcription elongation protein NUSA; escherichia | 92.84 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 92.82 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 92.82 | |
| 3fhg_A | 207 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 92.33 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 92.26 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 92.12 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 92.05 | |
| 4gfj_A | 685 | Topoisomerase V; helix-hairpin-helix, DNA repair e | 92.03 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 91.93 | |
| 3nyb_A | 323 | Poly(A) RNA polymerase protein 2; polya RNA polyme | 91.89 | |
| 1wcn_A | 70 | Transcription elongation protein NUSA; RNA-binding | 91.6 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 91.41 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 91.04 | |
| 3c65_A | 226 | Uvrabc system protein C; UVRC, endonuclease, nucle | 90.77 | |
| 2yg9_A | 225 | DNA-3-methyladenine glycosidase II, putative; hydr | 90.11 | |
| 3sgi_A | 615 | DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub | 89.94 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 89.52 | |
| 4dez_A | 356 | POL IV 1, DNA polymerase IV 1; Y-family, transfera | 89.23 | |
| 1b22_A | 114 | DNA repair protein RAD51; DNA binding, riken struc | 89.15 | |
| 3i0w_A | 290 | 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- | 88.81 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 88.74 | |
| 3n0u_A | 219 | Probable N-glycosylase/DNA lyase; structural genom | 88.1 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 87.1 | |
| 3osn_A | 420 | DNA polymerase IOTA; hoogsteen base PAIR, protein- | 87.01 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 86.97 | |
| 2jhn_A | 295 | ALKA, 3-methyladenine DNA-glycosylase; DNA repair, | 86.93 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 86.82 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 86.69 | |
| 1jx4_A | 352 | DNA polymerase IV (family Y); protein-DNA complex, | 86.34 | |
| 3c1y_A | 377 | DNA integrity scanning protein DISA; DNA damage, D | 86.16 | |
| 3gqc_A | 504 | DNA repair protein REV1; protein-DNA complex, DNA | 86.15 | |
| 4e8f_A | 405 | Poly(A) RNA polymerase protein CID1; beta polymera | 86.03 | |
| 1wcn_A | 70 | Transcription elongation protein NUSA; RNA-binding | 85.74 | |
| 1im4_A | 221 | DBH; DNA polymerase PALM, thumb, fingers, helix-ha | 85.6 | |
| 2bgw_A | 219 | XPF endonuclease; hydrolase, structure specific en | 85.11 | |
| 2h56_A | 233 | DNA-3-methyladenine glycosidase; 10174367, EC 3.2. | 85.09 | |
| 1ylq_A | 96 | Putative nucleotidyltransferase, hypothetical Pro | 84.92 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 84.77 | |
| 3bq0_A | 354 | POL IV, DBH, DNA polymerase IV; Y-family, lesion b | 84.24 | |
| 2aq4_A | 434 | DNA repair protein REV1; polymerase, PAD, N-digit, | 83.87 | |
| 1no5_A | 114 | Hypothetical protein HI0073; structural genomics, | 82.62 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 82.04 | |
| 3c65_A | 226 | Uvrabc system protein C; UVRC, endonuclease, nucle | 81.97 | |
| 3bqs_A | 93 | Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s | 81.63 | |
| 3vdp_A | 212 | Recombination protein RECR; zinc finger, DNA repai | 81.1 | |
| 4f4y_A | 362 | POL IV, DNA polymerase IV; Y-family polymerase, tr | 81.01 | |
| 2nrt_A | 220 | Uvrabc system protein C; UVRC, endonuclease, RNAse | 80.84 | |
| 4fh3_A | 349 | Poly(A) RNA polymerase protein CID1; nucleotidyltr | 80.68 |
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-78 Score=629.95 Aligned_cols=295 Identities=30% Similarity=0.566 Sum_probs=272.5
Q ss_pred CCCcHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHhcCCccccchhhhcCCCCCCHHHHHHHHHHHHhCCchhhHHHH
Q 010406 207 PDLNKNITEIFGKLINIYRALGEDRRSFSYYKAIPVIEKLPFKIESADQVKGLPGIGKSMQDHIQEIVTTGKLSKLEHFE 286 (511)
Q Consensus 207 ~~~N~~ia~~l~~la~~~e~~g~~~r~~aY~rAa~~l~~l~~~i~s~~~l~~lpgIG~~ia~kI~Eil~tG~~~~le~l~ 286 (511)
+|+|++|+++|++||++||+.|+.+|++||++||++|+++|++|+++.++.+|||||+++|++|.||++||++.++|+|+
T Consensus 14 ~~~N~~i~~~L~~ia~~~e~~g~~~r~~AYr~Aa~~l~~l~~~i~~~~~l~~lpGIG~~~A~kI~E~l~tG~~~~le~L~ 93 (360)
T 2ihm_A 14 THHNTLLSEALETLAEAAGFEANEGRLLSFSRAASVLKSLPCPVASLSQLHGLPYFGEHSTRVIQELLEHGTCEEVKQVR 93 (360)
T ss_dssp SCSCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHCSSCCCSGGGGTTCTTCCHHHHHHHHHHHHHSCCHHHHHHH
T ss_pred CCCcHHHHHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHhCCcccCCHHHHhcCCCCCHHHHHHHHHHHHcCChHHHHHHh
Confidence 47899999999999999999996689999999999999999999999999999999999999999999999999999999
Q ss_pred hhchhHHHHHHhcccCCCHHHHHHHHHhCCCCHHHHhhc-cCcchhhhhcccchhhhccCcCHHHHHHHHHHHHHHhhhc
Q 010406 287 KDEKVRTISLFGEVWGIGPATAQKLYEKGHRTLDDLKNE-DSLTHSQRLGLKYFDDIKTRIPRHEVEQMERLLQKAGEEV 365 (511)
Q Consensus 287 ~~~~~~~l~lf~~I~GvGpktA~~l~~~Gi~tledL~~~-~~L~~~q~~Glk~~~d~~~~i~r~ea~~~~~iv~~~~~~~ 365 (511)
+++.+.++..|++|||||||||++||++||+||+||+.. ++|+..|++|++||+|+.+||||+||+++.++|.+.+..+
T Consensus 94 ~d~~~~~l~~l~~I~GvG~kta~~l~~~Gi~tledL~~~~~~L~~~~~~Gl~~~~d~~~ripr~ea~~i~~~i~~~l~~~ 173 (360)
T 2ihm_A 94 CSERYQTMKLFTQVFGVGVKTANRWYQEGLRTLDELREQPQRLTQQQKAGLQYYQDLSTPVRRADAEALQQLIEAAVRQT 173 (360)
T ss_dssp HSHHHHHHHHHHTSTTCCHHHHHHHHHTTCCSHHHHHTCCTTCCHHHHHHHHTHHHHHSCEEHHHHHHHHHHHHHHHHTT
T ss_pred cccchHHHHHHhCCCCCCHHHHHHHHHcCCCCHHHHHhcccchHHHHHHHHHHHHHhcCCEEHHHHHHHHHHHHHHHHhc
Confidence 988889999999999999999999999999999999943 5899999999999999999999999999999999988888
Q ss_pred CCCeEEEEccceeecCCccCCeeEEEecCCcchhhhHHHHHHHHHHHhcceeeeeE----e-------------------
Q 010406 366 LPEVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLSKYVKKLKEMKFLREDLI----F------------------- 422 (511)
Q Consensus 366 ~p~~~v~~~Gs~RRgke~~gDvDiLit~~~~~~~~~~l~~~v~~l~~~g~l~~~l~----~------------------- 422 (511)
.|+++|++||||||||++||||||||||+++..+.++|.++++.|.+.|++++.+. +
T Consensus 174 ~~~~~v~i~GSyRRgket~gDvDilit~~~~~~~~~ll~~v~~~L~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~d~~~k 253 (360)
T 2ihm_A 174 LPGATVTLTGGFRRGKLQGHDVDFLITHPEEGQEVGLLPKVMSCLQSQGLVLYHQYHRSHLADSAHNLRQRSSTMDVFER 253 (360)
T ss_dssp CTTCEEEECHHHHTTCSEESEEEEEEECSSTTTTTTHHHHHHHHHHHTTCEEEEEEECCC---------------CCCCE
T ss_pred CCCcEEEEccccccCCCccCCeEEEEecCChhhhhhHHHHHHHHHHhCCCeeeecchhhhhccccccccccccccccccc
Confidence 99999999999999999999999999999999888999999999999999974210 0
Q ss_pred -------e--------------------cccccccCcchHHHHHHHhcCcHHHHHHHHHHHHH-cCCccCCCCCcccccC
Q 010406 423 -------S--------------------THSEEVYPRDIYAFGLIAWTGNDVLNRRLRLLAES-KGYRLDDTGLFPATYG 474 (511)
Q Consensus 423 -------~--------------------~~~~~~~p~~~~~~aLl~~TGS~~fnr~lR~~A~~-kg~~L~~~gL~~~~~~ 474 (511)
. ..+..+||+++||+||+|||||++|||+||++|++ |||+||+||||+...
T Consensus 254 ~~~v~~lp~~~~~~~g~~~~~~~~~~~~rVDl~~vp~~~~g~ALl~fTGS~~fnr~lR~~A~~~kG~~L~e~Gl~~~~~- 332 (360)
T 2ihm_A 254 SFCILGLPQPQQAALAGALPPCPTWKAVRVDLVVTPSSQFPFALLGWTGSQFFERELRRFSRQEKGLWLNSHGLFDPEQ- 332 (360)
T ss_dssp EEEEEEEECC-------------CEEEEEEEEEECCTTSHHHHHHHHHSCHHHHHHHHHHHHHHHSCEECSSCEECSST-
T ss_pred eeeEeecCccccccccccccccccCCceEEEEEEECHHHHHHHHHHhhCCHHHHHHHHHHHHHhcCCCcCccccccCCC-
Confidence 0 01234999999999999999999999999999986 999999999996431
Q ss_pred CCCcccccccccCCCCCHHHHHhhcCCCCCCCCCcCC
Q 010406 475 SGGKQGVRARTSLKFDTEKEVFDFLGFPWLEPHERNL 511 (511)
Q Consensus 475 ~~~~~~~~~~~~~~~~tEedIf~~LGL~yipPe~Rn~ 511 (511)
+..+++.+|+|||++|||||||||+||.
T Consensus 333 ---------~~~i~~~~E~~If~~LGl~yipPe~Re~ 360 (360)
T 2ihm_A 333 ---------KRVFHATSEEDVFRLLGLKYLPPEQRNA 360 (360)
T ss_dssp ---------TCCCCCSSHHHHHHHTTCCCCCGGGBCC
T ss_pred ---------CccCCCCCHHHHHHHcCCCCCCccccCC
Confidence 3578999999999999999999999984
|
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1jaj_A DNA polymerase beta-like protein; CIS peptide, viral protein; HET: DNA; NMR {African swine fever virus} SCOP: d.218.1.2 PDB: 1jqr_A* | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 | Back alignment and structure |
|---|
| >4b21_A Probable DNA-3-methyladenine glycosylase 2; hydrolase-DNA complex, helix-hairpin-helix; HET: BGC 3DR; 1.45A {Schizosaccharomyces pombe} PDB: 4b22_A* 4b23_A* 4b24_A* | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3mab_A Uncharacterized protein; NYSGXRC, PSI-2, structural genomics; 1.42A {Listeria monocytogenes} PDB: 3bqt_A | Back alignment and structure |
|---|
| >1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... | Back alignment and structure |
|---|
| >3s6i_A DNA-3-methyladenine glycosylase 1; DNA glycosylase, DNA repair, helix-hairpin-helix (HHH), ABAS tetrahydrofuran (THF); HET: 3DR; 2.28A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* | Back alignment and structure |
|---|
| >1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >4gfj_A Topoisomerase V; helix-hairpin-helix, DNA repair enzyme, DNA B isomerase; 2.91A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3nyb_A Poly(A) RNA polymerase protein 2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus} | Back alignment and structure |
|---|
| >2yg9_A DNA-3-methyladenine glycosidase II, putative; hydrolase, DNA repair; 1.95A {Deinococcus radiodurans} PDB: 2yg8_A | Back alignment and structure |
|---|
| >3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >4dez_A POL IV 1, DNA polymerase IV 1; Y-family, transferase; HET: DNA; 2.60A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 | Back alignment and structure |
|---|
| >3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >3osn_A DNA polymerase IOTA; hoogsteen base PAIR, protein-DNA complex, Y-family DNA polym translesion synthesis, nucleoside triphosphate; HET: DNA DOC 6OG TTP; 1.90A {Homo sapiens} PDB: 2dpj_A* 2fll_A* 2fln_A* 2flp_A* 3epg_A* 3epi_A* 2dpi_A* 3g6v_A* 3g6y_A* 3g6x_A* 3gv7_B* 3gv8_B* 3ngd_A* 3gv5_B* 3q8p_B* 3q8q_B* 3q8r_B* 3q8s_B* 4ebc_A* 4ebd_A* ... | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1jx4_A DNA polymerase IV (family Y); protein-DNA complex, Y-family, transferase-D complex; HET: DNA MSE ADI; 1.70A {Sulfolobus solfataricus} SCOP: d.240.1.1 e.8.1.7 PDB: 1jxl_A* 1n48_A* 1n56_A* 1ryr_A* 1rys_A* 1s0m_A* 1s0n_A* 1s0o_A* 1s10_A* 1s97_A* 1s9f_A* 2ia6_A* 2ibk_A* 2r8g_A* 2r8h_A* 2r8i_A* 2rdj_A* 3fds_A* 3m9m_B* 3m9n_B* ... | Back alignment and structure |
|---|
| >3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* | Back alignment and structure |
|---|
| >3gqc_A DNA repair protein REV1; protein-DNA complex, DNA damage, DNA repair, DNA synthesis, binding, magnesium, metal-binding; HET: DNA DOC DCP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4e8f_A Poly(A) RNA polymerase protein CID1; beta polymerase-like nucleotidyl transferase, terminal uridi transferase, UTP, cytoplasmic; 2.60A {Schizosaccharomyces pombe 972h-} PDB: 4e7x_A* 4e80_A | Back alignment and structure |
|---|
| >1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B | Back alignment and structure |
|---|
| >1im4_A DBH; DNA polymerase PALM, thumb, fingers, helix-hairpin-helix, fidelity, processivity, transferase; 2.30A {Sulfolobus solfataricus} SCOP: e.8.1.7 | Back alignment and structure |
|---|
| >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A | Back alignment and structure |
|---|
| >2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, struc genomics, PSI-2, protein structure initiative, joint center structural genomics; 2.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1ylq_A Putative nucleotidyltransferase, hypothetical Pro AF0614; structural genomics, PSI, protein ST initiative; 2.02A {Archaeoglobus fulgidus} SCOP: d.218.1.5 | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3bq0_A POL IV, DBH, DNA polymerase IV; Y-family, lesion bypass; HET: DNA; 2.60A {Sulfolobus acidocaldarius} SCOP: d.240.1.1 e.8.1.7 PDB: 3bq1_A* 3bq2_A* 1k1q_A 1k1s_A | Back alignment and structure |
|---|
| >2aq4_A DNA repair protein REV1; polymerase, PAD, N-digit, G-loop, transferase; HET: DNA DOC DCP; 2.32A {Saccharomyces cerevisiae} PDB: 3bjy_A* 3osp_A* | Back alignment and structure |
|---|
| >1no5_A Hypothetical protein HI0073; structural genomics, nucleotidyl transferase structure 2 function project, S2F, unknown function; 1.80A {Haemophilus influenzae} SCOP: d.218.1.5 | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus} | Back alignment and structure |
|---|
| >3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D | Back alignment and structure |
|---|
| >4f4y_A POL IV, DNA polymerase IV; Y-family polymerase, transferase-DNA complex; HET: DNA DCP; 2.34A {Sulfolobus acidocaldarius} PDB: 3bq0_A* 3bq1_A* 3bq2_A* 4hyk_A* 1k1q_A 1k1s_A | Back alignment and structure |
|---|
| >2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A | Back alignment and structure |
|---|
| >4fh3_A Poly(A) RNA polymerase protein CID1; nucleotidyltransferase, poly(U) polymerase, transferase; 2.00A {Schizosaccharomyces pombe} PDB: 4fh5_A* 4fhp_A* 4fhv_A* 4fhw_A* 4fhy_A* 4fhx_A* 4ep7_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 511 | ||||
| d2bcqa3 | 190 | d.218.1.2 (A:386-575) DNA polymerase lambda {Human | 1e-42 | |
| d2fmpa3 | 187 | d.218.1.2 (A:149-335) DNA polymerase beta, catalyt | 1e-36 | |
| d1jmsa4 | 208 | d.218.1.2 (A:303-510) Terminal deoxynucleotidyl tr | 2e-36 | |
| d1jqra_ | 174 | d.218.1.2 (A:) DNA polymerase X {African swine fev | 1e-32 | |
| d2fmpa1 | 82 | a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal | 9e-23 | |
| d2bcqa1 | 76 | a.60.6.1 (A:252-327) DNA polymerase lambda {Human | 1e-22 | |
| d1jmsa1 | 95 | a.60.6.1 (A:148-242) Terminal deoxynucleotidyl tra | 2e-21 | |
| d2bcqa2 | 57 | a.60.12.1 (A:329-385) DNA polymerase lambda {Human | 5e-21 | |
| d2fmpa2 | 57 | a.60.12.1 (A:92-148) DNA polymerase beta {Human (H | 3e-20 | |
| d1jmsa3 | 60 | a.60.12.1 (A:243-302) Terminal deoxynucleotidyl tr | 1e-19 | |
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 2e-10 | |
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 1e-09 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 4e-05 | |
| d2edua1 | 91 | a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human | 0.002 | |
| d1t94a2 | 333 | e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Ho | 0.003 |
| >d2bcqa3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Length = 190 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nucleotidyltransferase superfamily: Nucleotidyltransferase family: DNA polymerase beta-like domain: DNA polymerase lambda species: Human (Homo sapiens) [TaxId: 9606]
Score = 148 bits (374), Expect = 1e-42
Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 23/189 (12%)
Query: 345 RIPRHEVEQMERLLQKAGEEVLPEVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLS 404
R+PR E ++E+ +QKA + ++ + GSYRRGKA+CGD+DV+I HPD +SH+G S
Sbjct: 1 RMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFS 60
Query: 405 KYVKKLKEMKFLREDLIFSTHSEEV-----------------------YPRDIYAFGLIA 441
+ + L++ FL +DL+ + + P +A L+
Sbjct: 61 RLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLY 120
Query: 442 WTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSGGKQGVRARTSLKFDTEKEVFDFLGF 501
+TG+ NR +R LA++KG L + L A + V L TEK+VF LG
Sbjct: 121 FTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGL 180
Query: 502 PWLEPHERN 510
P+ EP ER+
Sbjct: 181 PYREPAERD 189
|
| >d2fmpa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1jmsa4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 | Back information, alignment and structure |
|---|
| >d1jqra_ d.218.1.2 (A:) DNA polymerase X {African swine fever virus [TaxId: 10497]} Length = 174 | Back information, alignment and structure |
|---|
| >d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]} Length = 333 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 511 | |||
| d2bcqa3 | 190 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 100.0 | |
| d1jmsa4 | 208 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 100.0 | |
| d2fmpa3 | 187 | DNA polymerase beta, catalytic (31 kD) fragment {H | 100.0 | |
| d1jqra_ | 174 | DNA polymerase X {African swine fever virus [TaxId | 100.0 | |
| d1jmsa1 | 95 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 99.9 | |
| d2bcqa1 | 76 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 99.83 | |
| d2fmpa1 | 82 | DNA polymerase beta, N-terminal (8 kD)-domain {Hum | 99.82 | |
| d2bcqa2 | 57 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 99.73 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 99.67 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 99.63 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.47 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.44 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.28 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.12 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 99.06 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 98.27 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 97.85 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 97.77 | |
| d2p6ra2 | 198 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.64 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 97.56 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 97.5 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 97.48 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 97.41 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 97.34 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 97.31 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 97.22 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 97.19 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 97.14 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 97.11 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 97.06 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 97.04 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 96.99 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 96.98 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 96.85 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 96.83 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 96.8 | |
| d1b22a_ | 70 | DNA repair protein Rad51, N-terminal domain {Human | 96.78 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 96.66 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 96.63 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 96.55 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 96.34 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 96.31 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 96.2 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 95.78 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 95.69 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 95.57 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 95.51 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 95.24 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 95.12 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 94.87 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 94.79 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 94.22 | |
| d1ylqa1 | 90 | Putative nucleotidyltransferase AF0614 {Archaeon A | 93.61 | |
| d1rxwa1 | 105 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 93.35 | |
| d1xo1a1 | 105 | T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] | 92.65 | |
| d1a77a1 | 108 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 92.63 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 90.92 | |
| d1gm5a2 | 180 | RecG "wedge" domain {Thermotoga maritima [TaxId: 2 | 90.44 | |
| d1no5a_ | 100 | Hypothetical protein HI0073 {Haemophilus influenza | 90.34 | |
| d1zeta2 | 273 | DNA polymerase iota {Human (Homo sapiens) [TaxId: | 90.17 | |
| d2noha1 | 190 | 8-oxoguanine glycosylase {Human (Homo sapiens) [Ta | 89.98 | |
| d1mpga1 | 183 | 3-Methyladenine DNA glycosylase II (gene alkA or a | 89.24 | |
| d1jx4a2 | 240 | DinB homolog (DBH) {Archaeon Sulfolobus solfataric | 89.04 | |
| d2i5ha1 | 180 | Hypothetical protein AF1531 {Archaeoglobus fulgidu | 88.97 | |
| d1ul1x1 | 140 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 88.74 | |
| d1im4a_ | 209 | DinB homolog (DBH) {Archaeon Sulfolobus solfataric | 86.82 | |
| d1q79a2 | 196 | Poly(A) polymerase, PAP, N-terminal domain {Cow (B | 86.07 | |
| d1t94a2 | 333 | DNA polymerase kappa {Human (Homo sapiens) [TaxId: | 84.57 | |
| d2q66a2 | 197 | Poly(A) polymerase, PAP, N-terminal domain {Baker' | 82.9 | |
| d1orna_ | 214 | Endonuclease III {Escherichia coli [TaxId: 562]} | 82.84 | |
| d1kg2a_ | 224 | Catalytic domain of MutY {Escherichia coli [TaxId: | 82.56 | |
| d1r89a2 | 142 | tRNA nucleotidyltransferase, N-terminal domain {Ar | 82.25 | |
| d1pu6a_ | 217 | 3-Methyladenine DNA glycosylase III (MagIII) {Heli | 81.48 | |
| d1zeta2 | 273 | DNA polymerase iota {Human (Homo sapiens) [TaxId: | 81.07 | |
| d1b22a_ | 70 | DNA repair protein Rad51, N-terminal domain {Human | 80.76 | |
| d1vdda_ | 199 | Recombination protein RecR {Deinococcus radioduran | 80.68 | |
| d2abka_ | 211 | Endonuclease III {Escherichia coli [TaxId: 562]} | 80.58 |
| >d2bcqa3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nucleotidyltransferase superfamily: Nucleotidyltransferase family: DNA polymerase beta-like domain: DNA polymerase lambda species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.2e-44 Score=338.02 Aligned_cols=167 Identities=38% Similarity=0.649 Sum_probs=146.3
Q ss_pred CcCHHHHHHHHHHHHHHhhhcCCCeEEEEccceeecCCccCCeeEEEecCCcchhhhHHHHHHHHHHHhcceeeeeEeec
Q 010406 345 RIPRHEVEQMERLLQKAGEEVLPEVIILCGGSYRRGKASCGDLDVVIMHPDRKSHKGFLSKYVKKLKEMKFLREDLIFST 424 (511)
Q Consensus 345 ~i~r~ea~~~~~iv~~~~~~~~p~~~v~~~Gs~RRgke~~gDvDiLit~~~~~~~~~~l~~~v~~l~~~g~l~~~l~~~~ 424 (511)
||||+||.+++++|++.+..+.|++++++||||||||++||||||||+|+++.+..++|.++++.|++.|++.+++....
T Consensus 1 RIPr~E~~~i~~~l~~~~~~~~~~~~~~i~GSyRRgk~~~gDIDili~~~~~~~~~~~l~~~~~~l~~~g~i~~~l~~~~ 80 (190)
T d2bcqa3 1 RMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQE 80 (190)
T ss_dssp CEEHHHHHHHHHHHHHHHHTTCTTCEEEECHHHHTTCSEESSEEEEEECTTSSTTTTCHHHHHHHHHHTTCEEEEEECCT
T ss_pred CCCHHHHHHHHHHHHHHHHhCCCCcEEEEecccccCCcccCCeeEEEecCCchhHHHHHHHHHHHHHhcCceEEEEeeec
Confidence 79999999999999999888899999999999999999999999999999999888999999999999999987764321
Q ss_pred -----------------------ccccccCcchHHHHHHHhcCcHHHHHHHHHHHHHcCCccCCCCCcccccCCCCcccc
Q 010406 425 -----------------------HSEEVYPRDIYAFGLIAWTGNDVLNRRLRLLAESKGYRLDDTGLFPATYGSGGKQGV 481 (511)
Q Consensus 425 -----------------------~~~~~~p~~~~~~aLl~~TGS~~fnr~lR~~A~~kg~~L~~~gL~~~~~~~~~~~~~ 481 (511)
.+..+||+++|+|||+|||||++||+.||.+|+++||+||+||||+......+....
T Consensus 81 ~~~~~~~~~gi~~l~~~~~~~rrvDi~~~~~~~~~~allyfTGs~~fn~~lR~~A~~~G~~Lne~GL~~~~~~~~~~~~~ 160 (190)
T d2bcqa3 81 ENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKV 160 (190)
T ss_dssp TSTTCCEEEEEECCSSTTCCCEEEEEEECCGGGHHHHHHHHHCCHHHHHHHHHHHHHTTCEECSSCEEESCEECTTSCEE
T ss_pred ccCCcceeEEEEecCCCCCcceeEEEEEcCHHHHHHHHHhhcccHHHHHHHHHHHHHhCCccccccCccccccccccccc
Confidence 122389999999999999999999999999999999999999999875422221112
Q ss_pred cccccCCCCCHHHHHhhcCCCCCCCCCcCC
Q 010406 482 RARTSLKFDTEKEVFDFLGFPWLEPHERNL 511 (511)
Q Consensus 482 ~~~~~~~~~tEedIf~~LGL~yipPe~Rn~ 511 (511)
..+..+++.+|+|||++|||||||||+||+
T Consensus 161 ~~~~~~~~~~E~dIf~~Lgl~yi~Pe~Re~ 190 (190)
T d2bcqa3 161 GPGRVLPTPTEKDVFRLLGLPYREPAERDW 190 (190)
T ss_dssp ECCEECCCSSHHHHHHHTTCCCCCGGGGCC
T ss_pred CCCCcCCCCCHHHHHHHcCCCCCCccccCc
Confidence 235678999999999999999999999996
|
| >d1jmsa4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fmpa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqra_ d.218.1.2 (A:) DNA polymerase X {African swine fever virus [TaxId: 10497]} | Back information, alignment and structure |
|---|
| >d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1no5a_ d.218.1.5 (A:) Hypothetical protein HI0073 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jx4a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2i5ha1 e.71.1.1 (A:16-195) Hypothetical protein AF1531 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im4a_ e.8.1.7 (A:) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1q79a2 d.218.1.3 (A:19-214) Poly(A) polymerase, PAP, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q66a2 d.218.1.3 (A:5-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r89a2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|