Citrus Sinensis ID: 010445

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGNFGDKI
ccccccHHHccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHccccccEEccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHccccHHHcccccccccccccccccc
cccHHHHHcccccccccccccccccHcccccccEEEEEEEEEcccccccccccEEEEcccccccccccccccccccHHHHHccccccccEEEEEcccccccccEEEEcccccccccHccccccccccccccEcccEEEEEccccccccccccccEccccccccHHHHHHcccccccccccccccccccHEEEccccccEEEEEccccccHHHHHHHcccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccEEEEEEcccccccccccccccEEEEEccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEccccccccccccccccccccccccccEEEEEEccccccccccccccccHccHccccccccccccHHHHHcccccHcccccccHHcccccccccc
MVAAEDYARRFESGYvataskdiageeqgqsntNVMCRLCFVGENEGCERARrmlsckscgkkyhrnCLKNWAqnrdlfhwsswkcpscriceicrrtgdpnkfmfcrrcdaayhcycqhpphknvssgpylcpkhtkchscgsnvpgnglsVRWFLGYtccdacgrlfvkgnycpvclkvyrdsestpmvccdvcqrwvhcqcdgisdekYLQFQVdgnlqyrcptcrgecyqvRDLEDAVRELWRRKDMADKDLIASLRAaaglptedeifsispysddeengpvvlknefGRSLKLSLkgvvdkspkkvKEHGKKWlnkkyprkkgyqmplnskpepdqsfegyhdvhsygnsfgddtqspknegldipssvagivshtegvcsisqpgilkhkyvdevmvsdddkisrvkfktskphdldsgeddgkhvsksktiKAKKLVINLGArkinvtnsprsdasscqreqdlttsngiedpslqrmnskfvldrhdgssklgdgnfgdki
mvaaedyarrfesgyvataskdiageeqgqsntnVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLraaaglptedEIFSispysddeenGPVVLKNEFGRSLKLslkgvvdkspkkvkehgkkwlnkkyprkkgyqmplnSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEgvcsisqpgilkhkyvDEVMvsdddkisrvkfktskphdldsgeddgkhvsksktikakklvinlgarkinvtnsprsdasscqreqdlttsngiedpslqRMNSKfvldrhdgssklgdgnfgdki
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGNFGDKI
********************************TNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFS****************************************************************************************************VAGIVSHTEGVCSISQPGILKHKYVDEVMV**************************************KLVINLGA************************************************************
***********************************MCRLCFVGE*****RARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTC******************************************************************************************************************************************************************************************************************************************************************************************
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGV***********GKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFK********************KTIKAKKLVINLGARKINVT****************TTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGNFGDKI
******************************SNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPT***************NGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKY***************************************************************I*Q*GILKHKYVDEVMVSDDDKISRVKFKTS*********************KAKKLVINLGA************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGNFGDKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
O08550 2713 Histone-lysine N-methyltr yes no 0.343 0.064 0.333 5e-23
Q9UMN6 2715 Histone-lysine N-methyltr yes no 0.343 0.064 0.333 5e-23
Q6PDK2 5588 Histone-lysine N-methyltr no no 0.366 0.033 0.301 1e-22
O14686 5537 Histone-lysine N-methyltr no no 0.366 0.033 0.297 2e-22
Q8NEZ4 4911 Histone-lysine N-methyltr no no 0.350 0.036 0.308 1e-21
Q8BRH4 4903 Histone-lysine N-methyltr no no 0.350 0.036 0.308 2e-21
Q03164 3969 Histone-lysine N-methyltr no no 0.333 0.042 0.329 8e-20
P55200 3966 Histone-lysine N-methyltr no no 0.333 0.042 0.318 1e-18
Q24742 3828 Histone-lysine N-methyltr N/A no 0.333 0.044 0.310 2e-16
P20659 3726 Histone-lysine N-methyltr no no 0.343 0.046 0.293 5e-15
>sp|O08550|MLL4_MOUSE Histone-lysine N-methyltransferase MLL4 OS=Mus musculus GN=Wbp7 PE=1 SV=3 Back     alignment and function desciption
 Score =  109 bits (273), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 94/183 (51%), Gaps = 8/183 (4%)

Query: 54   MLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMF-CRRCDA 112
            ++ C+ C   +H  CL+  A+     H  +W C  C+ C +C R G  +K +  C RC  
Sbjct: 1221 LVFCQVCCDPFHPFCLEE-AERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRH 1279

Query: 113  AYHCYCQHPPHKNVSSGP---YLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLF 169
            AYH  C  P +   ++     ++C    +C SCG+  PG    V W   Y+ C  C  L+
Sbjct: 1280 AYHPACLGPSYPTRATRRRRHWICSACVRCKSCGAT-PGKNWDVEWSGDYSLCPRCTELY 1338

Query: 170  VKGNYCPVCLKVYRDSE-STPMVCCDVCQRWVHCQCDGISDEKY-LQFQVDGNLQYRCPT 227
             KGNYCP+C + Y D++  + M+ C  C  WVH +C+G+SDE Y +   +  ++ Y C  
Sbjct: 1339 EKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGP 1398

Query: 228  CRG 230
            C G
Sbjct: 1399 CAG 1401
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q9UMN6|MLL4_HUMAN Histone-lysine N-methyltransferase MLL4 OS=Homo sapiens GN=WBP7 PE=1 SV=1 Back     alignment and function description
>sp|Q6PDK2|MLL2_MOUSE Histone-lysine N-methyltransferase MLL2 OS=Mus musculus GN=Mll2 PE=1 SV=2 Back     alignment and function description
>sp|O14686|MLL2_HUMAN Histone-lysine N-methyltransferase MLL2 OS=Homo sapiens GN=MLL2 PE=1 SV=2 Back     alignment and function description
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description
>sp|Q03164|MLL1_HUMAN Histone-lysine N-methyltransferase MLL OS=Homo sapiens GN=MLL PE=1 SV=5 Back     alignment and function description
>sp|P55200|MLL1_MOUSE Histone-lysine N-methyltransferase MLL OS=Mus musculus GN=Mll PE=1 SV=3 Back     alignment and function description
>sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 Back     alignment and function description
>sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
297736278 679 unnamed protein product [Vitis vinifera] 0.986 0.740 0.762 0.0
449436315 847 PREDICTED: uncharacterized protein LOC10 0.919 0.553 0.751 0.0
224106097 845 predicted protein [Populus trichocarpa] 0.896 0.540 0.696 0.0
297833588 778 protein binding protein [Arabidopsis lyr 0.898 0.588 0.685 0.0
145338256 779 PHD finger-containing protein [Arabidops 0.898 0.587 0.675 0.0
356544287 845 PREDICTED: uncharacterized protein LOC10 0.974 0.588 0.644 0.0
356529861 820 PREDICTED: uncharacterized protein LOC10 0.921 0.573 0.653 1e-180
6648214 764 unknown protein [Arabidopsis thaliana] 0.868 0.579 0.649 1e-174
359487302 730 PREDICTED: uncharacterized protein LOC10 0.554 0.387 0.794 1e-140
255553540 734 protein binding protein, putative [Ricin 0.519 0.361 0.838 1e-140
>gi|297736278|emb|CBI24916.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/513 (76%), Positives = 434/513 (84%), Gaps = 10/513 (1%)

Query: 2   VAAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCG 61
           + AEDYARRFESG +   SKDI GEEQ QSN NVMCR+CF GE EG ERAR+ML C SCG
Sbjct: 109 MVAEDYARRFESGDLVDTSKDIVGEEQSQSNVNVMCRICFFGEMEGSERARKMLPCNSCG 168

Query: 62  KKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHP 121
           KKYHR CLK+W+QNRDLFHWSSW CPSCRICE+CRR+GDPNKFMFCRRCD AYHCYCQ P
Sbjct: 169 KKYHRLCLKSWSQNRDLFHWSSWTCPSCRICEVCRRSGDPNKFMFCRRCDDAYHCYCQQP 228

Query: 122 PHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKV 181
           PHKNVSSGPYLCPKHT+CHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKV
Sbjct: 229 PHKNVSSGPYLCPKHTRCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKV 288

Query: 182 YRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDA 241
           YRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQY+C TCRGECYQV+DLEDA
Sbjct: 289 YRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYKCATCRGECYQVKDLEDA 348

Query: 242 VRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSL 301
           V+ELWRR+D AD+DLIASLRA A LPT+DEIFSISPYSDDEENGPV LK+EFGRSLKLSL
Sbjct: 349 VQELWRRRDKADRDLIASLRAKARLPTQDEIFSISPYSDDEENGPVSLKSEFGRSLKLSL 408

Query: 302 KGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDD- 360
           KG VDKSPKK KE+GK+  NKK  +KKG+Q PL SK E  QSFEG+ D   +  S GDD 
Sbjct: 409 KGSVDKSPKKTKEYGKQSSNKKNVKKKGHQTPLISKKESHQSFEGHDDAQPFEYSLGDDK 468

Query: 361 -TQSPKNEGLDIPSS-VAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRV-KFKT 417
             Q  +++G  + SS VAG +SHTEG+CSI+QPG+LKHK+VDE+ V+++D+ SRV + K+
Sbjct: 469 NEQPNRSDGRGVFSSPVAGSLSHTEGICSINQPGVLKHKFVDEIAVNNEDRTSRVIQIKS 528

Query: 418 SKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNG 477
           +KPH  D GED GK  SKSKT+K  KLVI+LGAR  NVTNSPRSDASSCQREQDLTTSNG
Sbjct: 529 NKPHGSDVGEDTGKQASKSKTMKGTKLVIHLGARNRNVTNSPRSDASSCQREQDLTTSNG 588

Query: 478 IEDPSLQRMNSKFVLDRHDGSSKLGDGNFGDKI 510
            ED S QRM      D+HD  +K GD   GDKI
Sbjct: 589 SEDTSQQRMG-----DKHDRIAKFGDSK-GDKI 615

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449436315|ref|XP_004135938.1| PREDICTED: uncharacterized protein LOC101208296 [Cucumis sativus] gi|449488832|ref|XP_004158186.1| PREDICTED: uncharacterized protein LOC101230410 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224106097|ref|XP_002314042.1| predicted protein [Populus trichocarpa] gi|222850450|gb|EEE87997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297833588|ref|XP_002884676.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297330516|gb|EFH60935.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145338256|ref|NP_187459.2| PHD finger-containing protein [Arabidopsis thaliana] gi|110739634|dbj|BAF01725.1| hypothetical protein [Arabidopsis thaliana] gi|110741394|dbj|BAF02246.1| hypothetical protein [Arabidopsis thaliana] gi|332641110|gb|AEE74631.1| PHD finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356544287|ref|XP_003540585.1| PREDICTED: uncharacterized protein LOC100815407 [Glycine max] Back     alignment and taxonomy information
>gi|356529861|ref|XP_003533505.1| PREDICTED: uncharacterized protein LOC100809429 [Glycine max] Back     alignment and taxonomy information
>gi|6648214|gb|AAF21212.1|AC013483_36 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359487302|ref|XP_002274438.2| PREDICTED: uncharacterized protein LOC100249974 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553540|ref|XP_002517811.1| protein binding protein, putative [Ricinus communis] gi|223543083|gb|EEF44618.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
TAIR|locus:2077457 779 AT3G08020 [Arabidopsis thalian 0.898 0.587 0.685 4.2e-182
TAIR|locus:2083715696 AT3G52100 [Arabidopsis thalian 0.476 0.349 0.766 3.3e-130
UNIPROTKB|H7BYJ6366 MLL "MLL cleavage product C180 0.354 0.494 0.331 1.5e-29
FB|FBgn0263667 1482 Lpt "Lost PHDs of trr" [Drosop 0.533 0.183 0.304 5.8e-27
UNIPROTKB|E1BKN0 2711 LOC785776 "Uncharacterized pro 0.368 0.069 0.326 1.5e-26
MGI|MGI:109565 2713 Wbp7 "WW domain binding protei 0.368 0.069 0.321 2.6e-26
UNIPROTKB|Q9UMN6 2715 WBP7 "Histone-lysine N-methylt 0.368 0.069 0.321 3.3e-26
UNIPROTKB|F1RM66 2724 LOC100520742 "Uncharacterized 0.368 0.069 0.321 3.4e-26
RGD|1308331 2705 Mll4 "myeloid/lymphoid or mixe 0.368 0.069 0.321 7.4e-26
UNIPROTKB|J9NZ02 2194 RBM42 "Uncharacterized protein 0.368 0.085 0.316 7.5e-26
TAIR|locus:2077457 AT3G08020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1767 (627.1 bits), Expect = 4.2e-182, P = 4.2e-182
 Identities = 327/477 (68%), Positives = 381/477 (79%)

Query:     3 AAEDYARRFESGYVATASKDIAGEEQGQSNTNVMCRLCFVGENEGCERARRMLSCKSCGK 62
             AAEDYARRFESG     S D AGEE G S  N+MCR+CF+GE EG +RARRMLSCK CGK
Sbjct:   114 AAEDYARRFESGVNDLTSNDHAGEELGHSGMNIMCRMCFLGEGEGSDRARRMLSCKDCGK 173

Query:    63 KYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPP 122
             KYH+NCLK+WAQ+RDLFHWSSW CPSCR+CE+CRRTGDPNKFMFC+RCDAAYHCYCQHPP
Sbjct:   174 KYHKNCLKSWAQHRDLFHWSSWSCPSCRVCEVCRRTGDPNKFMFCKRCDAAYHCYCQHPP 233

Query:   123 HKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVY 182
             HKNVSSGPYLCPKHT+CHSC S VPGNGLSVRWFL YTCCDACGRLFVKGNYCPVCLKVY
Sbjct:   234 HKNVSSGPYLCPKHTRCHSCDSTVPGNGLSVRWFLSYTCCDACGRLFVKGNYCPVCLKVY 293

Query:   183 RDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAV 242
             RDSESTPMVCCD+CQRWVHC CDGISD+KY+QFQVDG LQY+C TCRGECYQV+DL+DAV
Sbjct:   294 RDSESTPMVCCDICQRWVHCHCDGISDDKYMQFQVDGKLQYKCATCRGECYQVKDLQDAV 353

Query:   243 RELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLK 302
             +ELW++KD+ DK+LIASLRAAAGLPTE+EIFSI P+SDDEENGPV      GRSLK S+K
Sbjct:   354 QELWKKKDVVDKELIASLRAAAGLPTEEEIFSIFPFSDDEENGPVS-----GRSLKFSIK 408

Query:   303 GVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQ 362
             G+V+KSPKK KE+GK   +KK+  KKG     ++K EP+   E   +    G    D+  
Sbjct:   409 GLVEKSPKKSKEYGKHSSSKKHASKKGS----HTKLEPEVHQEIGSERRRLGGVRIDNVG 464

Query:   363 SPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTSKPH 421
                NE  D+ SSVAGI       CS  +P I+KHK VD+VMV+D++K SR V+ K SKPH
Sbjct:   465 FQINEQSDVNSSVAGI-------CSTHEPKIVKHKRVDDVMVTDEEKPSRIVRIKCSKPH 517

Query:   422 DLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDA-SSCQREQDLTTSNG 477
             D DS ED  ++  + K++KAKKLVINLGARKINV+ S +S+  S   R++D +T  G
Sbjct:   518 DSDS-EDTLRNAGEEKSVKAKKLVINLGARKINVSGSSKSNVVSHLSRDKDQSTLGG 573
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2083715 AT3G52100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYJ6 MLL "MLL cleavage product C180" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0263667 Lpt "Lost PHDs of trr" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKN0 LOC785776 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:109565 Wbp7 "WW domain binding protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UMN6 WBP7 "Histone-lysine N-methyltransferase MLL4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RM66 LOC100520742 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1308331 Mll4 "myeloid/lymphoid or mixed-lineage leukemia 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ02 RBM42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
pfam0062851 pfam00628, PHD, PHD-finger 2e-05
smart0024947 smart00249, PHD, PHD zinc finger 6e-05
pfam0062851 pfam00628, PHD, PHD-finger 0.001
smart0024947 smart00249, PHD, PHD zinc finger 0.001
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 41.7 bits (98), Expect = 2e-05
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 91  ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPP--HKNVSSGPYLCPK 135
            C +C +  D  + + C  CD  +H  C  PP   + +  G + CP+
Sbjct: 1   YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPE 47

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 100.0
KOG1244336 consensus Predicted transcription factor Requiem/N 99.7
KOG1512381 consensus PHD Zn-finger protein [General function 99.45
KOG0954 893 consensus PHD finger protein [General function pre 99.25
KOG4299613 consensus PHD Zn-finger protein [General function 98.63
KOG0383 696 consensus Predicted helicase [General function pre 98.58
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.47
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.4
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.29
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 98.28
KOG4299613 consensus PHD Zn-finger protein [General function 98.27
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.2
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.15
KOG0956 900 consensus PHD finger protein AF10 [General functio 98.1
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.98
KOG1512381 consensus PHD Zn-finger protein [General function 97.89
KOG1244336 consensus Predicted transcription factor Requiem/N 97.79
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.72
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.71
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.71
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.59
KOG0383 696 consensus Predicted helicase [General function pre 97.58
COG5141669 PHD zinc finger-containing protein [General functi 97.37
KOG1973274 consensus Chromatin remodeling protein, contains P 97.33
COG5141669 PHD zinc finger-containing protein [General functi 97.32
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.13
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.96
KOG0957 707 consensus PHD finger protein [General function pre 96.94
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.92
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.91
KOG0957707 consensus PHD finger protein [General function pre 96.76
KOG0954 893 consensus PHD finger protein [General function pre 96.71
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.59
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 96.2
KOG1973274 consensus Chromatin remodeling protein, contains P 95.91
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 95.68
KOG2752345 consensus Uncharacterized conserved protein, conta 94.96
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 94.19
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 93.94
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 93.67
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 93.67
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 93.2
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 92.77
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 91.14
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 87.54
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.36
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 86.36
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 84.54
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 82.54
PF13901202 DUF4206: Domain of unknown function (DUF4206) 80.6
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=403.34  Aligned_cols=411  Identities=39%  Similarity=0.737  Sum_probs=348.6

Q ss_pred             cccccccccccccCCccCCCCcEEeCCCCCcchhhhcCCCccccccCCCCCcCCCCCCcCcccccCCCCcceEEcCCCCC
Q 010445           33 TNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDA  112 (510)
Q Consensus        33 ~~~~C~vC~~~G~~gs~~~eeLL~C~~C~~~yH~~CL~~~~~~~~~~~~~~W~C~~C~~C~vC~~~gd~~~lL~Cd~C~~  112 (510)
                      ...+|.+|...|   ++....|+.|..|+..||++|+..+.+...+.  ..|+|+.|++|..|+..+++.++++|+.|+.
T Consensus        17 ~~~mc~l~~s~G---~~~ag~m~ac~~c~~~yH~~cvt~~~~~~~l~--~gWrC~~crvCe~c~~~gD~~kf~~Ck~cDv   91 (694)
T KOG4443|consen   17 VCLMCPLCGSSG---KGRAGRLLACSDCGQKYHPYCVTSWAQHAVLS--GGWRCPSCRVCEACGTTGDPKKFLLCKRCDV   91 (694)
T ss_pred             hhhhhhhhcccc---ccccCcchhhhhhcccCCcchhhHHHhHHHhc--CCcccCCceeeeeccccCCcccccccccccc
Confidence            345677776655   45667899999999999999999988765443  4599999999999999999999999999999


Q ss_pred             cccccccCCCCcCCCCCCccccCCcccccCCCCCCCCCCccccccCccccccccccccccccccccccccCCCCCCCcee
Q 010445          113 AYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVC  192 (510)
Q Consensus       113 ~YH~~CL~P~l~~ip~~~W~Cp~C~~C~~Cg~~~pgk~~s~rW~~~~~lC~~C~~~~~kg~~CpVC~r~Y~d~e~~~mLq  192 (510)
                      .||.+|+.|++..++.++|+|+.|+.|..|..+.++  +..+|..++..|+.|..    +.|||||.++|++.+..+|++
T Consensus        92 syh~yc~~P~~~~v~sg~~~ckk~~~c~qc~~~lpg--~s~~~~~~~~~~~~c~s----~~~cPvc~~~Y~~~e~~~~~~  165 (694)
T KOG4443|consen   92 SYHCYCQKPPNDKVPSGPWLCKKCTRCRQCDSTLPG--LSLDLQEGYLQCAPCAS----LSYCPVCLIVYQDSESLPMVC  165 (694)
T ss_pred             cccccccCCccccccCcccccHHHHhhhhccccccc--cchhhhccCcccccccc----cccCchHHHhhhhccchhhHH
Confidence            999999999999999999999999999999998877  67788888999999986    679999999999999999999


Q ss_pred             ccCcCCcccccCCCCchHHHhhhccCCCCceeCCCCCCCCCCCcchHHHHHHHhhccccccHHHHHHHHHhcCCCCcccc
Q 010445          193 CDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEI  272 (510)
Q Consensus       193 Cd~C~~wfH~~Cd~l~~e~y~~~~~~~~~~Y~C~~Cr~~~~~I~~~k~~~~r~Wr~~~~~~~~~i~slR~~~glp~~eei  272 (510)
                      |+.|.+|.|..|+++.+++|.++.++  +.|.|.+||...++++++.+++.+.|++.......++..++++.-|.     
T Consensus       166 c~~c~rwsh~~c~~~sdd~~~q~~vD--~~~~CS~CR~es~qvKdi~~~vqe~~~~k~~~~~~~~~tls~~a~lq-----  238 (694)
T KOG4443|consen  166 CSICQRWSHGGCDGISDDKYMQAQVD--LQYKCSTCRGESYQVKDISDALQETWKAKDKPDKILIATLSAQAALQ-----  238 (694)
T ss_pred             HHHhcccccCCCCccchHHHHHHhhh--hhcccceeehhhhhhhhHHHHHHhhcchhhccccceeehhhhhhhhh-----
Confidence            99999999999999999999998876  89999999999999999999999999999999999998888877653     


Q ss_pred             ccCCCCCCCccCCchhhhhhhhcccccccCCCCCCCCCchhhhcccccCCCCCcccCCCCCCCCCCCCCCCCCCcccccc
Q 010445          273 FSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHS  352 (510)
Q Consensus       273 ~s~~p~sdd~~~~~~~~~~~~~~~~~~s~k~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (510)
                                .+.+++     .++.+++.++..++++.+++...+....+.+...+|...     .+.     .+.|+.+
T Consensus       239 ----------~~~~~~-----~~s~~~k~~~~~~~~~~~s~a~gq~s~~~~~~~~~g~~~-----dp~-----~~~e~~s  293 (694)
T KOG4443|consen  239 ----------MHHAVI-----GDSSADKAGSSANSGSATSGASGQLSLTTANTPTLGVSL-----DPV-----KLQEVGS  293 (694)
T ss_pred             ----------hccccc-----cccccccccCcccCCcccccccccCCcccccccccCccc-----chh-----hhhhccc
Confidence                      333333     566778889999999999999999887777777777665     222     5566777


Q ss_pred             c----CCCCCCCCCCCCCCCCCCCCCcccccccCCCccccCCCCcccccccceeeccCCCccce-eeeecCCCCCCCCCC
Q 010445          353 Y----GNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTSKPHDLDSGE  427 (510)
Q Consensus       353 ~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~  427 (510)
                      |    +..+..+...+       +++...+.+..|++++-.-+-.+.+..+.+.||+.+|...| ++||++||+++++ +
T Consensus       294 E~~a~~~v~~e~vv~d-------~t~~~~~~~~~e~~~~p~~r~~~~~~m~~~~~vt~~e~~~r~~r~~Stk~~~~~~-~  365 (694)
T KOG4443|consen  294 ERKAKLLVKQEAVVKD-------STETPTVNSRAEEIGTPEKRLNANATMTAINQVTSEEKPTRTARIKSTKPPDSDS-E  365 (694)
T ss_pred             hhhhhhccchhhhhhc-------cccCcccccchhhccCccccccccceeeeeeccccccccceeeecCCCCCCCcch-h
Confidence            7    34455555555       44455566778999999999999999999999985554445 9999999999999 5


Q ss_pred             cccccccccccccceeEEEeecccccccCCCCCCCccchhcccc--ccCCCCCC-Ccccceecceeeecc
Q 010445          428 DDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQD--LTTSNGIE-DPSLQRMNSKFVLDR  494 (510)
Q Consensus       428 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~-~~~~~~~~~~~~~~~  494 (510)
                      +...+++...++++++||||+|+|++|+.++.+.++.+-..+-+  ..++.|.. |.+++.|++.-|+-+
T Consensus       366 ~~~r~a~edn~ll~~~l~~n~st~kl~~~~~t~~~v~~~~~~a~l~~~~l~~~~~~s~~k~rsle~egs~  435 (694)
T KOG4443|consen  366 NNLRSAAEDNALLAKKLVINSSSRKLNVISSTSAHVGSASSSAPLSQRKLIGVRAPSMGKVRSLEDEGSR  435 (694)
T ss_pred             hhhhhccchhhHHhhhcccccCccccccccccccccccccccChhhHHHhccCcCcchhhhhhhhhhccc
Confidence            58888999999999999999999999999999999888755544  34566777 999999998775544

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
2ysm_A111 Solution Structure Of The First And Second Phd Doma 3e-08
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 6e-08
2ln0_A110 Structure Of Moz Length = 110 1e-05
3v43_A112 Crystal Structure Of Moz Length = 112 1e-05
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 1e-04
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
Query: 57  CKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHC 116
           C +CG+ YH  CL            + W+CP C++C+ C+++G+ +K + C  CD  YH 
Sbjct: 25  CTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHT 81
Query: 117 YCQHPPHKNVSSGPYLC 133
           +C  P  K+V +  + C
Sbjct: 82  FCLQPVMKSVPTNGWKC 98
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 7e-25
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-24
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-08
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-05
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-21
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-05
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 5e-18
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-13
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 5e-11
1we9_A64 PHD finger family protein; structural genomics, PH 1e-10
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-09
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-08
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 2e-08
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 4e-08
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 7e-08
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 4e-07
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 7e-07
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-06
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 1e-06
1wem_A76 Death associated transcription factor 1; structura 2e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 7e-05
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 4e-06
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 5e-06
1wee_A72 PHD finger family protein; structural genomics, PH 6e-06
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 7e-06
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 7e-06
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 8e-06
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-05
3o70_A68 PHD finger protein 13; PHF13, structural genomics 1e-05
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 1e-05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 6e-05
2yt5_A66 Metal-response element-binding transcription facto 6e-05
2yt5_A66 Metal-response element-binding transcription facto 3e-04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 6e-05
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-04
3kv5_D 488 JMJC domain-containing histone demethylation prote 3e-04
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 3e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 3e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 3e-04
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 4e-04
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 8e-04
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 9e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 9e-04
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
 Score = 98.2 bits (244), Expect = 7e-25
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 2/110 (1%)

Query: 37  CRLCFVGE--NEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEI 94
           C  C  G   N+   R   ++SC  CG+  H  CL+      +      W+C  C+ C +
Sbjct: 4   CDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCIL 63

Query: 95  CRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGS 144
           C  + + ++ +FC  CD  YH YC +PP      G + C    +     +
Sbjct: 64  CGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKA 113
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.86
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.83
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.83
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.49
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.39
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.34
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.32
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.32
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.3
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.27
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.14
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.06
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.0
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.99
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.92
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.91
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.88
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.85
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.84
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.82
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.81
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.81
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.77
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.72
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.71
2yt5_A66 Metal-response element-binding transcription facto 98.69
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.68
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.68
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.6
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.59
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.59
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.58
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.58
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.57
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.57
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.57
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.56
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.54
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.51
2yt5_A66 Metal-response element-binding transcription facto 98.49
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.49
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.48
1we9_A64 PHD finger family protein; structural genomics, PH 98.47
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.47
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.44
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.43
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.4
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.4
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.38
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.37
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.34
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.33
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.29
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.24
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.24
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.23
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.21
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.12
1wem_A76 Death associated transcription factor 1; structura 98.11
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.07
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.04
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.03
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.01
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.99
1weu_A91 Inhibitor of growth family, member 4; structural g 97.96
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.95
1wee_A72 PHD finger family protein; structural genomics, PH 97.93
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.93
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.92
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.85
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.85
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.83
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.81
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.81
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.8
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 97.79
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.78
1we9_A64 PHD finger family protein; structural genomics, PH 97.68
1wee_A72 PHD finger family protein; structural genomics, PH 97.67
1weu_A91 Inhibitor of growth family, member 4; structural g 97.66
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.64
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.53
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.52
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.5
1wem_A76 Death associated transcription factor 1; structura 97.42
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.39
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.38
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.37
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.37
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.36
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.36
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.34
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.29
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.28
1wew_A78 DNA-binding family protein; structural genomics, P 97.26
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.21
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.17
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.11
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.95
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 96.94
1wew_A78 DNA-binding family protein; structural genomics, P 96.91
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.9
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 96.84
1x4i_A70 Inhibitor of growth protein 3; structural genomics 96.79
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.48
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.21
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.06
3kv5_D488 JMJC domain-containing histone demethylation prote 95.4
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 94.93
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.61
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 93.27
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 92.72
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 91.66
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 90.81
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 90.62
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 90.53
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 89.49
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 88.38
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 88.13
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 87.99
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 87.82
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 86.84
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 86.16
2ect_A78 Ring finger protein 126; metal binding protein, st 84.98
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 82.53
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 81.68
2ecm_A55 Ring finger and CHY zinc finger domain- containing 80.3
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 80.09
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.86  E-value=2.2e-22  Score=175.65  Aligned_cols=104  Identities=28%  Similarity=0.799  Sum_probs=92.3

Q ss_pred             ccccccccccccccCCccCCCCcEEeCCCCCcchhhhcCCCccccccCCCCCcCCCCCCcCcccccCCCCcceEEcCCCC
Q 010445           32 NTNVMCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCD  111 (510)
Q Consensus        32 ~~~~~C~vC~~~G~~gs~~~eeLL~C~~C~~~yH~~CL~~~~~~~~~~~~~~W~C~~C~~C~vC~~~gd~~~lL~Cd~C~  111 (510)
                      .++++|.+|..+|+     .++||.|+.|+++||+.||+++..+.   .++.|+|++|.+|.+|++.+++..||+|+.|+
T Consensus         5 ~~~~~C~~C~~~g~-----~~~ll~C~~C~~~~H~~Cl~~~~~~~---~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~   76 (111)
T 2ysm_A            5 SSGANCAVCDSPGD-----LLDQFFCTTCGQHYHGMCLDIAVTPL---KRAGWQCPECKVCQNCKQSGEDSKMLVCDTCD   76 (111)
T ss_dssp             CCCSCBTTTCCCCC-----TTTSEECSSSCCEECTTTTTCCCCTT---TSTTCCCTTTCCCTTTCCCSCCTTEEECSSSC
T ss_pred             CCCCCCcCCCCCCC-----CcCCeECCCCCCCcChHHhCCccccc---cccCccCCcCCcccccCccCCCCCeeECCCCC
Confidence            46789999999873     34789999999999999999976532   45899999999999999999888999999999


Q ss_pred             CcccccccCCCCcCCCCCCccccCCcccccCC
Q 010445          112 AAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCG  143 (510)
Q Consensus       112 ~~YH~~CL~P~l~~ip~~~W~Cp~C~~C~~Cg  143 (510)
                      ++||.+|+.|++..+|.+.|+|+.|..|..+.
T Consensus        77 ~~yH~~Cl~ppl~~~P~g~W~C~~C~~c~~g~  108 (111)
T 2ysm_A           77 KGYHTFCLQPVMKSVPTNGWKCKNCRICISGP  108 (111)
T ss_dssp             CEEEGGGSSSCCSSCCSSCCCCHHHHCCSCSC
T ss_pred             cHHhHHhcCCccccCCCCCcCCcCCcCcCCCC
Confidence            99999999999999999999999998876554
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-08
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 5e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 7e-07
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-05
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 4e-06
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 0.001
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 3e-05
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 6e-04
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 7e-05
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 8e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 4e-04
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 8e-04
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.2 bits (117), Expect = 1e-08
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 92  CEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSC 142
           C++CR+ G+ +K + C  C+ A+H +C  P    V  G + CP    C   
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCP---ACQPA 50
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.99
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.93
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.66
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.54
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.53
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.51
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.35
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.32
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.13
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.12
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.06
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.01
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 97.98
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.88
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.78
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.73
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.72
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.65
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.49
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.31
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.14
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.86
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.9
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.19
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 91.09
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 87.34
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 86.65
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 85.42
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 84.57
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 84.01
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 82.11
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.99  E-value=8.1e-11  Score=87.24  Aligned_cols=49  Identities=31%  Similarity=0.954  Sum_probs=44.5

Q ss_pred             cCcccccCCCCcceEEcCCCCCcccccccCCCCcCCCCCCccccCCccc
Q 010445           91 ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKC  139 (510)
Q Consensus        91 ~C~vC~~~gd~~~lL~Cd~C~~~YH~~CL~P~l~~ip~~~W~Cp~C~~C  139 (510)
                      .|.+|+..++++.||.|+.|+.+||..|++|++..+|.+.|+|+.|..|
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcCc
Confidence            4778888888889999999999999999999999999999999999864
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure