Citrus Sinensis ID: 010446


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MAASFLAVPSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFRPD
cccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccc
ccEEEEEccccccccccccccccccccHHHHcccEEEHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccc
maasflavpspsfcnhrksqvglclpsgiwqngrthfpiCLQMQKCKVKLYMIPCKAIVRFWALKRfasvgslevdtedqkhhlssgfsapndfarsktlhdhssnlwDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILElnrgtesadlvlplfslgslfikegkavdaESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIkdsnymsldDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITekykgkehpsFVTHLLNLAASYSRSKNFVEAERLLRICLDImtktvgpddqsisfpmlhLGITLYHLNRDKEAEKLVLEALYIREIafgkdslpgklLTVWSLFRPD
maasflavpspsfcnHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILelnrgtesADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEkykgkehpSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREiafgkdslpgklltvwslfrpd
MAASFLAVPSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVgrgqegrelleecllITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFRPD
************FCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLE*******************************NLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLF***
***************************GIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFRP*
********PSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGS*************SGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFRPD
*AASFLAVPSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASFLAVPSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLELFNEVKSMIMxxxxxxxxxxxxxxxxxxxxxINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTxxxxxxxxxxxxxxxxxxxxxYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLLTVWSLFRPD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.486 0.189 0.240 3e-13
Q6AZT71300 Nephrocystin-3 OS=Xenopus N/A no 0.486 0.190 0.240 8e-13
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.513 0.196 0.225 7e-11
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.523 0.201 0.224 8e-11
P0CI651303 Nephrocystin-3 OS=Danio r yes no 0.560 0.219 0.231 8e-11
P46822540 Kinesin light chain OS=Ca yes no 0.470 0.444 0.252 1e-08
Q07866573 Kinesin light chain 1 OS= no no 0.437 0.389 0.252 3e-08
Q5R581560 Kinesin light chain 1 OS= yes no 0.437 0.398 0.252 4e-08
Q2HJJ0616 Kinesin light chain 4 OS= no no 0.503 0.417 0.238 8e-08
Q5PQM2619 Kinesin light chain 4 OS= no no 0.482 0.397 0.247 8e-08
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function desciption
 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 118/274 (43%), Gaps = 26/274 (9%)

Query: 245  VTSLLGMAKVLG----SIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKE 300
            +TSL  + + LG     +G   +AV    R + I E     +   +   L  L  ++++ 
Sbjct: 923  MTSLADLYETLGRFLKDLGLLSQAVTPLQRSLEIRETALDPDHPSVAQSLHQLAGVYVQS 982

Query: 301  GKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIK 360
             K  +AE ++ + L+I    YG    RV   + +LA         E+A +L KK+L++ +
Sbjct: 983  KKFGNAEQLYKQALEISENAYGSEHMRVARELDALAVLYQKQNKFEQAEQLRKKSLKIRQ 1042

Query: 361  DS--------------------NYMSLDDSIMENMRI--DLAELLHIVGRGQEGRELLEE 398
             S                      ++L     +N R   +L  L ++    +     L+ 
Sbjct: 1043 KSARRKGSMYGFALLRRRALQLEELTLGKDTSDNARTLNELGVLYYLQNNLETAETFLKR 1102

Query: 399  CLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISF 458
             L + E+  G +HP     + NLAA Y+  K + +AE L    LDI  + + PD  S+++
Sbjct: 1103 SLEMRERVLGADHPDCAQSINNLAALYNEKKQYDKAEELYERALDIRRRALSPDHPSLAY 1162

Query: 459  PMLHLGITLYHLNRDKEAEKLVLEALYIREIAFG 492
             + HL +      +  +A  L   A+ IR+ +FG
Sbjct: 1163 TVKHLAVLYKRKGKLDKAVPLYELAVEIRQKSFG 1196




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling that regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Xenopus tropicalis (taxid: 8364)
>sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function description
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 Back     alignment and function description
>sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 Back     alignment and function description
>sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 Back     alignment and function description
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
224135115579 predicted protein [Populus trichocarpa] 0.970 0.854 0.668 0.0
225455344573 PREDICTED: nephrocystin-3-like [Vitis vi 0.931 0.828 0.665 0.0
302143919559 unnamed protein product [Vitis vinifera] 0.903 0.824 0.687 0.0
255561868505 kinesin light chain, putative [Ricinus c 0.819 0.827 0.677 1e-164
356509235577 PREDICTED: nephrocystin-3-like [Glycine 0.929 0.821 0.593 1e-163
357463995580 Kinesin light chain [Medicago truncatula 0.970 0.853 0.596 1e-156
297792665562 hypothetical protein ARALYDRAFT_495375 [ 0.905 0.822 0.575 1e-156
8809597498 unnamed protein product [Arabidopsis tha 0.884 0.905 0.587 1e-155
449497357561 PREDICTED: nephrocystin-3-like [Cucumis 0.933 0.848 0.571 1e-154
18423468564 kinesin light chain-related protein [Ara 0.870 0.787 0.594 1e-154
>gi|224135115|ref|XP_002321987.1| predicted protein [Populus trichocarpa] gi|222868983|gb|EEF06114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/497 (66%), Positives = 395/497 (79%), Gaps = 2/497 (0%)

Query: 1   MAASFLAVPSPSFCNHRKSQVGLCLPSGIWQNGRTHFPICLQMQKCKVKLYMIPCKAIVR 60
           MA S L    P   N R +Q  + L S   Q G T F ICLQ QKC ++LYMIP   + R
Sbjct: 1   MAVSLLH--HPPLSNQRITQAFVDLNSRSLQRGITCFSICLQKQKCSIELYMIPTTTVAR 58

Query: 61  FWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSKTLHDHSSNLWDGMNDFERQLLE 120
            W LK FAS GSL  + E Q++ +SSGFS  NDF RSKT+ D SS   DG+ DFERQL E
Sbjct: 59  HWMLKTFASAGSLNAEVECQENQISSGFSTSNDFGRSKTVADSSSKPSDGVKDFERQLQE 118

Query: 121 LFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKF 180
           LF+EVK MI MGNKNDA+DLLQANYE VKEQINAG++GIEE A LDIIALGY+ IGDLK 
Sbjct: 119 LFDEVKMMIKMGNKNDAMDLLQANYEFVKEQINAGSRGIEEAATLDIIALGYMAIGDLKS 178

Query: 181 VQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKT 240
           V  +L+ +  +V+ L DDEPLLD++L+HMGSMYS L  +EKSMLVYQRVI +LE  +GK 
Sbjct: 179 VGFILNKLDEVVERLTDDEPLLDSVLIHMGSMYSALGKFEKSMLVYQRVIAILERIHGKG 238

Query: 241 SILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKE 300
           S  LV+ LLGMAK+LGSIG+A KA+E+Y RVI+ILE +RG ES DLV+PL  LG+L IKE
Sbjct: 239 SAFLVSPLLGMAKILGSIGKATKAIEVYQRVISILESSRGAESKDLVVPLSGLGNLLIKE 298

Query: 301 GKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIK 360
           G+A DAES+F+RIL IY + YGE DGR GMA+CS+AH KCA GNAEEA+ LY+KAL+VIK
Sbjct: 299 GRATDAESLFNRILSIYKESYGEYDGRFGMALCSVAHVKCATGNAEEAINLYRKALQVIK 358

Query: 361 DSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLN 420
           D++YM++DDSIME MRIDLAELLH+VGRG EGRELLEECLLITEKYKGK+HPS VTHL+N
Sbjct: 359 DADYMAVDDSIMERMRIDLAELLHVVGRGNEGRELLEECLLITEKYKGKDHPSSVTHLIN 418

Query: 421 LAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLV 480
           LA SYS+SKN+V+AERLLR  L+IM K+V PDD SI+FPMLHL +TLY LN+D+EAE+L 
Sbjct: 419 LATSYSQSKNYVQAERLLRTSLEIMMKSVRPDDSSITFPMLHLAVTLYRLNQDEEAEQLT 478

Query: 481 LEALYIREIAFGKDSLP 497
           LE L+IRE AFGKDSLP
Sbjct: 479 LEVLHIREKAFGKDSLP 495




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225455344|ref|XP_002272297.1| PREDICTED: nephrocystin-3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143919|emb|CBI23024.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561868|ref|XP_002521943.1| kinesin light chain, putative [Ricinus communis] gi|223538868|gb|EEF40467.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356509235|ref|XP_003523356.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|357463995|ref|XP_003602279.1| Kinesin light chain [Medicago truncatula] gi|355491327|gb|AES72530.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|297792665|ref|XP_002864217.1| hypothetical protein ARALYDRAFT_495375 [Arabidopsis lyrata subsp. lyrata] gi|297310052|gb|EFH40476.1| hypothetical protein ARALYDRAFT_495375 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|8809597|dbj|BAA97148.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449497357|ref|XP_004160380.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18423468|ref|NP_568784.1| kinesin light chain-related protein [Arabidopsis thaliana] gi|53828571|gb|AAU94395.1| At5g53080 [Arabidopsis thaliana] gi|332008918|gb|AED96301.1| kinesin light chain-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
TAIR|locus:2168387564 AT5G53080 [Arabidopsis thalian 0.878 0.794 0.571 1.9e-131
UNIPROTKB|Q5LU72374 SPO1186 "TPR domain protein" [ 0.556 0.759 0.272 1.6e-15
TIGR_CMR|SPO_1186374 SPO_1186 "TPR domain protein" 0.556 0.759 0.272 1.6e-15
ASPGD|ASPL0000018313 1288 AN3547 [Emericella nidulans (t 0.596 0.236 0.266 4.4e-14
UNIPROTKB|F1NZ11497 KLC1 "Uncharacterized protein" 0.682 0.700 0.221 1.2e-09
UNIPROTKB|F1SNS5293 F1SNS5 "Uncharacterized protei 0.403 0.703 0.230 1.8e-09
UNIPROTKB|A0JM231311 nphp3 "Nephrocystin-3" [Xenopu 0.403 0.157 0.220 6.1e-09
UNIPROTKB|E1BSU81316 NPHP3 "Uncharacterized protein 0.403 0.156 0.225 6.1e-09
UNIPROTKB|Q6AZT71300 nphp3 "Nephrocystin-3" [Xenopu 0.403 0.158 0.225 1e-08
MGI|MGI:19212751325 Nphp3 "nephronophthisis 3 (ado 0.403 0.155 0.244 2.2e-08
TAIR|locus:2168387 AT5G53080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1289 (458.8 bits), Expect = 1.9e-131, P = 1.9e-131
 Identities = 265/464 (57%), Positives = 347/464 (74%)

Query:    39 ICLQMQKCKVKLYMIPCKAIVRFWALKRFASVGSLEVDTEDQKHHLSSGFSAPNDFARSK 98
             +CL+ QK K KLY+IP     R +      SV S  +       + +SG S   +  RS 
Sbjct:    37 VCLRNQKRKPKLYLIPA----RHFLSTPIDSVSSSSITAS---RYATSGVS---EVQRST 86

Query:    99 TLHDHSSNLWDGMNDFERQLLELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKG 158
             +    S+N+ + M +FE +L ELFNEVKSM+ +G ++DA+DLL+ANY AVKE++++G KG
Sbjct:    87 S----SNNVTE-MEEFEMELQELFNEVKSMVKIGKESDAMDLLRANYVAVKEELDSGLKG 141

Query:   159 IEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLEN 218
             IE+ A+LDIIALGY+ +GDLK V +LLDM++ IVD+LKD EPLLD++L+H+GSMYS +  
Sbjct:   142 IEQAAVLDIIALGYMAVGDLKPVPALLDMINKIVDNLKDSEPLLDSVLMHVGSMYSVIGK 201

Query:   219 YEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELN 278
             +E ++LV+QR I +LE+RYGK + LLVT LLGMAK   S G+A KA+ +Y R +TILE N
Sbjct:   202 FENAILVHQRAIRILENRYGKCNTLLVTPLLGMAKSFASDGKATKAIGVYERTLTILERN 261

Query:   279 RGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHA 338
             RG+ES DLV+PLFSLG L +KEGKA +AE  F+ I+ IY K+YGE DGRVGMAMCSLA+A
Sbjct:   262 RGSESEDLVVPLFSLGKLLLKEGKAAEAEIPFTSIVNIYKKIYGERDGRVGMAMCSLANA 321

Query:   339 KCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVXXXXXXXXXXXX 398
             KC+ G+A EAV++Y+ ALR+IKDSNYM++D+SI+ENMRIDLAELLH V            
Sbjct:   322 KCSKGDANEAVDIYRNALRIIKDSNYMTIDNSILENMRIDLAELLHFVGRGDEGRELLEE 381

Query:   399 XXXITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISF 458
                I E++KGK HPS  THL+NLAASYSRSKN+VEAERLLR CL+IM  +VG + QSI+F
Sbjct:   382 CLLINERFKGKNHPSMATHLINLAASYSRSKNYVEAERLLRTCLNIMEVSVGSEGQSITF 441

Query:   459 PMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLP-GKLL 501
             PML+L +TL  LNRD+EAE++ L+ L IRE AFG+DSLP G+ L
Sbjct:   442 PMLNLAVTLSQLNRDEEAEQIALKVLRIREKAFGEDSLPVGEAL 485




GO:0009507 "chloroplast" evidence=ISM
GO:0042802 "identical protein binding" evidence=IEA
UNIPROTKB|Q5LU72 SPO1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1186 SPO_1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ11 KLC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNS5 F1SNS5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A0JM23 nphp3 "Nephrocystin-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSU8 NPHP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZT7 nphp3 "Nephrocystin-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1921275 Nphp3 "nephronophthisis 3 (adolescent)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 9e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 8e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 0.002
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
 Score = 49.3 bits (118), Expect = 9e-08
 Identities = 13/77 (16%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 200 PLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIG 259
           P L A L ++  +   L +Y++++ + ++ + +     G+       +L  +A++  ++G
Sbjct: 2   PDLAAALNNLALVLRRLGDYDEALELLEKALELAR-ELGEDHPETARALNNLARLYLALG 60

Query: 260 RAKKAVEIYHRVITILE 276
              +A+E   + + + E
Sbjct: 61  DYDEALEYLEKALALRE 77


Length = 78

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.94
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.92
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.92
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
KOG0547606 consensus Translocase of outer mitochondrial membr 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.86
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.86
KOG1126638 consensus DNA-binding cell division cycle control 99.85
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.84
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.83
KOG2076 895 consensus RNA polymerase III transcription factor 99.83
PRK04841 903 transcriptional regulator MalT; Provisional 99.83
PLN03218 1060 maturation of RBCL 1; Provisional 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
PLN03218 1060 maturation of RBCL 1; Provisional 99.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.8
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.8
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.78
KOG2003 840 consensus TPR repeat-containing protein [General f 99.77
KOG0547606 consensus Translocase of outer mitochondrial membr 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.76
PRK12370553 invasion protein regulator; Provisional 99.75
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
KOG2003840 consensus TPR repeat-containing protein [General f 99.75
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.73
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.73
PRK11189296 lipoprotein NlpI; Provisional 99.73
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.71
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.71
PRK11189296 lipoprotein NlpI; Provisional 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.7
PRK04841903 transcriptional regulator MalT; Provisional 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.7
KOG2076 895 consensus RNA polymerase III transcription factor 99.7
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.69
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.69
KOG1125579 consensus TPR repeat-containing protein [General f 99.69
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
PLN03077 857 Protein ECB2; Provisional 99.65
KOG1125579 consensus TPR repeat-containing protein [General f 99.65
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.65
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.65
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PLN03077 857 Protein ECB2; Provisional 99.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.61
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.51
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.48
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.48
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.47
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.46
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.42
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.41
PLN02789320 farnesyltranstransferase 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.4
PLN02789320 farnesyltranstransferase 99.4
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.36
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.35
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.35
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.34
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.34
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.28
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.28
PRK15359144 type III secretion system chaperone protein SscB; 99.27
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.26
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.25
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.25
PRK10370198 formate-dependent nitrite reductase complex subuni 99.23
PRK15359144 type III secretion system chaperone protein SscB; 99.22
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.21
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.21
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.2
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.2
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.18
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.18
KOG1585308 consensus Protein required for fusion of vesicles 99.16
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.15
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.13
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.12
PRK10370198 formate-dependent nitrite reductase complex subuni 99.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.11
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.11
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.09
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.08
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.07
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.07
KOG1128777 consensus Uncharacterized conserved protein, conta 99.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.05
KOG1915677 consensus Cell cycle control protein (crooked neck 99.05
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.05
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.01
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.01
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.01
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.01
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.0
KOG0553304 consensus TPR repeat-containing protein [General f 99.0
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.99
KOG0553304 consensus TPR repeat-containing protein [General f 98.96
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.96
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.95
KOG1585308 consensus Protein required for fusion of vesicles 98.95
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.94
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.94
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.89
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.88
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.87
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.79
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.75
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.74
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.74
PF12688120 TPR_5: Tetratrico peptide repeat 98.72
PF12688120 TPR_5: Tetratrico peptide repeat 98.71
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.69
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.69
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.68
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.66
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.65
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.65
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.63
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.63
KOG1586288 consensus Protein required for fusion of vesicles 98.62
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
KOG2471696 consensus TPR repeat-containing protein [General f 98.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.6
PRK10803263 tol-pal system protein YbgF; Provisional 98.59
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.59
PRK10803263 tol-pal system protein YbgF; Provisional 98.58
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.57
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.56
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.54
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.53
KOG4555175 consensus TPR repeat-containing protein [Function 98.52
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.52
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.5
COG3898531 Uncharacterized membrane-bound protein [Function u 98.47
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.47
KOG1586288 consensus Protein required for fusion of vesicles 98.45
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.45
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.42
KOG4555175 consensus TPR repeat-containing protein [Function 98.4
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.39
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.38
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.36
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.35
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.35
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.33
PF13512142 TPR_18: Tetratricopeptide repeat 98.3
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.29
PRK15331165 chaperone protein SicA; Provisional 98.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.28
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.26
PRK11906458 transcriptional regulator; Provisional 98.25
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.23
PRK15331165 chaperone protein SicA; Provisional 98.22
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.21
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.2
COG4700251 Uncharacterized protein conserved in bacteria cont 98.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.19
COG4700251 Uncharacterized protein conserved in bacteria cont 98.16
PF13512142 TPR_18: Tetratricopeptide repeat 98.15
PRK11906458 transcriptional regulator; Provisional 98.15
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.11
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.11
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.08
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.07
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.05
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.03
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.01
KOG4234271 consensus TPR repeat-containing protein [General f 98.0
KOG4234271 consensus TPR repeat-containing protein [General f 97.99
KOG2471 696 consensus TPR repeat-containing protein [General f 97.92
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.92
PF1337173 TPR_9: Tetratricopeptide repeat 97.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.87
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.86
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.85
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.84
PF1337173 TPR_9: Tetratricopeptide repeat 97.84
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.84
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.83
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.83
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.81
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.77
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.77
KOG4648536 consensus Uncharacterized conserved protein, conta 97.73
COG5159 421 RPN6 26S proteasome regulatory complex component [ 97.71
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.69
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.65
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.65
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.65
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.64
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.64
KOG1550552 consensus Extracellular protein SEL-1 and related 97.59
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.58
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.58
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.57
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.51
KOG20411189 consensus WD40 repeat protein [General function pr 97.5
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.45
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.43
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.41
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.4
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.34
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.33
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.32
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.25
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.16
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.16
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.11
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.11
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.09
PF1343134 TPR_17: Tetratricopeptide repeat 97.04
PF1342844 TPR_14: Tetratricopeptide repeat 97.04
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.03
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.03
PF1342844 TPR_14: Tetratricopeptide repeat 97.0
PF1343134 TPR_17: Tetratricopeptide repeat 96.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.94
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.93
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.89
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.87
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.77
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.7
KOG1550552 consensus Extracellular protein SEL-1 and related 96.69
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.67
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.66
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.63
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.58
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.49
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.46
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.4
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.15
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.14
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.75
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.71
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.63
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.6
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 95.59
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.48
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.47
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.42
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.36
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.28
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.22
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.15
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.05
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.01
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.93
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.81
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.64
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.44
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.17
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.16
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.13
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.04
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.88
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.77
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 93.7
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.56
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.4
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.36
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.26
KOG1914656 consensus mRNA cleavage and polyadenylation factor 93.15
COG5187412 RPN7 26S proteasome regulatory complex component, 93.15
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.1
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.91
KOG4507886 consensus Uncharacterized conserved protein, conta 92.76
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.75
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.29
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.23
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.0
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.96
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.88
KOG4507886 consensus Uncharacterized conserved protein, conta 91.85
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.83
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.78
KOG2908380 consensus 26S proteasome regulatory complex, subun 91.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.48
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.41
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.29
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.29
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.09
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 90.86
KOG0687393 consensus 26S proteasome regulatory complex, subun 90.86
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 90.72
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.69
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.34
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.26
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 90.07
COG3629280 DnrI DNA-binding transcriptional activator of the 90.04
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.04
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.89
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 89.87
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 89.86
KOG0508 615 consensus Ankyrin repeat protein [General function 89.73
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 89.64
COG5187412 RPN7 26S proteasome regulatory complex component, 89.33
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.16
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 89.05
KOG2581493 consensus 26S proteasome regulatory complex, subun 89.03
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.01
COG3629280 DnrI DNA-binding transcriptional activator of the 88.97
COG3947361 Response regulator containing CheY-like receiver a 88.8
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 88.62
PRK10941269 hypothetical protein; Provisional 88.51
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 88.41
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.31
PRK10941269 hypothetical protein; Provisional 87.76
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 87.74
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 87.65
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 87.15
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 87.09
PRK14707 2710 hypothetical protein; Provisional 86.77
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 86.76
KOG4014248 consensus Uncharacterized conserved protein (conta 86.6
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 86.51
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.48
KOG0508615 consensus Ankyrin repeat protein [General function 86.32
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 86.3
PF1304150 PPR_2: PPR repeat family 86.25
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 85.65
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 85.64
PRK14707 2710 hypothetical protein; Provisional 85.52
PF1285434 PPR_1: PPR repeat 85.44
KOG2422 665 consensus Uncharacterized conserved protein [Funct 85.13
PF1285434 PPR_1: PPR repeat 85.12
PF1304150 PPR_2: PPR repeat family 85.0
COG3947361 Response regulator containing CheY-like receiver a 84.1
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 83.53
KOG1258 577 consensus mRNA processing protein [RNA processing 83.37
COG2178204 Predicted RNA-binding protein of the translin fami 83.34
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.17
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 82.72
KOG4814 872 consensus Uncharacterized conserved protein [Funct 82.49
KOG4563400 consensus Cell cycle-regulated histone H1-binding 82.4
KOG4521 1480 consensus Nuclear pore complex, Nup160 component [ 81.85
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 81.84
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 81.77
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 81.74
COG4976287 Predicted methyltransferase (contains TPR repeat) 81.11
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 80.86
KOG3364149 consensus Membrane protein involved in organellar 80.68
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 80.67
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 80.49
COG4976287 Predicted methyltransferase (contains TPR repeat) 80.41
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
Probab=100.00  E-value=2.7e-33  Score=259.96  Aligned_cols=311  Identities=28%  Similarity=0.372  Sum_probs=293.3

Q ss_pred             HHHhhhhcCCCchHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHhhcCCHHHHHHH
Q 010446          188 MSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEI  267 (510)
Q Consensus       188 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~  267 (510)
                      ........+...|....+...++..|..+|+|++|+..+++++++..+..+.+++.+......+|.+|..++++.+|+.+
T Consensus       184 ~~~~~~~~~~~~P~~~~~~~~La~~y~~~g~~e~A~~l~k~Al~~l~k~~G~~hl~va~~l~~~a~~y~~~~k~~eAv~l  263 (508)
T KOG1840|consen  184 LDIQAKGLGDEDPERLRTLRNLAEMYAVQGRLEKAEPLCKQALRILEKTSGLKHLVVASMLNILALVYRSLGKYDEAVNL  263 (508)
T ss_pred             HHHHHHhcccCCchHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHccCccCHHHHHHHHHHHHHHHHhccHHHHHHH
Confidence            33334455778888888889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHCCCHHH
Q 010446          268 YHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEE  347 (510)
Q Consensus       268 ~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~  347 (510)
                      |++|+.+.+...|+++|..+.++.+||..|...|++++|..++++|+++.++..+..++.+...+.+++.++...+++++
T Consensus       264 y~~AL~i~e~~~G~~h~~va~~l~nLa~ly~~~GKf~EA~~~~e~Al~I~~~~~~~~~~~v~~~l~~~~~~~~~~~~~Ee  343 (508)
T KOG1840|consen  264 YEEALTIREEVFGEDHPAVAATLNNLAVLYYKQGKFAEAEEYCERALEIYEKLLGASHPEVAAQLSELAAILQSMNEYEE  343 (508)
T ss_pred             HHHHHHHHHHhcCCCCHHHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcchhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhccCCCCChHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHh
Q 010446          348 AVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSR  427 (510)
Q Consensus       348 A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~  427 (510)
                      |..++++++++...  ..+++++.++.++.+||.+|..+|++++|.+++++|+.+.++..+..++.....+++||..|.+
T Consensus       344 a~~l~q~al~i~~~--~~g~~~~~~a~~~~nl~~l~~~~gk~~ea~~~~k~ai~~~~~~~~~~~~~~~~~l~~la~~~~~  421 (508)
T KOG1840|consen  344 AKKLLQKALKIYLD--APGEDNVNLAKIYANLAELYLKMGKYKEAEELYKKAIQILRELLGKKDYGVGKPLNQLAEAYEE  421 (508)
T ss_pred             HHHHHHHHHHHHHh--hccccchHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHhcccCcChhhhHHHHHHHHHHHH
Confidence            99999999999985  3678888899999999999999999999999999999999999888899999999999999999


Q ss_pred             ccCHHHHHHHHHHHHHHHHHHhCCCChhhHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhcCCCCcchhHH
Q 010446          428 SKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPGKLL  501 (510)
Q Consensus       428 ~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~  501 (510)
                      .+++.+|...|.++..+. +..|+++|++...+.+|+.+|..+|++++|.++.++++...++.+|..++.....
T Consensus       422 ~k~~~~a~~l~~~~~~i~-~~~g~~~~~~~~~~~nL~~~Y~~~g~~e~a~~~~~~~~~~~~~~~~~~~~~~~~~  494 (508)
T KOG1840|consen  422 LKKYEEAEQLFEEAKDIM-KLCGPDHPDVTYTYLNLAALYRAQGNYEAAEELEEKVLNAREQRLGTASPTVEDE  494 (508)
T ss_pred             hcccchHHHHHHHHHHHH-HHhCCCCCchHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcCCCCCcchhHH
Confidence            999999999999999999 8899999999999999999999999999999999999999999999888765543



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2178 Predicted RNA-binding protein of the translin family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 4e-08
3nf1_A 311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-06
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 5e-08
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 2e-07
3ceq_A 283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 3e-06
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 6e-08
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 2e-07
3edt_B 283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 3e-06
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 43/172 (25%), Positives = 75/172 (43%) Query: 198 DEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGS 257 D P + +L + +Y Y+ + + + + E GK + +L +A + G Sbjct: 64 DHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGK 123 Query: 258 IGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIY 317 G+ K+A + R + I E G + D+ L +L L +GK + E + R L+IY Sbjct: 124 RGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIY 183 Query: 318 TKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDD 369 G +D V +LA G ++A LYK+ L + + S+DD Sbjct: 184 QTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDD 235
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 9e-34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-26
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 8e-15
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-13
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 2e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-17
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-10
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-12
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-13
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-10
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 9e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 9e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-07
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-08
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 3e-08
3qww_A433 SET and MYND domain-containing protein 2; methyltr 1e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 1e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 4e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 5e-07
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 3e-06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 6e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 3e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-04
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
 Score =  131 bits (331), Expect = 7e-35
 Identities = 59/290 (20%), Positives = 100/290 (34%), Gaps = 17/290 (5%)

Query: 206 LLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAV 265
             H     S L     ++ + ++ +  LE   G     + T L  +A V     + K+A 
Sbjct: 4   SHHHHHHSSGLVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAA 63

Query: 266 EIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGEND 325
            + +  + I E   G +   +   L +L  L+ K GK  +AE +  R L+I  KV G+  
Sbjct: 64  HLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFH 123

Query: 326 GRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDD------SIMENMRIDL 379
             V   + +LA      G AEE    Y++AL +        L            N    L
Sbjct: 124 PDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYAT----RLGPDDPNVAKTKNN----L 175

Query: 380 AELLHIVGRGQEGRELLEECL-LITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLL 438
           A      G+ Q+   L +E L    EK  G  +       ++            ++    
Sbjct: 176 ASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSAPYG 235

Query: 439 RICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIRE 488
                   K    D  +++  +  LG       + + A  L   A   R+
Sbjct: 236 EYGSWY--KACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRK 283


>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.97
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.95
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.94
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.94
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.93
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.9
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.87
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.86
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.86
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.85
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.85
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.84
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.84
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.83
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.83
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.83
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.82
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.82
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.81
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.78
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.77
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.76
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.74
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.74
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.72
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.71
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.69
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.67
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.67
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.66
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.66
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.65
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.64
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.62
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.62
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.62
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.56
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.55
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.55
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.54
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.54
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.54
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.51
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.51
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.5
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.49
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.48
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.47
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.45
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.41
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.41
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.4
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.39
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.39
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.36
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.35
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.35
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.34
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.33
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.32
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.29
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.28
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.28
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.27
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.27
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.27
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.26
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.25
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.19
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.18
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.17
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.14
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.13
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.12
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.12
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.1
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.07
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
3k9i_A117 BH0479 protein; putative protein binding protein, 98.98
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.98
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.96
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.96
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.94
3k9i_A117 BH0479 protein; putative protein binding protein, 98.93
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.88
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.81
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.77
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.73
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.72
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.7
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.69
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.65
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.65
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.63
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.61
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.61
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.6
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.59
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.42
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.34
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.32
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.3
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.15
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.15
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.05
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.96
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.95
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.95
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.91
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.87
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.83
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.81
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.77
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.55
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.15
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.75
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.4
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.36
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.28
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.27
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.2
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.99
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 95.91
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.7
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.2
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.13
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.09
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.52
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.44
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.0
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.8
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.65
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.56
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.41
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 92.98
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.62
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 92.61
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.37
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.62
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.09
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.17
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 89.82
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 89.71
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 88.16
2npm_A260 14-3-3 domain containing protein; cell regulator p 87.06
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 86.99
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.97
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 86.03
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 85.17
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 84.76
2o8p_A227 14-3-3 domain containing protein; signaling protei 84.65
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 84.55
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 84.43
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 83.32
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 81.21
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 81.15
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=9.6e-30  Score=243.14  Aligned_cols=342  Identities=17%  Similarity=0.192  Sum_probs=292.4

Q ss_pred             HHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHHHhcCCCCh-hHHHHHHHHHHHHHhhCChHHHHHHHHHHHHhhhhcCC
Q 010446          119 LELFNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGI-EEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKD  197 (510)
Q Consensus       119 ~~l~~~~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~  197 (510)
                      ..++..|..+...|++++|+.+++++++.       .+..+ ..+.++..+|.++...|++++|+.++++++.+.... .
T Consensus        10 ~~l~~~g~~~~~~g~~~~A~~~~~~al~~-------~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~-~   81 (406)
T 3sf4_A           10 LELALEGERLCKSGDCRAGVSFFEAAVQV-------GTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTI-G   81 (406)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHH-------CCSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHT-T
T ss_pred             HHHHHHHHHHHHhccHHHHHHHHHHHHhc-------CcccHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhc-c
Confidence            34677899999999999999999999987       23233 346789999999999999999999999999988764 4


Q ss_pred             CchHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHhhcCC-----------------
Q 010446          198 DEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGR-----------------  260 (510)
Q Consensus       198 ~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~-----------------  260 (510)
                      +.+....++..+|.++...|++++|+.++++++++....  .+.+..+.++..+|.+|...|+                 
T Consensus        82 ~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~--~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~a  159 (406)
T 3sf4_A           82 DQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISREL--NDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEV  159 (406)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHH--TCHHHHHHHHHHHHHHHHHHHHTCC-------CCCCHHH
T ss_pred             ccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhc--ccccchHHHHHHHHHHHHHcCCcccccccchhhhhhhhH
Confidence            557778889999999999999999999999999998775  3445678899999999999999                 


Q ss_pred             ---HHHHHHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHH
Q 010446          261 ---AKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAH  337 (510)
Q Consensus       261 ---~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~  337 (510)
                         +++|+.++++++++.....  +.+....++.++|.++...|++++|+.++++++++....  ++.+....++.++|.
T Consensus       160 ~~~~~~A~~~~~~al~~~~~~~--~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~--~~~~~~~~~~~~la~  235 (406)
T 3sf4_A          160 RDALQAAVDFYEENLSLVTALG--DRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEF--GDKAAERRAYSNLGN  235 (406)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTT--CHHHHHHHHHHHHHHHHHHTBHHHHHHHHHHHHHHHHHT--TCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcc--CcHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhc--CCcHHHHHHHHHHHH
Confidence               9999999999999987753  456778899999999999999999999999999998775  344567779999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHhhccCCCCChHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHhhCCCChhHHHH
Q 010446          338 AKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTH  417 (510)
Q Consensus       338 ~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~  417 (510)
                      ++...|++++|+.++++++.+....    .++.....++..+|.++...|++++|+.++++++.+.....  +.+....+
T Consensus       236 ~~~~~g~~~~A~~~~~~al~~~~~~----~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~--~~~~~~~~  309 (406)
T 3sf4_A          236 AYIFLGEFETASEYYKKTLLLARQL----KDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELN--DRIGEGRA  309 (406)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHHHHT----TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT--CHHHHHHH
T ss_pred             HHHHcCChHHHHHHHHHHHHHHHhC----cCchHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcC--CcHHHHHH
Confidence            9999999999999999999998763    45566678889999999999999999999999999887752  45666788


Q ss_pred             HHHHHHHHHhccCHHHHHHHHHHHHHHHHHHhCCCChhhHHHHHHHHHHHHhcCChHHHHHHHHH
Q 010446          418 LLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLE  482 (510)
Q Consensus       418 ~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~  482 (510)
                      +..+|.+|...|++++|+.++++++++....  .+.+....++..+|.++...|+...+...+.+
T Consensus       310 ~~~la~~~~~~g~~~~A~~~~~~al~~~~~~--~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~  372 (406)
T 3sf4_A          310 CWSLGNAYTALGNHDQAMHFAEKHLEISREV--GDKSGELTARLNLSDLQMVLGLSYSTNNSIMS  372 (406)
T ss_dssp             HHHHHHHHHHHTCHHHHHHHHHHHHHHHHHT--TCHHHHHHHHHHHHHHHHHHHTTSCC------
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh--cCCcchhHHHHHHHHHHHHhhHhHHHHHHHHH
Confidence            9999999999999999999999999998775  34567788899999999999987544433333



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-10
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.002
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.002
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.003
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]
 Score = 60.3 bits (144), Expect = 2e-10
 Identities = 52/378 (13%), Positives = 125/378 (33%), Gaps = 22/378 (5%)

Query: 115 ERQLLELFNEVKSMIMM--GNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGY 172
           E  +   FN +++ + +  GN ++A  L +    A+  +          +    ++    
Sbjct: 7   EDTMHAEFNALRAQVAINDGNPDEAERLAK---LAL--EELPPGWFYSRIVATSVLGEVL 61

Query: 173 VYIGDLKFVQSLLDMMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINV 232
              G+L    +L+     +          L +++     +       + +    ++   +
Sbjct: 62  HCKGELTRSLALMQQTEQMARQHDVWHYALWSLI-QQSEILFAQGFLQTAWETQEKAFQL 120

Query: 233 LESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFS 292
           +  ++ +   +    +   A++L +  R  +A       I +L   +  +       L  
Sbjct: 121 INEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQC---LAM 177

Query: 293 LGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELY 352
           L    +  G   +A S  +R+  +       +   +  A           G+   A    
Sbjct: 178 LIQCSLARGDLDNARSQLNRLENLLGN-GKYHSDWISNANKVRVIYWQMTGDKAAAANWL 236

Query: 353 KKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHP 412
           +   +    +N+       ++    ++A    ++G  +    +LEE          +   
Sbjct: 237 RHTAKPEFANNH------FLQGQWRNIARAQILLGEFEPAEIVLEELNEN--ARSLRLMS 288

Query: 413 SFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFP-MLHLGITLYHLN 471
               +LL L   Y ++    +A+R+L   L +  +T       I    M      L  LN
Sbjct: 289 DLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQLIQLN 348

Query: 472 RDKEAEKLVLEALYIREI 489
              E E+   + + +REI
Sbjct: 349 TLPELEQHRAQRI-LREI 365


>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.94
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.91
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.83
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.82
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.77
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.76
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.74
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.71
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.46
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.45
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.39
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.38
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.34
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.33
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.28
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.23
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.2
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.2
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.17
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.11
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.02
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.98
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.96
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.89
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.61
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.5
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.37
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.92
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.78
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.25
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.75
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 95.47
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 92.55
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.24
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 92.17
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 91.95
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 88.78
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.5
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 87.09
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 84.17
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 83.94
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 81.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=3e-29  Score=235.55  Aligned_cols=306  Identities=17%  Similarity=0.190  Sum_probs=261.4

Q ss_pred             HHHHHHHHHcCChhHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHhhCChHHHHHHHHHHHHhhhhcCCCchH
Q 010446          122 FNEVKSMIMMGNKNDAIDLLQANYEAVKEQINAGNKGIEEVAILDIIALGYVYIGDLKFVQSLLDMMSGIVDSLKDDEPL  201 (510)
Q Consensus       122 ~~~~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  201 (510)
                      +..|..+++.|++++|+..++++++.          .|..+.++..+|.++...|++++|+..++++++..       |.
T Consensus         3 l~la~~~~~~G~~~~A~~~~~~~l~~----------~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-------p~   65 (388)
T d1w3ba_           3 MELAHREYQAGDFEAAERHCMQLWRQ----------EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-------PL   65 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHH----------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-------TT
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHh----------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-------CC
Confidence            45788899999999999999999987          77788899999999999999999999999998874       44


Q ss_pred             HHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHh---------------------------------------------
Q 010446          202 LDAILLHMGSMYSTLENYEKSMLVYQRVINVLESR---------------------------------------------  236 (510)
Q Consensus       202 ~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~---------------------------------------------  236 (510)
                      ...++..+|.+|...|++++|+..+.++.......                                             
T Consensus        66 ~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (388)
T d1w3ba_          66 LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL  145 (388)
T ss_dssp             CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHH
T ss_pred             CHHHHHHHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            45678999999999999999999998887641000                                             


Q ss_pred             ---------------cCCCChhHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHcC
Q 010446          237 ---------------YGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEG  301 (510)
Q Consensus       237 ---------------~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g  301 (510)
                                     .....|....++..+|..+...|++++|...++++++.        +|....++..+|.++...|
T Consensus       146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~~  217 (388)
T d1w3ba_         146 KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEAR  217 (388)
T ss_dssp             HTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHTTT
T ss_pred             cccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHh--------CcccHHHHHHHhhhhhccc
Confidence                           00011233567888999999999999999999999987        5667889999999999999


Q ss_pred             ChHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHhhccCCCCChHHHHHHHHHHH
Q 010446          302 KAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAE  381 (510)
Q Consensus       302 ~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~la~  381 (510)
                      ++++|+..++++...        .+.....+..+|.++...|++++|+..|++++++       .|+.   ..++..+|.
T Consensus       218 ~~~~A~~~~~~~~~~--------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-------~p~~---~~~~~~l~~  279 (388)
T d1w3ba_         218 IFDRAVAAYLRALSL--------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL-------QPHF---PDAYCNLAN  279 (388)
T ss_dssp             CTTHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT-------CSSC---HHHHHHHHH
T ss_pred             cHHHHHHHHHHhHHH--------hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh-------CCCC---HHHHHHHHH
Confidence            999999999998875        2344567888999999999999999999999986       3433   346788999


Q ss_pred             HHHHcCChHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHhccCHHHHHHHHHHHHHHHHHHhCCCChhhHHHHH
Q 010446          382 LLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPML  461 (510)
Q Consensus       382 ~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~  461 (510)
                      ++...|++++|+..+++++..        .|.....+..+|.++...|++++|+.+|++++++        +|....++.
T Consensus       280 ~~~~~~~~~~A~~~~~~~~~~--------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~  343 (388)
T d1w3ba_         280 ALKEKGSVAEAEDCYNTALRL--------CPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--------FPEFAAAHS  343 (388)
T ss_dssp             HHHHHSCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--------CTTCHHHHH
T ss_pred             HHHHcCCHHHHHHHHHhhhcc--------CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--------CCCCHHHHH
Confidence            999999999999999998764        3455678889999999999999999999999873        567778899


Q ss_pred             HHHHHHHhcCChHHHHHHHHHHHHH
Q 010446          462 HLGITLYHLNRDKEAEKLVLEALYI  486 (510)
Q Consensus       462 ~la~~~~~~g~~~~A~~~~~~al~~  486 (510)
                      .+|.+|..+|++++|+.+|++++++
T Consensus       344 ~la~~~~~~g~~~~A~~~~~~al~l  368 (388)
T d1w3ba_         344 NLASVLQQQGKLQEALMHYKEAIRI  368 (388)
T ss_dssp             HHHHHHHTTTCCHHHHHHHHHHHTT
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHh
Confidence            9999999999999999999999975



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure