Citrus Sinensis ID: 010611

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MTGSRFNEANLQETIHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSLESGPQEILRRPLEVFAPESSHRSSEALSIETQHRLFGAVSQEILPDLHVDILSQRNSVLTTAPSSSISYVSAVRPLSLESDRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNTARTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKGGLELGSGSKSAIVTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccEEEcccccHHHHHHHHHcccEEEcccccccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccEEEEEcccccHHHHHHHHHccEEEEcccccccccccccEEEEEEccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccEEccccccHHHHHHHHHccEEEEcc
cccccHHHHHHHHHHHcHHHHHHHHccccccEccccccccccccccccccccccccccccHHHHHHHHHccHHHHHcHHccccccccccccccccccccccccccccccccccccccccccccccHHccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccHHHHHHHHcccEEEEccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccEEEEEccccHHHHHHHHHcccEEEEEcccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccHHccccccccccccccccccccccccccccccccEEEEEEEccccccEEEcccccHHHHHHHHcccEEEEEc
mtgsrfneanlqeTIHKPLEVAFQESICRPVETILHetirrpvdtiphetihrpldtisHETIRRSleavphdtiarpveavPQEILWRSLesgpqeilrrplevfapesshrssealsIETQHRLFGAVSQEILPDLHVDILSQrnsvlttapsssisyvsavrplslesdRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGafisvgatmpecdERLITVtasegpesryspaQKAVVLVFSRLIegtsekgldfssnkgllVNARLVVASNQvgcllgkggtiiSEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVtgrlrdnhfsgtlntartrstssvltetspysrlkdpasfgvhssvavshdfsqppltqgmdhlglshsldcpsspklwtaqtvtgvhlrgssdvgrgwsqglshhkgglelgsgsksaivtNTTVEiivpenvigsvygengsnlLRLRQVSCILNVFAY
mtgsrfneanlqetihkplevafQESICRPVETILhetirrpvdtiphetihrpldtishETIRRSLEavphdtiarpveavpQEILWRSLESGPQEILRRPLEVFAPESSHRSSEALSIETQHRLFGAVSQEILPDLHVDILSQRNSVlttapsssisyvSAVRPLSLESDRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTasegpesryspaQKAVVLVFSRLIEGTsekgldfssnKGLLVNARLVVASNQVgcllgkggtiisemrkVTGTSIRIISDQLLKCISENDRvvqisgefskvKDAVYNVtgrlrdnhfsgtlntartrstssvltetspysrlkdPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKgglelgsgskSAIVTNTTVEIIVPENVIGSVYGEngsnllrlrqvscilnvfay
MTGSRFNEANLQETIHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSLESGPQEILRRPLEVFAPESSHRSSEALSIETQHRLFGAVSQEILPDLHVDILSQRNSVLTTAPSSSISYVSAVRPLSLESDRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNTARTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWSQglshhkgglelgsgsksAIVTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
**************IHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSL*******************************QHRLFGAVSQEILPDLHVDILSQRNSVLTT*****ISYVSAVRPL******VATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVT************QKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFS******************************************************************KLWTAQTVTGVHLRGSSDVGRGWS****************KSAIVTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFA*
*******************************************************************************************************************************************************************************************FRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRL*******************NARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRL*************************************************************************************************************************VEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
MTGSRFNEANLQETIHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSLESGPQEILRRPLEVF************SIETQHRLFGAVSQEILPDLHVDILSQRNSVLTTAPSSSISYVSAVRPLSLESDRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNT***************YSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKGGLELGSGSKSAIVTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
****RFNEANLQETIHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSL****QEILRRPLEVFAPESSHRSSEALSIETQHRLFGAVSQEILPDLHVDILSQR************************************QQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGTSEK*******KGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNTARTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWS********************VTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGSRFNEANLQETIHKPLEVAFQESICRPVETILHETIRRPVDTIPHETIHRPLDTISHETIRRSLEAVPHDTIARPVEAVPQEILWRSLESGPQEILRRPLEVFAPESSHRSSEALSIETQHRLFGAVSQEILPDLHVDILSQRNSVLTTAPSSSISYVSAVRPLSLESDRVATLDARTQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNTARTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLDCPSSPKLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKGGLELGSGSKSAIVTNTTVEIIVPENVIGSVYGENGSNLLRLRQVSCILNVFAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query506 2.2.26 [Sep-21-2011]
P58223606 KH domain-containing prot no no 0.498 0.415 0.28 8e-20
O19048356 Poly(rC)-binding protein yes no 0.545 0.775 0.258 3e-15
P60335356 Poly(rC)-binding protein yes no 0.545 0.775 0.258 3e-15
Q15365356 Poly(rC)-binding protein yes no 0.545 0.775 0.258 3e-15
Q5E9A3356 Poly(rC)-binding protein yes no 0.545 0.775 0.258 3e-15
Q61990362 Poly(rC)-binding protein no no 0.569 0.795 0.260 1e-14
P57721371 Poly(rC)-binding protein no no 0.539 0.735 0.238 3e-13
P57722371 Poly(rC)-binding protein no no 0.539 0.735 0.238 4e-13
Q15366365 Poly(rC)-binding protein no no 0.563 0.780 0.262 2e-12
P57724403 Poly(rC)-binding protein no no 0.280 0.352 0.292 8e-09
>sp|P58223|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.0 bits (245), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 155/325 (47%), Gaps = 73/325 (22%)

Query: 181 TQQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPEC--DERLITVTAS 238
           ++ +E+ F++LC    +  VIGKGG+ I+ ++  +G+ I V  +  +C  DE +I VTA+
Sbjct: 307 SRSEELVFKVLCPLCNIMRVIGKGGSTIKRIREASGSCIEVNDSRTKCGDDECVIIVTAT 366

Query: 239 EGPESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGT 298
           E P+   S A +AV+L+   + +  +E            V  +L+V+S  +GC++GK G+
Sbjct: 367 ESPDDMKSMAVEAVLLLQEYINDEDAEN-----------VKMQLLVSSKVIGCVIGKSGS 415

Query: 299 IISEMRKVTGTSIRIISDQLLKCIS--ENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSG 356
           +I+E+RK T  +I         CIS  + D +V++SGE S V+DA+  +  RLR++   G
Sbjct: 416 VINEIRKRTNANI---------CISKGKKDDLVEVSGEVSSVRDALIQIVLRLREDVL-G 465

Query: 357 TLNTARTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQPPLTQGMDHLGLSHSLD 416
             ++  TR          P +R  D  SF   SS A    ++ P     M          
Sbjct: 466 DKDSVATR---------KPPAR-TDNCSFLSGSSNA---GYTLPSFMSSM---------- 502

Query: 417 CPSSPKLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKGGLELGSG---SKSAIVTNTTVEI 473
                      + +G H  GS   G               LGS    S   + +++ +EI
Sbjct: 503 ----------ASTSGFHGYGSFPAGDNV------------LGSTGPYSYGRLPSSSALEI 540

Query: 474 IVPENVIGSVYGENGSNLLRLRQVS 498
           ++P + +  V G+ G NL  +R++S
Sbjct: 541 LIPAHAMSKVMGKGGGNLENIRRIS 565

Arabidopsis thaliana (taxid: 3702)
>sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 Back     alignment and function description
>sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 Back     alignment and function description
>sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3 Back     alignment and function description
>sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 Back     alignment and function description
>sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
225464083 648 PREDICTED: KH domain-containing protein 0.707 0.552 0.657 1e-130
296088778585 unnamed protein product [Vitis vinifera] 0.707 0.611 0.657 1e-129
147789223569 hypothetical protein VITISV_022038 [Viti 0.707 0.629 0.657 1e-129
449438568 658 PREDICTED: KH domain-containing protein 0.721 0.554 0.593 1e-112
449516663 643 PREDICTED: KH domain-containing protein 0.685 0.539 0.572 1e-106
356546743 663 PREDICTED: poly(rC)-binding protein 3-li 0.662 0.505 0.609 1e-106
356557593 710 PREDICTED: KH domain-containing protein 0.662 0.471 0.552 1e-104
255563372 698 Poly(rC)-binding protein, putative [Rici 0.683 0.495 0.501 2e-98
356519471591 PREDICTED: KH domain-containing protein 0.660 0.565 0.553 3e-98
356528011433 PREDICTED: KH domain-containing protein 0.660 0.771 0.544 4e-98
>gi|225464083|ref|XP_002269250.1| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 248/377 (65%), Positives = 294/377 (77%), Gaps = 19/377 (5%)

Query: 125 RLFGAVSQEILPDLHVDILSQRNSVLTTAPSSSISYVSAVRPLSLESDRVATLDARTQQQ 184
           R    V Q+ LPD  VD+  QR SVL   PS++ISY S  RPLS+ ++R++TLD +T QQ
Sbjct: 238 RPLEVVPQQSLPDPRVDLFQQRGSVLPPIPSNTISYASGSRPLSINTERISTLDPKTSQQ 297

Query: 185 EVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESR 244
           EV F+ILCSND+VG VIGKGGTI++ALQ+EAGA ISVGA + ECDERLIT+TASE PESR
Sbjct: 298 EVIFKILCSNDRVGGVIGKGGTIVKALQNEAGASISVGAPVAECDERLITITASENPESR 357

Query: 245 YSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMR 304
           YSPAQ  V+LVF+R IE   EKGLD S +KG  V+ARLVV SNQVGCL+GKGGTIISEMR
Sbjct: 358 YSPAQNGVILVFNRSIEAGIEKGLD-SGSKGSPVSARLVVPSNQVGCLMGKGGTIISEMR 416

Query: 305 KVTGTSIRII-SDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHF-SGTLNTAR 362
           K +G  IRII SDQ+ KC SEND+VVQISGEF  V+D +Y++TGRLRDN F S TLN A 
Sbjct: 417 KASGAGIRIIGSDQVPKCASENDQVVQISGEFVNVQDGLYHITGRLRDNLFPSKTLNGAG 476

Query: 363 TRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQ-PPLTQGMDHLGLSHSLDCPSSP 421
            RS SS + E SPY R++DPASFG+HSSV VS  FS+   LTQ MDHLGLSHSLD P+SP
Sbjct: 477 IRS-SSAMNEISPYGRVRDPASFGLHSSVGVSPSFSRHTTLTQSMDHLGLSHSLDHPTSP 535

Query: 422 KLWTAQTVTGVHLRGSSDVGRGWSQGLSHHKGGLELGSGSKSAIVTNTTVEIIVPENVIG 481
           +LW +QTVTGV+ R              + KGG+ELGSGSKSAI+TNTTVEI++PENVIG
Sbjct: 536 RLWPSQTVTGVNPR--------------NIKGGIELGSGSKSAIITNTTVEIVIPENVIG 581

Query: 482 SVYGENGSNLLRLRQVS 498
           SVYGENG+NL RLR++S
Sbjct: 582 SVYGENGNNLARLRKIS 598

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088778|emb|CBI38228.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789223|emb|CAN69138.1| hypothetical protein VITISV_022038 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438568|ref|XP_004137060.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516663|ref|XP_004165366.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356546743|ref|XP_003541782.1| PREDICTED: poly(rC)-binding protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356557593|ref|XP_003547100.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
>gi|255563372|ref|XP_002522689.1| Poly(rC)-binding protein, putative [Ricinus communis] gi|223538165|gb|EEF39776.1| Poly(rC)-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356519471|ref|XP_003528396.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information
>gi|356528011|ref|XP_003532599.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
TAIR|locus:2017612621 AT1G51580 "AT1G51580" [Arabido 0.584 0.476 0.358 3.9e-40
TAIR|locus:2066020632 AT2G22600 "AT2G22600" [Arabido 0.377 0.302 0.405 6.7e-31
TAIR|locus:2150956 548 AT5G15270 "AT5G15270" [Arabido 0.332 0.306 0.365 2.2e-24
TAIR|locus:2161413644 AT5G46190 "AT5G46190" [Arabido 0.418 0.329 0.347 9e-24
TAIR|locus:2168367652 RCF3 "AT5G53060" [Arabidopsis 0.490 0.380 0.289 2e-21
TAIR|locus:2035807479 AT1G14170 "AT1G14170" [Arabido 0.541 0.572 0.319 4.8e-20
TAIR|locus:2831364606 AT4G18375 "AT4G18375" [Arabido 0.322 0.268 0.329 2.1e-18
MGI|MGI:108202362 Pcbp2 "poly(rC) binding protei 0.584 0.817 0.254 5.7e-16
UNIPROTKB|Q3SYT9349 PCBP2 "Poly(RC) binding protei 0.405 0.587 0.283 6.3e-16
UNIPROTKB|J9P7Y9356 PCBP1 "Uncharacterized protein 0.294 0.418 0.3 9.2e-16
TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 3.9e-40, P = 3.9e-40
 Identities = 117/326 (35%), Positives = 170/326 (52%)

Query:   183 QQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPE 242
             ++EV+FR+LC  DKVG++IGKGG ++RALQ+E+GA I V     + +ER+I ++A E  E
Sbjct:   273 EEEVAFRLLCPADKVGSLIGKGGAVVRALQNESGASIKVSDPTHDSEERIIVISARENLE 332

Query:   243 SRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISE 302
              R+S AQ  V+ V +R++E      + F  +  ++  ARL+V S  +G LLGKGG +ISE
Sbjct:   333 RRHSLAQDGVMRVHNRIVE------IGFEPSAAVV--ARLLVHSPYIGRLLGKGGHLISE 384

Query:   303 MRKVTGTSIRIIS-DQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDNHFSGTLNTA 361
             MR+ TG SIR+ + DQ  K  S++D +VQ+ G    V+DA++ +  RLR+  F G L   
Sbjct:   385 MRRATGASIRVFAKDQATKYESQHDEIVQVIGNLKTVQDALFQILCRLREAMFPGRLPFQ 444

Query:   362 RTRSTSSVLTETSPYSRLKDPASFGVHSSVAVSHDFSQP--PLTQGMDH-LGLSH----S 414
                          PY   + P  FG     A    +  P  P  +   H  G        
Sbjct:   445 GMGGPPPPFM--GPYP--EPPPPFGPRQYPASPDRYHSPVGPFHERHCHGPGFDRPPGPG 500

Query:   415 LDCPSSPKLWTAQTVTGVHLRGS--SDVGRGWSQXXXXXXXXXXXXXXXXXAIVTNTTVE 472
              D P SP  WT Q     H  G    DV  G++                   ++T+  VE
Sbjct:   501 FDRPPSPMSWTPQPGIDGHPGGMVPPDVNHGFA--------LRNEPIGSENPVMTSANVE 552

Query:   473 IIVPENVIGSVYGENGSNLLRLRQVS 498
             I++P+  +G VYGEN SNL  ++QVS
Sbjct:   553 IVIPQAYLGHVYGENCSNLNYIKQVS 578
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0003723 "RNA binding" evidence=IEA
TAIR|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:108202 Pcbp2 "poly(rC) binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYT9 PCBP2 "Poly(RC) binding protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7Y9 PCBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 2e-16
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 3e-14
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-10
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-09
pfam0001359 pfam00013, KH_1, KH domain 2e-09
pfam1301442 pfam13014, KH_3, KH domain 2e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-07
pfam0001359 pfam00013, KH_1, KH domain 4e-07
pfam1301442 pfam13014, KH_3, KH domain 5e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 6e-06
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 4e-05
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 9e-04
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 0.001
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information 
 Score = 73.3 bits (181), Expect = 2e-16
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 281 RLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKD 340
           RL+V S+Q G ++GKGG+ I E+R+ TG  IR+    L       +RVV ISG+ S V+ 
Sbjct: 3   RLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGS---TERVVTISGKPSAVQK 59

Query: 341 AVY 343
           A+ 
Sbjct: 60  ALL 62

Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 506
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 99.98
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.98
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 99.97
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 99.96
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 99.95
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 99.93
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 99.93
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 99.92
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.92
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 99.7
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.52
PRK13763180 putative RNA-processing protein; Provisional 99.45
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.34
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 99.23
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.21
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.14
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.09
PRK13763180 putative RNA-processing protein; Provisional 99.09
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.09
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.03
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.96
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.88
PF1301443 KH_3: KH domain 98.85
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.84
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.83
PF1301443 KH_3: KH domain 98.79
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.74
smart0032269 KH K homology RNA-binding domain. 98.72
COG1094194 Predicted RNA-binding protein (contains KH domains 98.56
smart0032269 KH K homology RNA-binding domain. 98.36
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 98.25
KOG2208 753 consensus Vigilin [Lipid transport and metabolism] 98.24
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.05
PRK08406140 transcription elongation factor NusA-like protein; 97.74
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 97.59
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.5
KOG2113394 consensus Predicted RNA binding protein, contains 97.49
KOG2208 753 consensus Vigilin [Lipid transport and metabolism] 97.48
PRK08406140 transcription elongation factor NusA-like protein; 97.47
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.36
KOG2113 394 consensus Predicted RNA binding protein, contains 97.35
KOG0119 554 consensus Splicing factor 1/branch point binding p 97.15
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.07
COG1094194 Predicted RNA-binding protein (contains KH domains 96.87
COG0195190 NusA Transcription elongation factor [Transcriptio 96.74
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 96.72
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 96.37
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.36
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 96.35
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.34
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.15
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.02
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 95.84
PRK12328374 nusA transcription elongation factor NusA; Provisi 95.73
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 95.7
TIGR01953341 NusA transcription termination factor NusA. This m 95.61
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.6
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 95.57
KOG2814345 consensus Transcription coactivator complex, P50 c 95.48
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.43
PRK12329449 nusA transcription elongation factor NusA; Provisi 95.3
PRK0046875 hypothetical protein; Provisional 95.27
COG0195190 NusA Transcription elongation factor [Transcriptio 95.13
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 95.08
PRK09202470 nusA transcription elongation factor NusA; Validat 95.03
PRK0282177 hypothetical protein; Provisional 94.84
COG183776 Predicted RNA-binding protein (contains KH domain) 94.68
KOG1588259 consensus RNA-binding protein Sam68 and related KH 94.57
KOG2814345 consensus Transcription coactivator complex, P50 c 94.55
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.49
KOG0119554 consensus Splicing factor 1/branch point binding p 94.45
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 94.45
PRK12704520 phosphodiesterase; Provisional 94.26
PRK00106535 hypothetical protein; Provisional 94.23
PRK0046875 hypothetical protein; Provisional 94.06
PRK0106478 hypothetical protein; Provisional 93.95
COG5176269 MSL5 Splicing factor (branch point binding protein 93.73
PRK0282177 hypothetical protein; Provisional 93.38
COG183776 Predicted RNA-binding protein (contains KH domain) 92.95
PRK12328374 nusA transcription elongation factor NusA; Provisi 92.95
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 92.5
PRK0106478 hypothetical protein; Provisional 92.09
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 91.81
PRK09202 470 nusA transcription elongation factor NusA; Validat 91.68
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 91.55
PRK12327362 nusA transcription elongation factor NusA; Provisi 91.53
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 91.3
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 90.77
PRK12704520 phosphodiesterase; Provisional 90.75
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 90.66
PRK00106535 hypothetical protein; Provisional 90.25
PRK12329449 nusA transcription elongation factor NusA; Provisi 90.16
COG5176269 MSL5 Splicing factor (branch point binding protein 89.58
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 89.15
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 89.08
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 88.59
PRK12705508 hypothetical protein; Provisional 87.88
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 87.21
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 85.67
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 85.48
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 85.2
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 83.86
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 83.66
PRK12705 508 hypothetical protein; Provisional 83.5
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 82.68
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 81.2
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 80.98
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information 
Probab=99.98  E-value=4.6e-31  Score=282.31  Aligned_cols=167  Identities=38%  Similarity=0.636  Sum_probs=143.2

Q ss_pred             CCeeEEEEEeecccccccccccchHHHHHHhhcCceEEEcCCCCCCCcceEEEeccCCCCcCCChHHHHHHHHHHHHhhc
Q 010611          183 QQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEG  262 (506)
Q Consensus       183 ~~~vtlrllIP~~~vG~IIGKgGs~IK~IreeTGa~I~V~~~~p~s~eRvVtIsG~~~~i~~~s~a~~Av~~i~~~i~e~  262 (506)
                      ....++||||+.+.+|.||||+|..||+||.+|.++|+|.+..++|.||+++|+|..... ..+++++|+.+++++++..
T Consensus        40 ~~t~~~RlL~~~kevG~IIGk~G~~vkkir~~t~s~i~i~~~~~~c~eRIiti~g~~~~~-~~~~~~~al~ka~~~iv~~  118 (485)
T KOG2190|consen   40 DETLTYRLLCHVKEVGSIIGKKGDIVKKIRKETESKIRVNESLPGCPERIITITGNRVEL-NLSPATDALFKAFDMIVFK  118 (485)
T ss_pred             CCcceEEEEeccccceeEEccCcHHHHHHhhcccccceeecCCCCCCcceEEEecccccc-cCCchHHHHHHHHHHHhhc
Confidence            445569999999999999999999999999999999999998999999999999953222 6788999999999988763


Q ss_pred             cc---ccCCCcC-CCCCceeEEEEEeeccccceecccCcchHHhhhhhcCceEEEccCcccccCCCCCeEEEEEeCHHHH
Q 010611          263 TS---EKGLDFS-SNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKV  338 (506)
Q Consensus       263 ~~---~~g~~~~-~~~~~~vt~~l~VP~~~vG~IIGkgG~~IkeIr~~TGA~I~I~~d~~P~~~~s~eR~VtItGt~~~V  338 (506)
                      ..   ....+.+ ......++++|+||.+++|+||||+|+.||+|+++|||+|++..+.+|.   +++|.|+|.|.+++|
T Consensus       119 ~~~d~~~~~d~~~~~~~~~v~~RLlVp~sq~GslIGK~G~~Ik~Ire~TgA~I~v~~~~lP~---ster~V~IsG~~~av  195 (485)
T KOG2190|consen  119 LEEDDEAAEDNGEDASGPEVTCRLLVPSSQVGSLIGKGGSLIKEIREETGAKIRVSSDMLPN---STERAVTISGEPDAV  195 (485)
T ss_pred             ccccccccccCCccccCCceEEEEEechhheeeeeccCcHHHHHHHHhcCceEEecCCCCCc---ccceeEEEcCchHHH
Confidence            21   1111111 1123368999999999999999999999999999999999999888998   689999999999999


Q ss_pred             HHHHHHHHHHhhccc
Q 010611          339 KDAVYNVTGRLRDNH  353 (506)
Q Consensus       339 ~~A~~~I~~~L~e~~  353 (506)
                      .+|+..|..+|.++.
T Consensus       196 ~~al~~Is~~L~~~~  210 (485)
T KOG2190|consen  196 KKALVQISSRLLENP  210 (485)
T ss_pred             HHHHHHHHHHHHhcC
Confidence            999999999999964

>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
2jzx_A160 Pcbp2 Kh1-Kh2 Domains Length = 160 7e-11
3krm_A163 Imp1 Kh34 Length = 163 6e-05
>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 81/148 (54%), Gaps = 11/148 (7%)
Query: 186 VSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGPESRY 245
           ++ R+L    +VG++IGK G  ++ ++ E+GA I++  +   C ER+IT+    GP +  
Sbjct: 5   LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINI--SEGNCPERIITLA---GPTNAI 59
Query: 246 SPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRK 305
               KA  ++  +L E  S    + ++     V  RLVV ++Q G L+GKGG  I E+R+
Sbjct: 60  F---KAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRE 116
Query: 306 VTGTSIRIISDQLLKCISENDRVVQISG 333
            TG  +++  D L    +  +R + I+G
Sbjct: 117 STGAQVQVAGDMLP---NSTERAITIAG 141
>pdb|3KRM|A Chain A, Imp1 Kh34 Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 4e-41
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 3e-10
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 5e-08
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-38
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-09
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-08
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-37
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-08
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-07
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-36
1j4w_A174 FUSE binding protein; single-stranded DNA binding 1e-09
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-09
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-31
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 8e-10
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-08
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-13
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 3e-13
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-12
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 3e-10
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-04
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-12
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-10
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 4e-04
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 2e-11
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 8e-10
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 1e-04
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 5e-11
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 9e-11
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 7e-11
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 8e-11
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-10
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 2e-05
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-10
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-10
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-04
1x4m_A94 FAR upstream element binding protein 1; KH domain, 3e-10
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-09
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-10
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 6e-10
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 1e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 5e-10
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 6e-10
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 7e-08
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-09
1x4n_A92 FAR upstream element binding protein 1; KH domain, 7e-08
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-04
1we8_A104 Tudor and KH domain containing protein; structural 1e-08
1we8_A104 Tudor and KH domain containing protein; structural 9e-07
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-08
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-08
1tua_A191 Hypothetical protein APE0754; structural genomics, 9e-07
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 2e-06
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-05
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 4e-04
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 4e-04
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 4e-04
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 5e-04
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 7e-04
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
 Score =  144 bits (364), Expect = 4e-41
 Identities = 44/170 (25%), Positives = 84/170 (49%), Gaps = 11/170 (6%)

Query: 182 QQQEVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGATMPECDERLITVTASEGP 241
           +   ++ R+L    +VG++IGK G  ++ ++ E+GA I++      C ER+IT+      
Sbjct: 1   KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPT-- 56

Query: 242 ESRYSPAQKAVVLVFSRLIEGTSEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIIS 301
               +   KA  ++  +L E  S    + ++     V  RLVV ++Q G L+GKGG  I 
Sbjct: 57  ----NAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIK 112

Query: 302 EMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRD 351
           E+R+ TG  +++  D      +  +R + I+G    + + V  +   + +
Sbjct: 113 EIRESTGAQVQVAGDM---LPNSTERAITIAGIPQSIIECVKQICVVMLE 159
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.93
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.93
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.93
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.91
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.91
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.8
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.78
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.77
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.77
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.75
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.74
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.61
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.6
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.48
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.47
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.47
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.46
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.46
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.46
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.45
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.41
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.4
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.4
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.39
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.37
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.36
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.36
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.34
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.33
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.33
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.33
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.32
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.31
1we8_A104 Tudor and KH domain containing protein; structural 99.31
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.29
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.24
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.24
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.22
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.22
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.19
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.19
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.18
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.18
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.18
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.16
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.15
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.14
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.1
1we8_A104 Tudor and KH domain containing protein; structural 99.1
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.09
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.05
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.01
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 98.95
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 98.94
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.91
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 98.9
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.81
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.8
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 98.76
2cpq_A91 FragIle X mental retardation syndrome related prot 98.71
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.54
2cpq_A91 FragIle X mental retardation syndrome related prot 98.38
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.36
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.28
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.93
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 97.88
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 97.79
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.74
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.63
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.53
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.4
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.77
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 96.73
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.71
2cxc_A144 NUSA; transcription termination, RNA binding prote 96.49
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.63
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.52
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 93.78
1hh2_P344 NUSA, N utilization substance protein A; transcrip 93.04
2asb_A251 Transcription elongation protein NUSA; protein-RNA 92.96
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 92.96
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 92.61
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 92.27
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 83.11
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 80.12
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=6.5e-26  Score=209.63  Aligned_cols=155  Identities=23%  Similarity=0.402  Sum_probs=129.1

Q ss_pred             eeEEEEEeecccccccccccchHHHHHHhhcCceEEEcCC-CCCCCcceEEEeccCCCCcCCChHHHHHHHHHHHHhhcc
Q 010611          185 EVSFRILCSNDKVGAVIGKGGTIIRALQSEAGAFISVGAT-MPECDERLITVTASEGPESRYSPAQKAVVLVFSRLIEGT  263 (506)
Q Consensus       185 ~vtlrllIP~~~vG~IIGKgGs~IK~IreeTGa~I~V~~~-~p~s~eRvVtIsG~~~~i~~~s~a~~Av~~i~~~i~e~~  263 (506)
                      +-+++|+||.+.+|.||||+|++||+|+++|||+|++.+. .+++.+|+|+|+|.++.      +.+|..++.+.+.+..
T Consensus         2 ~~~~~~~ip~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~~~~~~r~v~I~G~~e~------v~~A~~~I~~~~~e~~   75 (163)
T 3krm_A            2 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEA------QFKAQGRIYGKLKEEN   75 (163)
T ss_dssp             CEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHTCEEEECCCSSTTCSEEEEEEEECHHH------HHHHHHHHHHHHHHTT
T ss_pred             ceEEEEEechhhcceeECCCcHHHHHHHHHHCCeEEEcCCCCCCCCceEEEEEcCHHH------HHHHHHHHHHHHhccc
Confidence            3488999999999999999999999999999999999875 67899999999997653      5567777776655432


Q ss_pred             cccCCCcCCCCCceeEEEEEeeccccceecccCcchHHhhhhhcCceEEEccCcccccCCCCCeEEEEEeCHHHHHHHHH
Q 010611          264 SEKGLDFSSNKGLLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVY  343 (506)
Q Consensus       264 ~~~g~~~~~~~~~~vt~~l~VP~~~vG~IIGkgG~~IkeIr~~TGA~I~I~~d~~P~~~~s~eR~VtItGt~~~V~~A~~  343 (506)
                      .     +.+......+.+|.||.+++|+||||+|++|++|+++|||+|+|.++..|.  ...++.|+|+|++++|++|+.
T Consensus        76 ~-----~~~~~~~~~~~~i~vp~~~~g~iIGkgG~~I~~i~~~tga~I~i~~~~~~~--~~~~~~v~I~G~~~~v~~A~~  148 (163)
T 3krm_A           76 F-----FGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPD--ENDQVIVKIIGHFYASQMAQR  148 (163)
T ss_dssp             S-----SCSSCCCCEEEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEECCTTCCCC--TTSEEEEEEEECHHHHHHHHH
T ss_pred             c-----cccccCCceEEEEEcChhheeeEEcCCChHHHHHHHHhCCeEEECCCCCCC--CCCceEEEEEeCHHHHHHHHH
Confidence            1     112233457889999999999999999999999999999999998655554  233458999999999999999


Q ss_pred             HHHHHhhcc
Q 010611          344 NVTGRLRDN  352 (506)
Q Consensus       344 ~I~~~L~e~  352 (506)
                      +|.+++++.
T Consensus       149 ~I~~~i~~~  157 (163)
T 3krm_A          149 KIRDILAQV  157 (163)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            999999874
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 506
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 4e-13
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 3e-11
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-11
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-08
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 0.004
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-11
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 6e-10
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 7e-11
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-08
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 8e-11
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 9e-08
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 1e-10
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-10
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 0.002
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 2e-10
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-06
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 0.001
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-09
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 6e-09
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 0.002
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 7e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 3e-08
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 0.004
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 3e-08
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-04
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-06
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 4e-05
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 7e-07
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 3e-05
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 1e-06
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 8e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-05
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-04
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-05
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 0.002
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 8e-05
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 9e-05
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 4e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 0.002
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 0.003
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.1 bits (151), Expect = 4e-13
 Identities = 16/74 (21%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 278 VNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSK 337
           +  RL++   +VG ++GK G  + +MR+ +G  I I            +R++ ++G  + 
Sbjct: 4   LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGN------CPERIITLAGPTNA 57

Query: 338 VKDAVYNVTGRLRD 351
           +  A   +  +L +
Sbjct: 58  IFKAFAMIIDKLEE 71
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.53
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.52
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.5
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.5
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.48
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.47
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.42
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.42
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.4
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.4
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.33
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.31
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.3
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.29
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.26
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.17
d2cpqa178 Fragile X mental retardation syndrome related prot 99.12
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.07
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.66
d2cpqa178 Fragile X mental retardation syndrome related prot 98.65
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.62
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.61
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.49
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.48
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.42
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.32
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.26
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.24
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.07
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.84
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 97.38
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.35
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.16
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 96.9
d1hh2p368 Transcription factor NusA, C-terminal domains {The 93.57
d2asba367 Transcription factor NusA, C-terminal domains {Myc 93.55
d2asba367 Transcription factor NusA, C-terminal domains {Myc 93.5
d1hh2p368 Transcription factor NusA, C-terminal domains {The 93.33
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 83.94
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: HnRNP K, KH3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.54  E-value=7.2e-15  Score=116.85  Aligned_cols=73  Identities=25%  Similarity=0.560  Sum_probs=65.7

Q ss_pred             ceeEEEEEeeccccceecccCcchHHhhhhhcCceEEEccCcccccCCCCCeEEEEEeCHHHHHHHHHHHHHHhhcc
Q 010611          276 LLVNARLVVASNQVGCLLGKGGTIISEMRKVTGTSIRIISDQLLKCISENDRVVQISGEFSKVKDAVYNVTGRLRDN  352 (506)
Q Consensus       276 ~~vt~~l~VP~~~vG~IIGkgG~~IkeIr~~TGA~I~I~~d~~P~~~~s~eR~VtItGt~~~V~~A~~~I~~~L~e~  352 (506)
                      +.++.++.||.+++|+||||+|++|++|+++|||+|+|..+ .   .++++|.|+|+|++++|.+|+.+|.++|+++
T Consensus         2 p~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~-~---~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~   74 (75)
T d1zzka1           2 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEP-L---EGSEDRIITITGTQDQIQNAQYLLQNSVKQY   74 (75)
T ss_dssp             CCEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCT-T---SCSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             CcEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccC-C---CCCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence            45789999999999999999999999999999999999732 2   2367899999999999999999999999874
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure