Citrus Sinensis ID: 010652

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----

MEASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWTKLPARLVPVLVRSIELLPFVACLFD

ccccccccEEEEEHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHcccccEEccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccEEcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHcccccccccccccc

cccHccEcEEEEcccHHHHHHHHHHHcccccEEEEccccHHHHHHHHHccccccccEEEcccHHHHHHHEccccEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHccEEEEEEccccHHHHHHHHHHHccEccccEcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEHHHHHHHHHHHcEccccccccHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccEcHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEcccccccccEccccccccccEEEEEEHHHHcHHHHHHcc

MEASALSRIGLAGLAVMGQNLALnvaekgfpisvynrttskvdetldrahregqlpltghytprdfvlsiqrpRSVIILVKAGSPVDQTIAALSehmspgdciidggnewylNTERRIHEASQKGLLYLgmgvsggeegarhgpslmpggsfeaYNNIRDILQKVAAqvddgpcvtyigeggsgnFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKvkdeygegelvdkildktgmkgtgkWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEaglkdevqnvgvhvdkkrLIDDVRQALYASKICSYAQGMNLLrsksnekgwnlnfGELARIWKGGCIIRAVFLDRIKKAyqrnpnlaslvvdpEFAREMVQRQAAWRRVVGLAISagistpgmcaslsyfDTYRRARLPANLVQAQRDLFgahtyeridrpgsfhtewtklparLVPVLVRSIELLPFVACLFD

measalsrIGLAGLAVMGQNLALNVAEKGFPISVYNRttskvdetldrahregqlpltghytprDFVLSIQRPRSVIILVKAGSPVDQTIAALsehmspgdCIIDGGNEWYLNTERRIHEASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVlkeaglkdevqnvgvhvdkkrliDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYqrnpnlaslvvdpEFAREMVQRQAAWRRVVGLAisagistpgmCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRpgsfhtewtklPARLVPVLVRSIELLPFVACLFD

*******RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETL*****EGQLPLTGHYTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGLLYLGMGV*****************SFEAYNNIRDILQKVAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK******AKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWTKLPARLVPVLVRSIELLPFVACLF*

****ALS**GLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVL*************VHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWTKLPA*L**VLVRSIELLPFVACLFD

****ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWTKLPARLVPVLVRSIELLPFVACLFD

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		505	2.2.26 [Sep-21-2011]
Q9SH69		487	6-phosphogluconate dehydr	yes	no	0.954	0.989	0.883	0.0
Q9FFR3		487	6-phosphogluconate dehydr	no	no	0.954	0.989	0.883	0.0
Q94KU2		537	6-phosphogluconate dehydr	N/A	no	0.958	0.901	0.847	0.0
Q94KU1		483	6-phosphogluconate dehydr	N/A	no	0.938	0.981	0.771	0.0
Q9LI00		480	6-phosphogluconate dehydr	yes	no	0.934	0.983	0.766	0.0
Q9FWA3		486	6-phosphogluconate dehydr	no	no	0.938	0.975	0.756	0.0
Q2R480		508	6-phosphogluconate dehydr	no	no	0.938	0.933	0.761	0.0
P21577		471	6-phosphogluconate dehydr	yes	no	0.922	0.989	0.566	1e-154
P80859		469	6-phosphogluconate dehydr	yes	no	0.920	0.991	0.525	1e-145
P52208		482	6-phosphogluconate dehydr	N/A	no	0.914	0.958	0.536	1e-139

>sp\|Q9SH69\|6PGD1_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic OS=Arabidopsis thaliana GN=At1g64190 PE=2 SV=1	Back alignment and function desciption

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/482 (88%), Positives = 460/482 (95%)

Query: 1   MEASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGH 60
           ME++ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETLDRA  EG LP++G 
Sbjct: 1   MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ 60

Query: 61  YTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHE 120
           Y+PRDFVLSIQRPRS+IILVKAG+PVDQTI A SE+M PGDCIIDGGNEWY NTERRI E
Sbjct: 61  YSPRDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISE 120

Query: 121 ASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGE 180
           A QKGLLYLGMGVSGGEEGAR+GPSLMPGGSF+AY+NI+DIL+KVAAQV+DGPCVTYIGE
Sbjct: 121 AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQVEDGPCVTYIGE 180

Query: 181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEIT 240
           GGSGNFVKMVHNGIEYGDMQLISEAYDVLK+VGGLSN ELAEIF EWN GELESFLVEIT
Sbjct: 181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNSGELESFLVEIT 240

Query: 241 ADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKE 300
           +DIF+VKDE+G+GELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK+
Sbjct: 241 SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD 300

Query: 301 EREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEK 360
           ERE AAKVL+EAGLK+E+ +    +DKKRL+DDVRQALYASKICSYAQGMNLLR+KS EK
Sbjct: 301 ERENAAKVLREAGLKEEIGSASSGIDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK 360

Query: 361 GWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRV 420
            WNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNP+LASLVVDPEFA+EMVQRQAAWRRV
Sbjct: 361 SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV 420

Query: 421 VGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWT 480
           VGLA+SAGISTPGMCASL+YFDTYRRARLPANLVQAQRDLFGAHTYER DRPG++HTEWT
Sbjct: 421 VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT 480

Query: 481 KL 482
           KL
Sbjct: 481 KL 482

Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 4

>sp\|Q9FFR3\|6PGD2_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Arabidopsis thaliana GN=At5g41670 PE=2 SV=1	Back alignment and function description

>sp\|Q94KU2\|6PGD2_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Spinacia oleracea GN=pgdP PE=1 SV=1	Back alignment and function description

>sp\|Q94KU1\|6PGD1_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Spinacia oleracea GN=pgdC PE=1 SV=1	Back alignment and function description

>sp\|Q9LI00\|6PGD1_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Oryza sativa subsp. japonica GN=G6PGH1 PE=2 SV=1	Back alignment and function description

>sp\|Q9FWA3\|6GPD3_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 3 OS=Arabidopsis thaliana GN=At3g02360 PE=2 SV=1	Back alignment and function description

>sp\|Q2R480\|6PGD2_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Oryza sativa subsp. japonica GN=G6PGH2 PE=2 SV=1	Back alignment and function description

>sp\|P21577\|6PGD_SYNE7 6-phosphogluconate dehydrogenase, decarboxylating OS=Synechococcus elongatus (strain PCC 7942) GN=gnd PE=1 SV=4	Back alignment and function description

>sp\|P80859\|6PGD2_BACSU 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Bacillus subtilis (strain 168) GN=yqjI PE=1 SV=4	Back alignment and function description

>sp\|P52208\|6PGD_SYNY3 6-phosphogluconate dehydrogenase, decarboxylating OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gnd PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		505
255553267		495	6-phosphogluconate dehydrogenase, putati	0.954	0.973	0.921	0.0
225426063		494	PREDICTED: 6-phosphogluconate dehydrogen	0.954	0.975	0.912	0.0
147798262		494	hypothetical protein VITISV_008240 [Viti	0.954	0.975	0.912	0.0
255537671		495	6-phosphogluconate dehydrogenase, putati	0.954	0.973	0.913	0.0
449522891		495	PREDICTED: 6-phosphogluconate dehydrogen	0.954	0.973	0.888	0.0
356528974		495	PREDICTED: 6-phosphogluconate dehydrogen	0.954	0.973	0.888	0.0
15222639		487	6-phosphogluconate dehydrogenase [Arabid	0.954	0.989	0.883	0.0
297836953		487	6-phosphogluconate dehydrogenase family	0.954	0.989	0.883	0.0
449464086		495	PREDICTED: 6-phosphogluconate dehydrogen	0.954	0.973	0.886	0.0
356513305		495	PREDICTED: 6-phosphogluconate dehydrogen	0.954	0.973	0.888	0.0

>gi\|255553267\|ref\|XP_002517676.1\| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] gi\|223543308\|gb\|EEF44840.1\| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/483 (92%), Positives = 465/483 (96%), Gaps = 1/483 (0%)

Query: 1   MEAS-ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTG 59
           MEAS ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDET+ RA  EG  PLTG
Sbjct: 1   MEASVALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETIHRAQNEGPFPLTG 60

Query: 60  HYTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIH 119
           HYTPRDFVLS+QRPRSVIILVKAG+PVDQTIAALSEHM  GDCIIDGGNEWY NTERRI 
Sbjct: 61  HYTPRDFVLSLQRPRSVIILVKAGAPVDQTIAALSEHMEAGDCIIDGGNEWYQNTERRID 120

Query: 120 EASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIG 179
           EA+QKGLLYLGMGVSGGEEGAR GPSLMPGGSFEAYNNI+DILQKVAAQV+DGPCVTYIG
Sbjct: 121 EANQKGLLYLGMGVSGGEEGARFGPSLMPGGSFEAYNNIKDILQKVAAQVEDGPCVTYIG 180

Query: 180 EGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEI 239
           EGGSGNFVKMVHNGIEYGDMQLISEAYDVLK+VGGLSNAELAEIF EWNKGELESFL+EI
Sbjct: 181 EGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNAELAEIFTEWNKGELESFLIEI 240

Query: 240 TADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK 299
           T+DIF+VKDE+G+GELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK
Sbjct: 241 TSDIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK 300

Query: 300 EEREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNE 359
           EERE AA+VLKEAGLK+EV+ V   +DKKRLIDDVRQALYASKICSYAQGMNLLR+KS E
Sbjct: 301 EERESAAQVLKEAGLKEEVEAVKSGIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVE 360

Query: 360 KGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRR 419
           KGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRR
Sbjct: 361 KGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRR 420

Query: 420 VVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW 479
           VVGLAISAGISTPGMCASL+YFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW
Sbjct: 421 VVGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW 480

Query: 480 TKL 482
           TKL
Sbjct: 481 TKL 483

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225426063\|ref\|XP_002275970.1\| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147798262\|emb\|CAN63456.1\| hypothetical protein VITISV_008240 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255537671\|ref\|XP_002509902.1\| 6-phosphogluconate dehydrogenase, putative [Ricinus communis] gi\|223549801\|gb\|EEF51289.1\| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449522891\|ref\|XP_004168459.1\| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356528974\|ref\|XP_003533072.1\| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Glycine max]	Back alignment and taxonomy information

>gi|15222639|ref|NP_176601.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana] gi|75313449|sp|Q9SH69.1|6PGD1_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic gi|6692095|gb|AAF24560.1|AC007764_2 F22C12.5 [Arabidopsis thaliana] gi|28416567|gb|AAO42814.1| At1g64190 [Arabidopsis thaliana] gi|110743402|dbj|BAE99587.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana] gi|332196086|gb|AEE34207.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297836953\|ref\|XP_002886358.1\| 6-phosphogluconate dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297332199\|gb\|EFH62617.1\| 6-phosphogluconate dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449464086\|ref\|XP_004149760.1\| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356513305\|ref\|XP_003525354.1\| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		505
TAIR\|locus:2024542		487	AT1G64190 [Arabidopsis thalian	0.954	0.989	0.883	6.6e-232
TAIR\|locus:2160422		487	AT5G41670 [Arabidopsis thalian	0.954	0.989	0.883	1.1e-231
UNIPROTKB\|Q94KU2		537	pgdP "6-phosphogluconate dehyd	0.958	0.901	0.847	6e-222
UNIPROTKB\|Q9LI00		480	G6PGH1 "6-phosphogluconate deh	0.934	0.983	0.768	3.9e-195
TAIR\|locus:2074577		486	AT3G02360 [Arabidopsis thalian	0.938	0.975	0.756	8.1e-195
UNIPROTKB\|Q2R480		508	G6PGH2 "6-phosphogluconate deh	0.938	0.933	0.761	2.1e-194
TIGR_CMR\|BA_0164		469	BA_0164 "6-phosphogluconate de	0.916	0.987	0.507	4.2e-127
GENEDB_PFALCIPARUM\|PF14_0520		468	PF14_0520 "6-phosphogluconate	0.920	0.993	0.515	9.9e-126
UNIPROTKB\|Q8IKT2		468	PF14_0520 "6-phosphogluconate	0.920	0.993	0.515	9.9e-126
UNIPROTKB\|P37756		468	gnd "6-phosphogluconate dehydr	0.912	0.985	0.515	1.2e-122

TAIR\|locus:2024542 AT1G64190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2237 (792.5 bits), Expect = 6.6e-232, P = 6.6e-232
 Identities = 426/482 (88%), Positives = 460/482 (95%)

Query:     1 MEASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGH 60
             ME++ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETLDRA  EG LP++G 
Sbjct:     1 MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ 60

Query:    61 YTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHE 120
             Y+PRDFVLSIQRPRS+IILVKAG+PVDQTI A SE+M PGDCIIDGGNEWY NTERRI E
Sbjct:    61 YSPRDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISE 120

Query:   121 ASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGE 180
             A QKGLLYLGMGVSGGEEGAR+GPSLMPGGSF+AY+NI+DIL+KVAAQV+DGPCVTYIGE
Sbjct:   121 AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQVEDGPCVTYIGE 180

Query:   181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEIT 240
             GGSGNFVKMVHNGIEYGDMQLISEAYDVLK+VGGLSN ELAEIF EWN GELESFLVEIT
Sbjct:   181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNSGELESFLVEIT 240

Query:   241 ADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKE 300
             +DIF+VKDE+G+GELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK+
Sbjct:   241 SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD 300

Query:   301 EREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEK 360
             ERE AAKVL+EAGLK+E+ +    +DKKRL+DDVRQALYASKICSYAQGMNLLR+KS EK
Sbjct:   301 ERENAAKVLREAGLKEEIGSASSGIDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK 360

Query:   361 GWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRV 420
              WNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNP+LASLVVDPEFA+EMVQRQAAWRRV
Sbjct:   361 SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV 420

Query:   421 VGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWT 480
             VGLA+SAGISTPGMCASL+YFDTYRRARLPANLVQAQRDLFGAHTYER DRPG++HTEWT
Sbjct:   421 VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT 480

Query:   481 KL 482
             KL
Sbjct:   481 KL 482

GO:0000166 "nucleotide binding" evidence=IEA

GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0006098 "pentose-phosphate shunt" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA

GO:0050661 "NADP binding" evidence=IEA

GO:0050662 "coenzyme binding" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0016020 "membrane" evidence=IDA

GO:0009651 "response to salt stress" evidence=IEP

GO:0009507 "chloroplast" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0052541 "plant-type cell wall cellulose metabolic process" evidence=RCA

GO:0052546 "cell wall pectin metabolic process" evidence=RCA

GO:0009536 "plastid" evidence=IDA

TAIR\|locus:2160422 AT5G41670 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q94KU2 pgdP "6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic" [Spinacia oleracea (taxid:3562)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9LI00 G6PGH1 "6-phosphogluconate dehydrogenase, decarboxylating 1" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2074577 AT3G02360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2R480 G6PGH2 "6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_0164 BA_0164 "6-phosphogluconate dehydrogenase, decarboxylating" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF14_0520 PF14_0520 "6-phosphogluconate dehydrogenase, decarboxylating, putative" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IKT2 PF14_0520 "6-phosphogluconate dehydrogenase, decarboxylating" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

UNIPROTKB\|P37756 gnd "6-phosphogluconate dehydrogenase, decarboxylating" [Shigella flexneri (taxid:623)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q7VMX4	6PGD_HAEDU	1, ., 1, ., 1, ., 4, 4	0.4821	0.9148	0.9545	yes	no
P96789	6PGD_LACLM	1, ., 1, ., 1, ., 4, 4	0.4968	0.9207	0.9851	yes	no
Q8TA03	6PGD_DICDI	1, ., 1, ., 1, ., 4, 4	0.4905	0.9267	0.9492	yes	no
P41580	6PGD_SHISO	1, ., 1, ., 1, ., 4, 4	0.5109	0.8792	0.9977	yes	no
Q6GGI7	6PGD_STAAR	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no
P41582	6PGD_CITDI	1, ., 1, ., 1, ., 4, 4	0.5142	0.8772	0.9955	yes	no
Q9LI00	6PGD1_ORYSJ	1, ., 1, ., 1, ., 4, 4	0.7661	0.9346	0.9833	yes	no
P53319	6PGD2_YEAST	1, ., 1, ., 1, ., 4, 4	0.4873	0.9227	0.9471	yes	no
P70718	6PGD_AGGAC	1, ., 1, ., 1, ., 4, 4	0.4905	0.9148	0.9545	yes	no
P57208	6PGD_BUCAI	1, ., 1, ., 1, ., 4, 4	0.4556	0.9188	0.9914	yes	no
P85968	6PGD_RAT	1, ., 1, ., 1, ., 4, 4	0.5062	0.9247	0.9668	yes	no
Q9FFR3	6PGD2_ARATH	1, ., 1, ., 1, ., 4, 4	0.8838	0.9544	0.9897	no	no
P00350	6PGD_ECOLI	1, ., 1, ., 1, ., 4, 4	0.5116	0.9128	0.9850	N/A	no
Q931R3	6PGD_STAAM	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no
Q94KU1	6PGD1_SPIOL	1, ., 1, ., 1, ., 4, 4	0.7710	0.9386	0.9813	N/A	no
Q94KU2	6PGD2_SPIOL	1, ., 1, ., 1, ., 4, 4	0.8471	0.9584	0.9013	N/A	no
P63335	6PGD_STAAW	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no
P63334	6PGD_STAAN	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no
Q5HP42	6PGD_STAEQ	1, ., 1, ., 1, ., 4, 4	0.5031	0.9168	0.9893	yes	no
P41575	6PGD_RAOPL	1, ., 1, ., 1, ., 4, 4	0.5032	0.8772	0.9955	N/A	no
P52209	6PGD_HUMAN	1, ., 1, ., 1, ., 4, 4	0.5041	0.9247	0.9668	yes	no
P52208	6PGD_SYNY3	1, ., 1, ., 1, ., 4, 4	0.5366	0.9148	0.9585	N/A	no
P37754	6PGD9_ECOLX	1, ., 1, ., 1, ., 4, 4	0.5073	0.9128	0.9850	yes	no
P37756	6PGD_SHIFL	1, ., 1, ., 1, ., 4, 4	0.5137	0.9128	0.9850	yes	no
P41574	6PGD_ESCVU	1, ., 1, ., 1, ., 4, 4	0.5098	0.8772	0.9955	N/A	no
Q9SH69	6PGD1_ARATH	1, ., 1, ., 1, ., 4, 4	0.8838	0.9544	0.9897	yes	no
P41581	6PGD_CITAM	1, ., 1, ., 1, ., 4, 4	0.5098	0.8772	0.9955	N/A	no
Q9DCD0	6PGD_MOUSE	1, ., 1, ., 1, ., 4, 4	0.5104	0.9247	0.9668	yes	no
P80859	6PGD2_BACSU	1, ., 1, ., 1, ., 4, 4	0.5253	0.9207	0.9914	yes	no
Q9FWA3	6GPD3_ARATH	1, ., 1, ., 1, ., 4, 4	0.7568	0.9386	0.9753	no	no
P41577	6PGD_RAOTE	1, ., 1, ., 1, ., 4, 4	0.5054	0.8772	0.9955	N/A	no
P41576	6PGD_KLEPN	1, ., 1, ., 1, ., 4, 4	0.5095	0.9128	0.9850	yes	no
P21577	6PGD_SYNE7	1, ., 1, ., 1, ., 4, 4	0.5669	0.9227	0.9893	yes	no
P41573	6PGD_DROSI	1, ., 1, ., 1, ., 4, 4	0.5020	0.9227	0.9688	N/A	no
Q9ZHD9	6PGD_BUCAP	1, ., 1, ., 1, ., 4, 4	0.4566	0.9148	0.9767	yes	no
Q9CHU6	6PGD_LACLA	1, ., 1, ., 1, ., 4, 4	0.5031	0.9207	0.9851	yes	no
P41572	6PGD_DROME	1, ., 1, ., 1, ., 4, 4	0.5020	0.9227	0.9688	yes	no
P41579	6PGD_SHIDY	1, ., 1, ., 1, ., 4, 4	0.5109	0.8792	0.9977	yes	no
P41578	6PGD_SHIBO	1, ., 1, ., 1, ., 4, 4	0.5087	0.8792	0.9977	yes	no
P14062	6PGD_SALTY	1, ., 1, ., 1, ., 4, 4	0.5137	0.9128	0.9850	yes	no
Q6G954	6PGD_STAAS	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no
Q2R480	6PGD2_ORYSJ	1, ., 1, ., 1, ., 4, 4	0.7615	0.9386	0.9330	no	no
Q8CP47	6PGD_STAES	1, ., 1, ., 1, ., 4, 4	0.5031	0.9168	0.9893	yes	no
P00349	6PGD_SHEEP	1, ., 1, ., 1, ., 4, 4	0.5104	0.9247	0.9668	N/A	no
Q17761	6PGD_CAEEL	1, ., 1, ., 1, ., 4, 4	0.4772	0.9425	0.9834	yes	no
Q5HFR2	6PGD_STAAC	1, ., 1, ., 1, ., 4, 4	0.4968	0.9128	0.9850	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.1	0.963
4th Layer	1.1.1.44	0.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		505
PLN02350		493	PLN02350, PLN02350, phosphogluconate dehydrogenase	0.0
PRK09287		459	PRK09287, PRK09287, 6-phosphogluconate dehydrogena	0.0
COG0362		473	COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca	0.0
PTZ00142		470	PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena	0.0
TIGR00873		467	TIGR00873, gnd, 6-phosphogluconate dehydrogenase (	0.0
pfam00393		290	pfam00393, 6PGD, 6-phosphogluconate dehydrogenase,	0.0
PRK09599		301	PRK09599, PRK09599, 6-phosphogluconate dehydrogena	1e-75
COG1023		300	COG1023, Gnd, Predicted 6-phosphogluconate dehydro	6e-61
PRK12490		299	PRK12490, PRK12490, 6-phosphogluconate dehydrogena	2e-57
pfam03446		163	pfam03446, NAD_binding_2, NAD binding domain of 6-	6e-57
TIGR00872		298	TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena	3e-49
COG2084		286	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase	2e-19
PRK11559		296	PRK11559, garR, tartronate semialdehyde reductase;	4e-11
TIGR01505		291	TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona	3e-10
PRK15059		292	PRK15059, PRK15059, tartronate semialdehyde reduct	2e-05
TIGR01692		288	TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen	7e-05
COG1023		300	COG1023, Gnd, Predicted 6-phosphogluconate dehydro	2e-04
PRK12490		299	PRK12490, PRK12490, 6-phosphogluconate dehydrogena	0.001
PRK15461		296	PRK15461, PRK15461, NADH-dependent gamma-hydroxybu	0.001
PRK09599		301	PRK09599, PRK09599, 6-phosphogluconate dehydrogena	0.002
TIGR00872		298	TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena	0.002

>gnl\|CDD\|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

 Score = 1030 bits (2665), Expect = 0.0
 Identities = 414/482 (85%), Positives = 444/482 (92%), Gaps = 1/482 (0%)

Query: 1   MEASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGH 60
           M ++ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA +EG LPL G 
Sbjct: 1   MASAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGF 60

Query: 61  YTPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHE 120
             P DFVLSIQ+PRSVIILVKAG+PVDQTI ALSE+M PGDCIIDGGNEWY NTERRI E
Sbjct: 61  KDPEDFVLSIQKPRSVIILVKAGAPVDQTIKALSEYMEPGDCIIDGGNEWYENTERRIKE 120

Query: 121 ASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQKVAAQVDDGPCVTYIGE 180
           A++KGLLYLGMGVSGGEEGAR+GPSLMPGGSFEAY NI DIL+KVAAQVDDGPCVTYIG 
Sbjct: 121 AAEKGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILEKVAAQVDDGPCVTYIGP 180

Query: 181 GGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEIT 240
           GG+GNFVKMVHNGIEYGDMQLISEAYDVLK VGGLSN ELAE+F EWNKGELESFL+EIT
Sbjct: 181 GGAGNFVKMVHNGIEYGDMQLISEAYDVLKSVGGLSNEELAEVFAEWNKGELESFLIEIT 240

Query: 241 ADIFKVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKE 300
           ADIF VKD+ G+G LVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLD RYLSGLKE
Sbjct: 241 ADIFSVKDDKGDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDARYLSGLKE 300

Query: 301 EREKAAKVLKEAGLKDEVQNVGVHVDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEK 360
           ER  AAKV KEAGL+D +      VDKK+LIDDVRQALYASKICSYAQGMNL+R+KS EK
Sbjct: 301 ERVAAAKVFKEAGLEDILSADSG-VDKKQLIDDVRQALYASKICSYAQGMNLIRAKSVEK 359

Query: 361 GWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRV 420
           GWNLN GELARIWKGGCIIRAVFLDRIKKAY RNP+LASL+VDPEFA+EMV+RQAAWRRV
Sbjct: 360 GWNLNLGELARIWKGGCIIRAVFLDRIKKAYDRNPDLASLLVDPEFAKEMVERQAAWRRV 419

Query: 421 VGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWT 480
           V LAI+AGISTPGM ASL+YFDTYRRARLPANLVQAQRD FGAHTYER+DRPGSFHTEWT
Sbjct: 420 VSLAINAGISTPGMSASLAYFDTYRRARLPANLVQAQRDYFGAHTYERVDRPGSFHTEWT 479

Query: 481 KL 482
           KL
Sbjct: 480 KL 481

Length = 493

>gnl\|CDD\|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>gnl\|CDD\|215895 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>gnl\|CDD\|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>gnl\|CDD\|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		505
COG0362		473	Gnd 6-phosphogluconate dehydrogenase [Carbohydrate	100.0
KOG2653		487	consensus 6-phosphogluconate dehydrogenase [Carboh	100.0
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	100.0
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	100.0
PRK09287		459	6-phosphogluconate dehydrogenase; Validated	100.0
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	100.0
PF00393		291	6PGD: 6-phosphogluconate dehydrogenase, C-terminal	100.0
COG1023		300	Gnd Predicted 6-phosphogluconate dehydrogenase [Ca	100.0
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	100.0
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	100.0
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	100.0
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	100.0
KOG0409		327	consensus Predicted dehydrogenase [General functio	100.0
PRK15059		292	tartronate semialdehyde reductase; Provisional	100.0
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	100.0
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	100.0
PLN02858		1378	fructose-bisphosphate aldolase	100.0
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	100.0
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	100.0
PLN02858		1378	fructose-bisphosphate aldolase	100.0
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	99.97
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	99.96
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	99.93
PRK15182		425	Vi polysaccharide biosynthesis protein TviB; Provi	99.92
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	99.91
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	99.91
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	99.91
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	99.89
PF00393		291	6PGD: 6-phosphogluconate dehydrogenase, C-terminal	99.88
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	99.88
COG0362		473	Gnd 6-phosphogluconate dehydrogenase [Carbohydrate	99.85
COG1023		300	Gnd Predicted 6-phosphogluconate dehydrogenase [Ca	99.84
PRK12557		342	H(2)-dependent methylenetetrahydromethanopterin de	99.84
COG0677		436	WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas	99.83
KOG2653		487	consensus 6-phosphogluconate dehydrogenase [Carboh	99.82
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	99.82
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	99.82
PLN02353		473	probable UDP-glucose 6-dehydrogenase	99.81
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.8
PLN02688		266	pyrroline-5-carboxylate reductase	99.79
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	99.77
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.77
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	99.77
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	99.77
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	99.75
PRK07417		279	arogenate dehydrogenase; Reviewed	99.74
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	99.72
PRK08507		275	prephenate dehydrogenase; Validated	99.72
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.72
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.71
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.7
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	99.69
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	99.69
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.67
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.66
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	99.65
PRK07680		273	late competence protein ComER; Validated	99.65
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	99.64
PRK08655		437	prephenate dehydrogenase; Provisional	99.64
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	99.64
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	99.63
PTZ00345		365	glycerol-3-phosphate dehydrogenase; Provisional	99.63
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	99.61
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	99.61
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	99.61
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	99.6
TIGR03376		342	glycerol3P_DH glycerol-3-phosphate dehydrogenase (	99.59
TIGR01724		341	hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome	99.59
PRK09287		459	6-phosphogluconate dehydrogenase; Validated	99.59
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	99.58
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	99.57
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	99.56
PRK08269		314	3-hydroxybutyryl-CoA dehydrogenase; Validated	99.56
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	99.54
PRK06545		359	prephenate dehydrogenase; Validated	99.52
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	99.5
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	99.5
PLN02256		304	arogenate dehydrogenase	99.43
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	99.43
PLN02712		667	arogenate dehydrogenase	99.4
PRK11730		715	fadB multifunctional fatty acid oxidation complex	99.39
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	99.39
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	99.38
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	99.38
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	99.37
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	99.37
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	99.37
COG0345		266	ProC Pyrroline-5-carboxylate reductase [Amino acid	99.37
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	99.36
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	99.36
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	99.35
PF14833		122	NAD_binding_11: NAD-binding of NADP-dependent 3-hy	99.35
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	99.34
PRK14806		735	bifunctional cyclohexadienyl dehydrogenase/ 3-phos	99.34
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	99.33
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	99.32
COG2085		211	Predicted dinucleotide-binding enzymes [General fu	99.31
PRK05479		330	ketol-acid reductoisomerase; Provisional	99.3
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	99.27
PTZ00431		260	pyrroline carboxylate reductase; Provisional	99.26
PLN02712		667	arogenate dehydrogenase	99.26
PRK08818		370	prephenate dehydrogenase; Provisional	99.26
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	99.24
KOG2304		298	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	99.14
PRK07574		385	formate dehydrogenase; Provisional	99.09
PRK12480		330	D-lactate dehydrogenase; Provisional	99.09
PLN03139		386	formate dehydrogenase; Provisional	99.06
TIGR00745		293	apbA_panE 2-dehydropantoate 2-reductase. This mode	99.05
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	99.02
PRK13243		333	glyoxylate reductase; Reviewed	99.0
PF02153		258	PDH: Prephenate dehydrogenase; InterPro: IPR003099	98.99
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	98.98
KOG2305		313	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	98.98
PRK08605		332	D-lactate dehydrogenase; Validated	98.95
KOG2666		481	consensus UDP-glucose/GDP-mannose dehydrogenase [C	98.95
PRK06436		303	glycerate dehydrogenase; Provisional	98.95
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	98.94
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	98.93
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	98.93
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	98.89
PRK13403		335	ketol-acid reductoisomerase; Provisional	98.84
TIGR01327		525	PGDH D-3-phosphoglycerate dehydrogenase. This mode	98.78
PLN02928		347	oxidoreductase family protein	98.77
PRK13581		526	D-3-phosphoglycerate dehydrogenase; Provisional	98.75
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	98.75
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	98.71
KOG2380		480	consensus Prephenate dehydrogenase (NADP+) [Amino	98.69
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	98.69
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	98.66
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	98.66
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	98.64
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	98.63
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	98.61
PRK06487		317	glycerate dehydrogenase; Provisional	98.61
PRK13304		265	L-aspartate dehydrogenase; Reviewed	98.61
TIGR00112		245	proC pyrroline-5-carboxylate reductase. This enzym	98.59
PRK06932		314	glycerate dehydrogenase; Provisional	98.59
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	98.58
COG4007		340	Predicted dehydrogenase related to H2-forming N5,N	98.56
PRK06141		314	ornithine cyclodeaminase; Validated	98.53
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.5
PLN02306		386	hydroxypyruvate reductase	98.46
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	98.4
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	98.36
PRK08306		296	dipicolinate synthase subunit A; Reviewed	98.35
KOG0069		336	consensus Glyoxylate/hydroxypyruvate reductase (D-	98.34
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	98.32
PRK06444		197	prephenate dehydrogenase; Provisional	98.26
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.25
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	98.25
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	98.24
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	98.19
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	98.18
PRK06223		307	malate dehydrogenase; Reviewed	98.12
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	98.09
PRK14179		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	98.05
COG0059		338	IlvC Ketol-acid reductoisomerase [Amino acid trans	98.05
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	98.05
COG0569		225	TrkA K+ transport systems, NAD-binding component [	97.97
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	97.96
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	97.96
smart00859		122	Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin	97.95
PTZ00082		321	L-lactate dehydrogenase; Provisional	97.93
PLN00203		519	glutamyl-tRNA reductase	97.89
TIGR01921		324	DAP-DH diaminopimelate dehydrogenase. This model r	97.86
PRK05225		487	ketol-acid reductoisomerase; Validated	97.86
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	97.86
PRK06407		301	ornithine cyclodeaminase; Provisional	97.86
PRK09310		477	aroDE bifunctional 3-dehydroquinate dehydratase/sh	97.85
PRK08618		325	ornithine cyclodeaminase; Validated	97.84
PRK07340		304	ornithine cyclodeaminase; Validated	97.84
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	97.82
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	97.82
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	97.81
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	97.8
PTZ00075		476	Adenosylhomocysteinase; Provisional	97.8
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	97.79
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	97.76
PRK06823		315	ornithine cyclodeaminase; Validated	97.76
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	97.76
cd05297		423	GH4_alpha_glucosidase_galactosidase Glycoside Hydr	97.75
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	97.7
TIGR02992		326	ectoine_eutC ectoine utilization protein EutC. Mem	97.69
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	97.68
KOG2711		372	consensus Glycerol-3-phosphate dehydrogenase/dihyd	97.68
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	97.67
PRK08291		330	ectoine utilization protein EutC; Validated	97.66
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	97.66
PRK13303		265	L-aspartate dehydrogenase; Provisional	97.65
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	97.64
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	97.64
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	97.63
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	97.63
COG0673		342	MviM Predicted dehydrogenases and related proteins	97.62
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	97.61
PLN02494		477	adenosylhomocysteinase	97.61
PTZ00117		319	malate dehydrogenase; Provisional	97.61
PRK00048		257	dihydrodipicolinate reductase; Provisional	97.6
PRK10669		558	putative cation:proton antiport protein; Provision	97.6
COG2423		330	Predicted ornithine cyclodeaminase, mu-crystallin	97.6
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	97.55
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	97.55
TIGR01761		343	thiaz-red thiazolinyl imide reductase. This reduct	97.54
PRK03659		601	glutathione-regulated potassium-efflux system prot	97.53
PRK06046		326	alanine dehydrogenase; Validated	97.52
TIGR00036		266	dapB dihydrodipicolinate reductase.	97.51
PRK03562		621	glutathione-regulated potassium-efflux system prot	97.51
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	97.49
PF02423		313	OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst	97.48
PF13380		116	CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5	97.47
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	97.46
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	97.42
PRK07589		346	ornithine cyclodeaminase; Validated	97.42
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	97.39
PRK11579		346	putative oxidoreductase; Provisional	97.39
KOG2741		351	consensus Dimeric dihydrodiol dehydrogenase [Carbo	97.38
cd00650		263	LDH_MDH_like NAD-dependent, lactate dehydrogenase-	97.38
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	97.38
PRK04148		134	hypothetical protein; Provisional	97.37
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	97.33
PRK09496		453	trkA potassium transporter peripheral membrane com	97.32
PRK13940		414	glutamyl-tRNA reductase; Provisional	97.32
COG5495		289	Uncharacterized conserved protein [Function unknow	97.29
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	97.28
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	97.25
KOG0068		406	consensus D-3-phosphoglycerate dehydrogenase, D-is	97.24
PRK00436		343	argC N-acetyl-gamma-glutamyl-phosphate reductase;	97.24
PF14833		122	NAD_binding_11: NAD-binding of NADP-dependent 3-hy	97.23
cd00300		300	LDH_like L-lactate dehydrogenase-like enzymes. Mem	97.22
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	97.2
PRK06270		341	homoserine dehydrogenase; Provisional	97.2
PRK06199		379	ornithine cyclodeaminase; Validated	97.18
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	97.16
COG2910		211	Putative NADH-flavin reductase [General function p	97.15
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	97.14
cd05294		309	LDH-like_MDH_nadp A lactate dehydrogenases-like st	97.13
PRK08300		302	acetaldehyde dehydrogenase; Validated	97.11
KOG3124		267	consensus Pyrroline-5-carboxylate reductase [Amino	97.09
PRK15076		431	alpha-galactosidase; Provisional	97.06
PRK09496		453	trkA potassium transporter peripheral membrane com	97.06
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	97.05
TIGR01850		346	argC N-acetyl-gamma-glutamyl-phosphate reductase,	97.01
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	96.99
PRK02318		381	mannitol-1-phosphate 5-dehydrogenase; Provisional	96.99
PF00984		96	UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas	96.98
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	96.97
TIGR03215		285	ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati	96.93
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	96.9
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	96.9
PRK06349		426	homoserine dehydrogenase; Provisional	96.87
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.85
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.83
PRK10206		344	putative oxidoreductase; Provisional	96.81
PF02629		96	CoA_binding: CoA binding domain; InterPro: IPR0037	96.81
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.76
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	96.76
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	96.73
PLN02602		350	lactate dehydrogenase	96.72
PRK00961		342	H(2)-dependent methylenetetrahydromethanopterin de	96.72
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	96.72
PRK00683		418	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.69
TIGR02717		447	AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP	96.68
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.68
PRK06392		326	homoserine dehydrogenase; Provisional	96.65
PRK12548		289	shikimate 5-dehydrogenase; Provisional	96.64
COG0002		349	ArgC Acetylglutamate semialdehyde dehydrogenase [A	96.63
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	96.62
TIGR01723		340	hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr	96.62
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	96.6
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	96.6
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	96.6
PRK08374		336	homoserine dehydrogenase; Provisional	96.59
PLN02968		381	Probable N-acetyl-gamma-glutamyl-phosphate reducta	96.58
cd01337		310	MDH_glyoxysomal_mitochondrial Glyoxysomal and mito	96.57
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.56
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	96.55
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	96.53
TIGR01772		312	MDH_euk_gproteo malate dehydrogenase, NAD-dependen	96.52
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	96.5
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.44
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.43
TIGR01019		286	sucCoAalpha succinyl-CoA synthetase, alpha subunit	96.42
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	96.38
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	96.37
cd01338		322	MDH_choloroplast_like Chloroplast-like malate dehy	96.36
PTZ00325		321	malate dehydrogenase; Provisional	96.36
PLN00106		323	malate dehydrogenase	96.36
PRK05442		326	malate dehydrogenase; Provisional	96.33
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	96.32
PRK08328		231	hypothetical protein; Provisional	96.32
PLN02477		410	glutamate dehydrogenase	96.32
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	96.29
PRK05678		291	succinyl-CoA synthetase subunit alpha; Validated	96.21
PRK05086		312	malate dehydrogenase; Provisional	96.21
PRK03803		448	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.18
TIGR01759		323	MalateDH-SF1 malate dehydrogenase. This model repr	96.17
COG0460		333	ThrA Homoserine dehydrogenase [Amino acid transpor	96.17
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.16
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	96.16
PRK14874		334	aspartate-semialdehyde dehydrogenase; Provisional	96.15
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.13
COG2344		211	AT-rich DNA-binding protein [General function pred	96.13
PF02882		160	THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl	96.08
PRK09414		445	glutamate dehydrogenase; Provisional	96.06
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	96.04
CHL00194		317	ycf39 Ycf39; Provisional	96.03
PRK05671		336	aspartate-semialdehyde dehydrogenase; Reviewed	95.99
PF03720		106	UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen	95.98
PRK05472		213	redox-sensing transcriptional repressor Rex; Provi	95.98
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	95.98
PRK15059		292	tartronate semialdehyde reductase; Provisional	95.97
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.96
PRK14982		340	acyl-ACP reductase; Provisional	95.94
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	95.93
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.91
PLN00112		444	malate dehydrogenase (NADP); Provisional	95.91
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.91
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	95.9
TIGR01087		433	murD UDP-N-acetylmuramoylalanine--D-glutamate liga	95.88
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	95.88
PRK07454		241	short chain dehydrogenase; Provisional	95.83
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	95.82
PRK14191		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.81
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	95.79
PRK06719		157	precorrin-2 dehydrogenase; Validated	95.75
cd00704		323	MDH Malate dehydrogenase. Malate dehydrogenase (MD	95.73
PRK14176		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.69
TIGR01082		448	murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a	95.66
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	95.65
PRK11861		673	bifunctional prephenate dehydrogenase/3-phosphoshi	95.6
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	95.59
cd01079		197	NAD_bind_m-THF_DH NAD binding domain of methylene-	95.57
PLN02383		344	aspartate semialdehyde dehydrogenase	95.54
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	95.49
COG0039		313	Mdh Malate/lactate dehydrogenases [Energy producti	95.49
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.49
PRK14183		281	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.47
PRK10537		393	voltage-gated potassium channel; Provisional	95.47
PRK11863		313	N-acetyl-gamma-glutamyl-phosphate reductase; Provi	95.46
PRK07326		237	short chain dehydrogenase; Provisional	95.42
PRK08664		349	aspartate-semialdehyde dehydrogenase; Reviewed	95.41
PRK05884		223	short chain dehydrogenase; Provisional	95.41
TIGR01757		387	Malate-DH_plant malate dehydrogenase, NADP-depende	95.4
cd01336		325	MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli	95.37
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	95.37
PRK03806		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.37
cd05313		254	NAD_bind_2_Glu_DH NAD(P) binding domain of glutama	95.37
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	95.31
PF02056		183	Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP	95.3
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.28
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	95.28
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	95.27
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	95.27
COG0289		266	DapB Dihydrodipicolinate reductase [Amino acid tra	95.24
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.17
PRK08265		261	short chain dehydrogenase; Provisional	95.14
PRK14173		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.12
PRK07774		250	short chain dehydrogenase; Provisional	95.09
PRK14186		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.08
PRK14573		809	bifunctional D-alanyl-alanine synthetase A/UDP-N-a	95.06
PRK14030		445	glutamate dehydrogenase; Provisional	95.06
PRK14170		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.05
PRK11908		347	NAD-dependent epimerase/dehydratase family protein	95.03
PRK10538		248	malonic semialdehyde reductase; Provisional	95.02
PF10100		429	DUF2338: Uncharacterized protein conserved in bact	95.01
PRK07236		386	hypothetical protein; Provisional	95.0
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	95.0
PRK14177		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.99
PRK08223		287	hypothetical protein; Validated	94.99
TIGR01771		299	L-LDH-NAD L-lactate dehydrogenase. This model repr	94.96
PRK14172		278	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.95
PRK14178		279	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.94
PRK14169		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.91
TIGR01758		324	MDH_euk_cyt malate dehydrogenase, NAD-dependent. T	94.91
PRK12828		239	short chain dehydrogenase; Provisional	94.89
cd05197		425	GH4_glycoside_hydrolases Glycoside Hydrases Family	94.89
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	94.88
PRK12939		250	short chain dehydrogenase; Provisional	94.87
PRK08309		177	short chain dehydrogenase; Provisional	94.85
TIGR00978		341	asd_EA aspartate-semialdehyde dehydrogenase (non-p	94.85
PRK07523		255	gluconate 5-dehydrogenase; Provisional	94.84
PRK07067		257	sorbitol dehydrogenase; Provisional	94.84
PRK06180		277	short chain dehydrogenase; Provisional	94.83
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	94.81
PRK14180		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.8
PLN03209		576	translocon at the inner envelope of chloroplast su	94.78
PRK14166		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.76
PRK00676		338	hemA glutamyl-tRNA reductase; Validated	94.76
PRK14187		294	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.74
cd05298		437	GH4_GlvA_pagL_like Glycoside Hydrolases Family 4;	94.74
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	94.7
PRK08163		396	salicylate hydroxylase; Provisional	94.7
PRK14190		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.69
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	94.68
PLN02353		473	probable UDP-glucose 6-dehydrogenase	94.67
PRK05993		277	short chain dehydrogenase; Provisional	94.65
PRK01368		454	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.64
TIGR01296		339	asd_B aspartate-semialdehyde dehydrogenase (peptid	94.64
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	94.63
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	94.62
PLN02516		299	methylenetetrahydrofolate dehydrogenase (NADP+)	94.61
TIGR01546		333	GAPDH-II_archae glyceraldehyde-3-phosphate dehydro	94.61
PRK07024		257	short chain dehydrogenase; Provisional	94.6
PRK08017		256	oxidoreductase; Provisional	94.59
PRK07074		257	short chain dehydrogenase; Provisional	94.58
COG0300		265	DltE Short-chain dehydrogenases of various substra	94.57
PRK06194		287	hypothetical protein; Provisional	94.55
TIGR02964		246	xanthine_xdhC xanthine dehydrogenase accessory pro	94.54
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	94.53
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	94.51
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	94.5
PRK08340		259	glucose-1-dehydrogenase; Provisional	94.47
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	94.47
TIGR01851		310	argC_other N-acetyl-gamma-glutamyl-phosphate reduc	94.46
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	94.45
cd05296		419	GH4_P_beta_glucosidase Glycoside Hydrolases Family	94.44
PRK06182		273	short chain dehydrogenase; Validated	94.44
PRK14193		284	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.42
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	94.39
PRK14182		282	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.38
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.36
PRK06482		276	short chain dehydrogenase; Provisional	94.35
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	94.32
PRK14171		288	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.32
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	94.29
COG3268		382	Uncharacterized conserved protein [Function unknow	94.27
PRK06500		249	short chain dehydrogenase; Provisional	94.24
PRK06728		347	aspartate-semialdehyde dehydrogenase; Provisional	94.23
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	94.22
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.22
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	94.22
PRK04663		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.21
PF03059		276	NAS: Nicotianamine synthase protein; InterPro: IPR	94.2
PRK07478		254	short chain dehydrogenase; Provisional	94.19
PRK06139		330	short chain dehydrogenase; Provisional	94.18
PLN02616		364	tetrahydrofolate dehydrogenase/cyclohydrolase, put	94.16
PRK12829		264	short chain dehydrogenase; Provisional	94.15
PRK05693		274	short chain dehydrogenase; Provisional	94.12
PRK08267		260	short chain dehydrogenase; Provisional	94.12
PLN02897		345	tetrahydrofolate dehydrogenase/cyclohydrolase, put	94.1
PRK06185		407	hypothetical protein; Provisional	94.08
KOG1683		380	consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA	94.07
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	94.06
PF00208		244	ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val	94.06
PRK06101		240	short chain dehydrogenase; Provisional	94.05
PRK08306		296	dipicolinate synthase subunit A; Reviewed	94.01
PRK14851		679	hypothetical protein; Provisional	94.01
PRK08040		336	putative semialdehyde dehydrogenase; Provisional	93.99
PRK08643		256	acetoin reductase; Validated	93.99
COG0026		375	PurK Phosphoribosylaminoimidazole carboxylase (NCA	93.99
PRK14181		287	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.97
COG1486		442	CelF Alpha-galactosidases/6-phospho-beta-glucosida	93.96
PRK05876		275	short chain dehydrogenase; Provisional	93.92
PRK07877		722	hypothetical protein; Provisional	93.9
COG0190		283	FolD 5,10-methylene-tetrahydrofolate dehydrogenase	93.88
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	93.86
PRK14852		989	hypothetical protein; Provisional	93.83
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	93.83
PRK07109		334	short chain dehydrogenase; Provisional	93.81
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	93.8
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	93.8
PRK06124		256	gluconate 5-dehydrogenase; Provisional	93.8
PRK06753		373	hypothetical protein; Provisional	93.78
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	93.77
PRK07890		258	short chain dehydrogenase; Provisional	93.76
PRK05868		372	hypothetical protein; Validated	93.72
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	93.71
COG0499		420	SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me	93.71
PRK03815		401	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.67
PRK08589		272	short chain dehydrogenase; Validated	93.64
PRK07063		260	short chain dehydrogenase; Provisional	93.64
PRK05866		293	short chain dehydrogenase; Provisional	93.62
KOG1399		448	consensus Flavin-containing monooxygenase [Seconda	93.61
PLN00016		378	RNA-binding protein; Provisional	93.59
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	93.57
PRK06057		255	short chain dehydrogenase; Provisional	93.57
PRK07453		322	protochlorophyllide oxidoreductase; Validated	93.56
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	93.52
PRK14168		297	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.51
PRK06847		375	hypothetical protein; Provisional	93.43
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	93.42
PRK06153		393	hypothetical protein; Provisional	93.42
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	93.39
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	93.37
PRK14185		293	bifunctional 5,10-methylene-tetrahydrofolate dehyd	93.32
TIGR03855		229	NAD_NadX aspartate dehydrogenase. Members of this	93.3
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.3
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	93.28
PRK11728		393	hydroxyglutarate oxidase; Provisional	93.27
PRK08263		275	short chain dehydrogenase; Provisional	93.26
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	93.25
PRK05872		296	short chain dehydrogenase; Provisional	93.21
COG4091		438	Predicted homoserine dehydrogenase [Amino acid tra	93.2
COG0334		411	GdhA Glutamate dehydrogenase/leucine dehydrogenase	93.19
PF00289		110	CPSase_L_chain: Carbamoyl-phosphate synthase L cha	93.19
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	93.19
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	93.16
cd01491		286	Ube1_repeat1 Ubiquitin activating enzyme (E1), rep	93.15
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	93.14
PRK08213		259	gluconate 5-dehydrogenase; Provisional	93.1

>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=9.1e-140  Score=1033.71  Aligned_cols=470  Identities=58%  Similarity=0.952  Sum_probs=454.8

Q ss_pred             CCCcEEEEcccHHHHHHHHHHHhCCCcEEEEeCChhHHHHHHHhhcccCCCCeeeeCCHHHHHhhcCCCcEEEEecCCCc
Q 010652            5 ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYTPRDFVLSIQRPRSVIILVKAGS   84 (505)
Q Consensus         5 ~~~~IgiIGlG~mG~~lA~~La~~G~~V~v~dr~~~~~~~~~~~~~~~g~~~i~~~~s~~e~v~~l~~advIil~vp~~~   84 (505)
                      +.+.||+||||+||++||+|++++||+|.+|||++++++++.++....+  ++.++.|++|++++|++|+.|++||.++.
T Consensus         2 ~~~~iGviGLaVMG~NLaLNi~~~G~~VavyNRt~~ktd~f~~~~~~~k--~i~~~~sieefV~~Le~PRkI~lMVkAG~   79 (473)
T COG0362           2 MKADIGVIGLAVMGSNLALNIADHGYTVAVYNRTTEKTDEFLAERAKGK--NIVPAYSIEEFVASLEKPRKILLMVKAGT   79 (473)
T ss_pred             CccceeeEehhhhhHHHHHHHHhcCceEEEEeCCHHHHHHHHHhCccCC--CccccCcHHHHHHHhcCCceEEEEEecCC
Confidence            3578999999999999999999999999999999999999998765432  68999999999999999999999999999


Q ss_pred             hHHHHHHHHhhccCCCCEEEeCCCCChhhHHHHHHHHHHcCCeEEcCCCCCChhhhhcCCcccCCCCHHHHHHHHHHHHH
Q 010652           85 PVDQTIAALSEHMSPGDCIIDGGNEWYLNTERRIHEASQKGLLYLGMGVSGGEEGARHGPSLMPGGSFEAYNNIRDILQK  164 (505)
Q Consensus        85 ~v~~vl~~l~~~l~~g~iiId~st~~~~~t~~~~~~l~~~gi~~v~~pvsgg~~~a~~G~~i~~gg~~e~~~~v~~ll~~  164 (505)
                      +||.++++|+|+|++||||||.+|+++.||.|+.+.|.++|++|++++||||++||++||+|||||++++|+.++|+|++
T Consensus        80 ~VD~~I~~L~p~Le~gDIiIDGGNs~y~DT~RR~~eL~~~Gi~FvG~GVSGGEeGA~~GPSiMpGG~~eay~~v~pil~~  159 (473)
T COG0362          80 PVDAVIEQLLPLLEKGDIIIDGGNSHYKDTIRRNKELSEKGILFVGMGVSGGEEGARHGPSIMPGGQKEAYELVAPILTK  159 (473)
T ss_pred             cHHHHHHHHHhhcCCCCEEEeCCCcCCchHHHHHHHHHhcCCeEEeccccccccccccCCCcCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcccCCCCcEEEeCCCCchhhhhhHhHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHhccCCcchhhHhhhhhhc
Q 010652          165 VAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKHVGGLSNAELAEIFDEWNKGELESFLVEITADIF  244 (505)
Q Consensus       165 iga~~~~~~~v~~~G~~G~g~~vK~v~N~i~~~~~~~i~Ea~~l~~~~g~l~~~~i~~~~~~~~~g~~~s~l~~~~~~~l  244 (505)
                      |+||.+++|||.|+|+.|+|||||||||+|||+.||+|+|+|.+++...|++.++|.++|.+||+|.++|||++|+.++|
T Consensus       160 IaAk~~g~pCc~~iG~~GAGHfVKmVHNGIEYgDMQlIaE~Y~ilk~~lgls~~ei~~vF~~WN~geL~SYLIeIT~~IL  239 (473)
T COG0362         160 IAAKVDGEPCCTWIGPDGAGHFVKMVHNGIEYGDMQLIAEAYDILKDGLGLSAEEIAEVFEEWNKGELDSYLIEITADIL  239 (473)
T ss_pred             HHhhcCCCCceeeECCCCCCceeeeeecCchHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHhccCcchHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999777999999999999999999999999999999


Q ss_pred             ccccccCCchhHHHHHhhhCCCccHHHHHHHHHHcCCCcchhHHHHHHHHHcccchHHHHHHHHhccCCCcccccccccc
Q 010652          245 KVKDEYGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVH  324 (505)
Q Consensus       245 ~~~~~~~~~~~ld~i~~~~~~kgtg~~~~~~A~~~gvp~p~i~~A~~~r~~s~~~~~r~~~~~~~~~~~~~~~~~~~~~~  324 (505)
                      +.+|+.++.+++|.|+|.++|||||+|+++.|.++|+|+|+|.+||++|++|+.|++|+.+++.|++|...       .+
T Consensus       240 ~~kD~~~~kplvd~ILD~AgQKGTGkWt~~~AldlGvP~t~I~eaVfAR~lSs~K~eR~~Ask~l~~~~~~-------~~  312 (473)
T COG0362         240 RKKDEEGGKPLVDKILDKAGQKGTGKWTVISALDLGVPLTLITEAVFARYLSSLKDERVAASKVLAGPKLG-------EP  312 (473)
T ss_pred             hhcCcccCCchHHHHHHHhcCCCcchhhHHHHHHcCCCcHHHHHHHHHHHHHHhHHHHHHHHhhcCCCCCC-------CC
Confidence            99887777799999999999999999999999999999999999999999999999999999999988542       36


Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCCHHHHHHHHhCCCcchhhHHHHHHHHHhcCCCCCCCcchh
Q 010652          325 VDKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDP  404 (505)
Q Consensus       325 ~~~~~~v~~v~~ai~~~~i~~yaqg~~ll~~as~~~~w~l~l~~i~~iW~~GciIrs~lL~~i~~~~~~~~~~~~ll~~~  404 (505)
                      .++..|+++|++|||+++|++|||||.+|++||++|+|+|++.+|++|||+||||||.||+.|+++|+++|++.|||++|
T Consensus       313 ~dk~~fi~~vr~ALy~sKI~sYAQGF~~l~~AS~e~gW~l~~~~iA~iWR~GCIIRs~FL~~I~~af~~~p~l~nLl~~p  392 (473)
T COG0362         313 GDKEEFIEDVRQALYASKIVSYAQGFALLRAASKEYGWDLNLGEIALIWRGGCIIRSKFLDKITDAFDENPELANLLLAP  392 (473)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCHHHHHHHHhccceehHHHHHHHHHHHhcCcchhhhhcCH
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHhHHHHhhhhHHHHHHHHHHHcCCChHHHHHHHHHHHhhccCChhhhHHHHHhhhhcCccccccCCCCcccccccCCC
Q 010652          405 EFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYRRARLPANLVQAQRDLFGAHTYERIDRPGSFHTEWTKLP  483 (505)
Q Consensus       405 ~~~~~~~~~~~~~r~~v~~a~~~gvp~P~~saal~y~~~~~~~~~~a~liqaqRd~FG~H~~~r~d~~~~~h~~w~~~~  483 (505)
                      +|.+.+.+.+.+||++|.+|++.|+|+|++|+||+|||+||++++|+|||||||||||||||+|+|++|.||++|++..
T Consensus       393 yF~~~~~~~~~~~R~vV~~a~~~giP~P~~ssalsy~Dsyr~~~lpaNLiQAQRDyFGAHtyeR~D~~~~fHt~W~~~~  471 (473)
T COG0362         393 YFKSILEEYQQSLRRVVAYAVEAGIPVPAFSSALSYYDSYRTARLPANLIQAQRDYFGAHTYERTDKEGFFHTNWTGGG  471 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhhhccccHHHHHHHHHhhcccceeecCCCCccccCccCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998643

>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK09287 6-phosphogluconate dehydrogenase; Validated	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>KOG0409 consensus Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional	Back alignment and domain information

>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+))	Back alignment and domain information

>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein	Back alignment and domain information

>PRK09287 6-phosphogluconate dehydrogenase; Validated	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK06545 prephenate dehydrogenase; Validated	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>PLN02712 arogenate dehydrogenase	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK08605 D-lactate dehydrogenase; Validated	Back alignment and domain information

>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism]	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00112 proC pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02306 hydroxypyruvate reductase	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PRK06444 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>TIGR01921 DAP-DH diaminopimelate dehydrogenase	Back alignment and domain information

>PRK05225 ketol-acid reductoisomerase; Validated	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>PRK06407 ornithine cyclodeaminase; Provisional	Back alignment and domain information

>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>PRK06823 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>TIGR02992 ectoine_eutC ectoine utilization protein EutC	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion]	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08291 ectoine utilization protein EutC; Validated	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK13303 L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>TIGR01761 thiaz-red thiazolinyl imide reductase	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>TIGR00036 dapB dihydrodipicolinate reductase	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline []	Back alignment and domain information

>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK07589 ornithine cyclodeaminase; Validated	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK11579 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>COG5495 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated	Back alignment and domain information

>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D	Back alignment and domain information

>cd00300 LDH_like L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK06199 ornithine cyclodeaminase; Validated	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15076 alpha-galactosidase; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional	Back alignment and domain information

>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PRK06349 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK10206 putative oxidoreductase; Provisional	Back alignment and domain information

>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK06392 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK08374 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase	Back alignment and domain information

>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases	Back alignment and domain information

>PTZ00325 malate dehydrogenase; Provisional	Back alignment and domain information

>PLN00106 malate dehydrogenase	Back alignment and domain information

>PRK05442 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>PLN02477 glutamate dehydrogenase	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK05678 succinyl-CoA synthetase subunit alpha; Validated	Back alignment and domain information

>PRK05086 malate dehydrogenase; Provisional	Back alignment and domain information

>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01759 MalateDH-SF1 malate dehydrogenase	Back alignment and domain information

>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG2344 AT-rich DNA-binding protein [General function prediction only]	Back alignment and domain information

>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF)	Back alignment and domain information

>PRK09414 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK05472 redox-sensing transcriptional repressor Rex; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK15059 tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN00112 malate dehydrogenase (NADP); Provisional	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>cd00704 MDH Malate dehydrogenase	Back alignment and domain information

>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase	Back alignment and domain information

>PLN02383 aspartate semialdehyde dehydrogenase	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK10537 voltage-gated potassium channel; Provisional	Back alignment and domain information

>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent	Back alignment and domain information

>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>PRK14030 glutamate dehydrogenase; Provisional	Back alignment and domain information

>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>TIGR01771 L-LDH-NAD L-lactate dehydrogenase	Back alignment and domain information

>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08309 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms)	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK00676 hemA glutamyl-tRNA reductase; Validated	Back alignment and domain information

>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+)	Back alignment and domain information

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>COG3268 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PRK14851 hypothetical protein; Provisional	Back alignment and domain information

>PRK08040 putative semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07877 hypothetical protein; Provisional	Back alignment and domain information

>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]	Back alignment and domain information

>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>PRK06153 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>TIGR03855 NAD_NadX aspartate dehydrogenase	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below)	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		505
2w8z_A		470	Geobacillus Stearothermophilus 6-Phosphogluconate D		1e-145
2w90_A		471	Geobacillus Stearothermophilus 6-Phosphogluconate D		1e-145
2iyo_A		472	Structural Characterization Of A Bacterial 6pdh Rev		1e-135
2iyp_A		473	Product Rup Length = 473		1e-134
2iz0_A		474	Pex Inhibitor-Home Data Length = 474		1e-134
3fwn_A		480	Dimeric 6-Phosphogluconate Dehydrogenase Complexed		1e-134
2zya_A		480	Dimeric 6-Phosphogluconate Dehydrogenase Complexed		1e-132
2zyg_A		480	Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenas		1e-132
1pgn_A		482	Crystallographic Study Of Coenzyme, Coenzyme Analog		1e-128
2jkv_A		505	Structure Of Human Phosphogluconate Dehydrogenase I		1e-125
4gwg_A		484	Crystal Structure Analysis Of 6-Phosphogluconate De		1e-125
2p4q_A		497	Crystal Structure Analysis Of Gnd1 In Saccharomyces		1e-124
1pgj_A		478	X-Ray Structure Of 6-Phosphogluconate Dehydrogenase		6e-77
4e21_A		358	The Crystal Structure Of 6-Phosphogluconate Dehydro		5e-18
2uyy_A		316	Structure Of The Cytokine-Like Nuclear Factor N-Pac		2e-07
3doj_A		310	Structure Of Glyoxylate Reductase 1 From Arabidopsi		7e-07
1wp4_A		289	Structure Of Tt368 Protein From Thermus Thermophilu		9e-07
3cky_A		301	Structural And Kinetic Properties Of A Beta-Hydroxy		3e-05
2cvz_A		289	Structure Of Hydroxyisobutyrate Dehydrogenase From		1e-04

>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470