Citrus Sinensis ID: 010753
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 502 | ||||||
| 225447095 | 569 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.878 | 0.699 | 0.0 | |
| 255576913 | 570 | ubiquitin fusion degradaton protein, put | 0.994 | 0.875 | 0.694 | 0.0 | |
| 224131638 | 567 | predicted protein [Populus trichocarpa] | 0.992 | 0.878 | 0.681 | 0.0 | |
| 449453521 | 571 | PREDICTED: uncharacterized protein LOC10 | 0.998 | 0.877 | 0.681 | 0.0 | |
| 356554447 | 573 | PREDICTED: uncharacterized protein LOC10 | 0.998 | 0.874 | 0.665 | 0.0 | |
| 356501298 | 573 | PREDICTED: uncharacterized protein LOC10 | 0.998 | 0.874 | 0.681 | 0.0 | |
| 357493375 | 571 | Ubiquitin fusion degradation protein-lik | 0.998 | 0.877 | 0.671 | 0.0 | |
| 164605542 | 570 | CM0545.430.nc [Lotus japonicus] | 0.998 | 0.878 | 0.663 | 0.0 | |
| 11139266 | 574 | PRLI-interacting factor K [Arabidopsis t | 0.974 | 0.851 | 0.633 | 0.0 | |
| 18414447 | 561 | ubiquitin fusion degradation UFD1 family | 0.974 | 0.871 | 0.633 | 0.0 |
| >gi|225447095|ref|XP_002273297.1| PREDICTED: uncharacterized protein LOC100246609 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 747 bits (1929), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 353/505 (69%), Positives = 424/505 (83%), Gaps = 5/505 (0%)
Query: 1 MDFELRRAREKLEKEQKERKERARLKLEREKKAKEEAKKQREAIEAAQRSRRLDAIDAQL 60
MDFELRRAREKLE+EQKERKE+ARLKLER++K+K+EA +QR+AIEA QRSRRLDA +AQL
Sbjct: 1 MDFELRRAREKLEREQKERKEKARLKLERDRKSKQEAARQRDAIEAVQRSRRLDAAEAQL 60
Query: 61 KADQEMQESLLAGGGIVFYHTLEALPFQGSGDKIKLPPSCFTELSGQGAFDKGPLHFKLS 120
KADQ+M+ESLLAG G++F+ LEA+ +QG+GDKIKLPPSCF ELS QGAFDKGPL+F LS
Sbjct: 61 KADQQMEESLLAGRGVMFFRILEAVAYQGNGDKIKLPPSCFKELSDQGAFDKGPLYFGLS 120
Query: 121 VLHQEGPSNMEDGEKESNRSTHSGVLEFTADEGFVGLPPHVWRNLFPSDTPNNSFVEVRY 180
V+HQEG + + E ++ R+TH+GVLEFTA+EG V LPPHVW NLFP +T + VEVRY
Sbjct: 121 VVHQEGSLDTKAAETQNQRTTHAGVLEFTAEEGSVSLPPHVWSNLFPEETLKSPLVEVRY 180
Query: 181 VRLPKGTYAKLQPEGIGFAELPNQKAVLETSLRQHATLSQDDVLTVNYGELAYKLKVLEL 240
+ LPKGTYAKLQ +GIGF+++PN KAVLET LRQHATLSQDDVL VN+GEL YKLKVLEL
Sbjct: 181 LWLPKGTYAKLQADGIGFSDIPNHKAVLETRLRQHATLSQDDVLIVNHGELTYKLKVLEL 240
Query: 241 KPSSSVSVLETDIEVDIVSPDDMSAGTDQYTLKPLLFGKSESGMVEEGKYVFYKFTIDDD 300
KPSSS+SVLETDIEVDIV PD +S T+Q LKPL FGKSE+GMVEEG YV+YKF++D D
Sbjct: 241 KPSSSISVLETDIEVDIVGPDSVSGRTNQQFLKPLEFGKSETGMVEEGNYVYYKFSMDGD 300
Query: 301 TRKKIVSGEKRAEVRVDSEIDGGDTSIYVSRHPLLFPTRHLHEWSSHDAGSKVVILSSKD 360
I SG+ R EV++++E DGGDT +Y+SRHPL+FP RH HEWSSHD GSK +ILS KD
Sbjct: 301 ILGIIASGDARIEVKIEAESDGGDTDLYISRHPLIFPNRHQHEWSSHDVGSKTLILSHKD 360
Query: 361 KSVDVGTYSIGVYGFKDMTKFQVLVTLEDDSGRKVGQEATSSSSSIEMDTVQCKNCKRFI 420
+S++ GT+SIGVYGFK TK+Q+ V+++D+ KVGQ+AT SSSS+E+DTV+C+NCK +I
Sbjct: 361 QSLEAGTFSIGVYGFKGTTKYQISVSVQDNLNHKVGQQAT-SSSSMEVDTVECRNCKHYI 419
Query: 421 PSRSIVLHEAYCSRHSVACQHAGCGMVLRTEEARDHVHCDKCGQGLQRREMEKHMKVFHE 480
PSRSI LHEAYCSRH++ C HAGCG+VLR EA++HVHCDKCGQ LQR EMEKHMKVFHE
Sbjct: 420 PSRSIALHEAYCSRHNIICPHAGCGVVLRVAEAKNHVHCDKCGQALQRGEMEKHMKVFHE 479
Query: 481 QCSCPCGVVLENAAMV----SYCPL 501
CPCGVVLE MV S CPL
Sbjct: 480 PLHCPCGVVLEKELMVQHQASACPL 504
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255576913|ref|XP_002529342.1| ubiquitin fusion degradaton protein, putative [Ricinus communis] gi|223531213|gb|EEF33059.1| ubiquitin fusion degradaton protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224131638|ref|XP_002321140.1| predicted protein [Populus trichocarpa] gi|222861913|gb|EEE99455.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449453521|ref|XP_004144505.1| PREDICTED: uncharacterized protein LOC101203089 [Cucumis sativus] gi|449493141|ref|XP_004159204.1| PREDICTED: uncharacterized LOC101203089 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356554447|ref|XP_003545558.1| PREDICTED: uncharacterized protein LOC100779441 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501298|ref|XP_003519462.1| PREDICTED: uncharacterized protein LOC100777384 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357493375|ref|XP_003616976.1| Ubiquitin fusion degradation protein-like protein [Medicago truncatula] gi|355518311|gb|AES99934.1| Ubiquitin fusion degradation protein-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|164605542|dbj|BAF98608.1| CM0545.430.nc [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|11139266|gb|AAG31651.1| PRLI-interacting factor K [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18414447|ref|NP_567465.1| ubiquitin fusion degradation UFD1 family protein [Arabidopsis thaliana] gi|17933289|gb|AAL48228.1|AF446353_1 AT4g15420/dl3755w [Arabidopsis thaliana] gi|21554166|gb|AAM63245.1| UFD1 like protein [Arabidopsis thaliana] gi|23506013|gb|AAN28866.1| At4g15420/dl3755w [Arabidopsis thaliana] gi|111609946|gb|ABH11523.1| UFD1d [Arabidopsis thaliana] gi|332658201|gb|AEE83601.1| ubiquitin fusion degradation UFD1 family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 502 | ||||||
| TAIR|locus:2130120 | 561 | AT4G15420 [Arabidopsis thalian | 0.878 | 0.786 | 0.614 | 2.1e-156 | |
| DICTYBASE|DDB_G0271122 | 330 | ufd1 "ubiquitin fusion degrada | 0.386 | 0.587 | 0.359 | 2.3e-26 | |
| TAIR|locus:2066122 | 312 | AT2G29070 [Arabidopsis thalian | 0.306 | 0.493 | 0.394 | 4.7e-24 | |
| TAIR|locus:2050054 | 340 | UFD1 "AT2G21270" [Arabidopsis | 0.348 | 0.514 | 0.366 | 6.2e-24 | |
| ZFIN|ZDB-GENE-040718-150 | 308 | ufd1l "ubiquitin fusion degrad | 0.278 | 0.454 | 0.426 | 1e-23 | |
| UNIPROTKB|F1NVD8 | 307 | UFD1L "Uncharacterized protein | 0.278 | 0.456 | 0.419 | 3.8e-23 | |
| UNIPROTKB|J9NYF2 | 307 | UFD1L "Uncharacterized protein | 0.278 | 0.456 | 0.419 | 3.8e-23 | |
| UNIPROTKB|Q92890 | 307 | UFD1L "Ubiquitin fusion degrad | 0.278 | 0.456 | 0.419 | 3.8e-23 | |
| UNIPROTKB|F1RK61 | 307 | UFD1L "Uncharacterized protein | 0.278 | 0.456 | 0.419 | 3.8e-23 | |
| MGI|MGI:109353 | 307 | Ufd1l "ubiquitin fusion degrad | 0.278 | 0.456 | 0.419 | 3.8e-23 |
| TAIR|locus:2130120 AT4G15420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1494 (531.0 bits), Expect = 2.1e-156, Sum P(2) = 2.1e-156
Identities = 282/459 (61%), Positives = 360/459 (78%)
Query: 49 RSRRLDAIDAQLKADQEMQESLLAGGGIVFYHTLEALPFQGSGDKIKLPPSCFTELSGQG 108
R+RRLDAI+AQ+KADQ MQESL++G GIVF +A+ FQG+GDKIKLPPSCFTELS QG
Sbjct: 49 RARRLDAIEAQIKADQHMQESLVSGDGIVFERVFQAVSFQGNGDKIKLPPSCFTELSDQG 108
Query: 109 AFDKGPLHFKLSVLHQEGPSNMEDGEKESNRSTHSGVLEFTADEGFVGLPPHVWRNLFPS 168
AFDKGPL+F+LSV+ ++ ++THSGVLEFTA++G +GLPPHVW NLF +
Sbjct: 109 AFDKGPLYFELSVVDHA----------DNKKTTHSGVLEFTAEDGTIGLPPHVWSNLFST 158
Query: 169 DTPNN-SFVEVRYVRLPKGTYAKLQPEGIGFAELPNQKAVLETSLRQHATLSQDDVLTVN 227
P + VE+RY+RLPKG+YAKLQP+ +GF++LPN KA+LET LRQHATLS DDVL VN
Sbjct: 159 HDPMDVPLVEIRYIRLPKGSYAKLQPDNLGFSDLPNHKAILETILRQHATLSLDDVLLVN 218
Query: 228 YGELAYKLKVLELKPSSSVSVLETDIEVDIVSPDDMSAGTDQYTLKPLLFGKSESGMVEE 287
YG+++YKL+VLEL+P++S+SVLETDIEVDIVSPD +S +Q+ LKPL +GKSESG VEE
Sbjct: 219 YGQVSYKLQVLELRPATSISVLETDIEVDIVSPDIVSDQPNQHVLKPLQYGKSESGTVEE 278
Query: 288 GKYVFYKFTIDDDTRKKIVSGEKRAEVRVDSEIDGGDTSIYVSRHPLLFPTRHLHEWSSH 347
G+Y +YKF ID+ T +K+++G + V+VD E G DT +YVS+HP+LFP+ + HEWSSH
Sbjct: 279 GRYDYYKFVIDEATVEKVMAGSVKVIVKVDVEKVGADTDLYVSKHPVLFPSLNQHEWSSH 338
Query: 348 DAGSKVVILSSKDKSVDVGTYSIGVYGFKDMTKFQVLVTLEDD-SGRKVGQEATSSSSSI 406
D GSK +IL SK++++ GTYSIGVYGFK K+QV V +++ G KVG+ A SSSS +
Sbjct: 339 DVGSKTLILVSKERALSSGTYSIGVYGFKGTVKYQVSVLVQESIDGAKVGERAVSSSSDV 398
Query: 407 EMDTVQCKNCKRFIPSRSIVLHEAYCSRHSVACQHAGCGMVLRTEEARDHVHCDKCGQGL 466
DTV+C+NCK IPSRSI LHE YCSRH+V C H GCG+VLR EEA++H+HC+KCG+ L
Sbjct: 399 --DTVECRNCKHSIPSRSIALHEVYCSRHNVVCNHHGCGIVLRVEEAKNHLHCEKCGKAL 456
Query: 467 QRREMEKHMKVFHEQCSCPCGVVLENAAMVSY----CPL 501
Q EMEKH+KVFHE +C CG+VLE MV + CPL
Sbjct: 457 QPTEMEKHLKVFHEPLTCGCGIVLEKEQMVQHQGKDCPL 495
|
|
| DICTYBASE|DDB_G0271122 ufd1 "ubiquitin fusion degradation protein UFD1 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066122 AT2G29070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050054 UFD1 "AT2G21270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-150 ufd1l "ubiquitin fusion degradation 1-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVD8 UFD1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYF2 UFD1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92890 UFD1L "Ubiquitin fusion degradation protein 1 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RK61 UFD1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109353 Ufd1l "ubiquitin fusion degradation 1 like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025922001 | SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (579 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 502 | |||
| PLN03086 | 567 | PLN03086, PLN03086, PRLI-interacting factor K; Pro | 0.0 | |
| pfam03152 | 176 | pfam03152, UFD1, Ubiquitin fusion degradation prot | 1e-64 | |
| COG5140 | 331 | COG5140, UFD1, Ubiquitin fusion-degradation protei | 7e-26 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 3e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 8e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| smart00935 | 140 | smart00935, OmpH, Outer membrane protein (OmpH-lik | 0.002 | |
| pfam04518 | 380 | pfam04518, Effector_1, Effector from type III secr | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 |
| >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
Score = 835 bits (2159), Expect = 0.0
Identities = 366/505 (72%), Positives = 432/505 (85%), Gaps = 7/505 (1%)
Query: 1 MDFELRRAREKLEKEQKERKERARLKLEREKKAKEEAKKQREAIEAAQRSRRLDAIDAQL 60
MDFELRRAREKLE+EQ+ERK+RA+LKLERE+KAKEEA KQREAIEAAQRSRRLDAI+AQ+
Sbjct: 1 MDFELRRAREKLEREQRERKQRAKLKLERERKAKEEAAKQREAIEAAQRSRRLDAIEAQI 60
Query: 61 KADQEMQESLLAGGGIVFYHTLEALPFQGSGDKIKLPPSCFTELSGQGAFDKGPLHFKLS 120
KADQ+MQESL AG GIVF EA+ FQG+GDKIKLPPSCFTELS QGAFDKGPL+F+LS
Sbjct: 61 KADQQMQESLQAGRGIVFSRIFEAVSFQGNGDKIKLPPSCFTELSDQGAFDKGPLYFRLS 120
Query: 121 VLHQEGPSNMEDGEKESNRSTHSGVLEFTADEGFVGLPPHVWRNLFPSDTPNNSFVEVRY 180
V+HQEG M+D +S ++THSGVLEFTA+EG VGLPPHVW NLFPSD P+ VEVRY
Sbjct: 121 VVHQEGSGEMKD--TDSQKTTHSGVLEFTAEEGSVGLPPHVWSNLFPSDPPDVPLVEVRY 178
Query: 181 VRLPKGTYAKLQPEGIGFAELPNQKAVLETSLRQHATLSQDDVLTVNYGELAYKLKVLEL 240
+ LPKGTYAKLQP+G+GF++LPN KAVLET+LRQHATLS+DDVL VNYG+L YKLKVLEL
Sbjct: 179 IWLPKGTYAKLQPDGVGFSDLPNHKAVLETALRQHATLSEDDVLVVNYGQLTYKLKVLEL 238
Query: 241 KPSSSVSVLETDIEVDIVSPDDMSAGTDQYTLKPLLFGKSESGMVEEGKYVFYKFTIDDD 300
KP+SSVSVLETDIEVDIV PD +S +Q+ LKPL FGKSESGMVEEG Y +YKF+ID+D
Sbjct: 239 KPASSVSVLETDIEVDIVGPDSVSNEENQHVLKPLEFGKSESGMVEEGNYRYYKFSIDED 298
Query: 301 TRKKIVSGEKRAEVRVDSEIDGGDTSIYVSRHPLLFPTRHLHEWSSHDAGSKVVILSSKD 360
T +K+ SG+ R EV++D+E GGDT +YVS+HPL+FPTRH HEWSSHD GSKV+IL SKD
Sbjct: 299 TWEKVASGDARVEVKIDAETSGGDTDLYVSKHPLVFPTRHQHEWSSHDMGSKVLILKSKD 358
Query: 361 KSVDVGTYSIGVYGFKDMTKFQVLVTLEDDSGRKVGQEATSSSSSIEMDTVQCKNCKRFI 420
S+ GTYSIGVYGFK TK+QV V+++D++ +KVG++A SSSSS+++DTV+C+NCK +I
Sbjct: 359 ASLSSGTYSIGVYGFKGTTKYQVSVSVQDNNNQKVGEQA-SSSSSMDVDTVECRNCKHYI 417
Query: 421 PSRSIVLHEAYCSRHSVACQHAGCGMVLRTEEARDHVHCDKCGQGLQRREMEKHMKVFHE 480
PSRSI LHEAYCSRH+V C H GCG+VLR EEA++HVHC+KCGQ Q+ EMEKHMKVFHE
Sbjct: 418 PSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQQGEMEKHMKVFHE 477
Query: 481 QCSCPCGVVLENAAMV----SYCPL 501
CPCGVVLE MV S CPL
Sbjct: 478 PLQCPCGVVLEKEQMVQHQASTCPL 502
|
Length = 567 |
| >gnl|CDD|217391 pfam03152, UFD1, Ubiquitin fusion degradation protein UFD1 | Back alignment and domain information |
|---|
| >gnl|CDD|227469 COG5140, UFD1, Ubiquitin fusion-degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|218124 pfam04518, Effector_1, Effector from type III secretion system | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 502 | |||
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 100.0 | |
| KOG1816 | 308 | consensus Ubiquitin fusion-degradation protein [Po | 100.0 | |
| PF03152 | 176 | UFD1: Ubiquitin fusion degradation protein UFD1; I | 100.0 | |
| COG5140 | 331 | UFD1 Ubiquitin fusion-degradation protein [Posttra | 100.0 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 99.33 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.27 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 99.0 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.59 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 98.48 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 98.41 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.38 | |
| KOG3576 | 267 | consensus Ovo and related transcription factors [T | 98.14 | |
| PHA00733 | 128 | hypothetical protein | 98.0 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 97.92 | |
| KOG3608 | 467 | consensus Zn finger proteins [General function pre | 97.81 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 97.77 | |
| PHA00732 | 79 | hypothetical protein | 97.62 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 97.57 | |
| PHA00733 | 128 | hypothetical protein | 97.42 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 97.1 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 96.92 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 96.91 | |
| KOG1074 | 958 | consensus Transcriptional repressor SALM [Transcri | 96.65 | |
| PHA00616 | 44 | hypothetical protein | 95.99 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.98 | |
| KOG3993 | 500 | consensus Transcription factor (contains Zn finger | 95.93 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 95.86 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 95.74 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 95.72 | |
| KOG2186 | 276 | consensus Cell growth-regulating nucleolar protein | 95.36 | |
| PHA00732 | 79 | hypothetical protein | 94.94 | |
| PHA00616 | 44 | hypothetical protein | 94.86 | |
| PF02933 | 64 | CDC48_2: Cell division protein 48 (CDC48), domain | 94.65 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 94.54 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 94.38 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 94.34 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 94.24 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 93.29 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.11 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 92.8 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 92.54 | |
| PF02176 | 60 | zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A | 92.32 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 91.35 | |
| KOG3654 | 708 | consensus Uncharacterized CH domain protein [Cytos | 91.32 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 91.13 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 91.13 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 91.11 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 90.87 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 90.84 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 90.29 | |
| PRK11029 | 334 | FtsH protease regulator HflC; Provisional | 89.62 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 88.44 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 88.11 | |
| PRK00247 | 429 | putative inner membrane protein translocase compon | 87.37 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 87.23 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 86.99 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 86.73 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 86.21 | |
| PF05502 | 483 | Dynactin_p62: Dynactin p62 family; InterPro: IPR00 | 86.08 | |
| PF09262 | 80 | PEX-1N: Peroxisome biogenesis factor 1, N-terminal | 85.93 | |
| PF06936 | 190 | Selenoprotein_S: Selenoprotein S (SelS); InterPro: | 85.51 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 85.5 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 85.35 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 84.71 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 83.72 | |
| KOG3054 | 299 | consensus Uncharacterized conserved protein [Funct | 83.5 | |
| KOG2231 | 669 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.23 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 83.05 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 82.98 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 82.92 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 82.1 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 81.95 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 81.22 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 81.1 | |
| TIGR01932 | 317 | hflC HflC protein. HflK and HflC are paralogs enco | 80.8 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 80.65 | |
| PF14353 | 128 | CpXC: CpXC protein | 80.35 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 80.03 |
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-140 Score=1131.40 Aligned_cols=498 Identities=73% Similarity=1.191 Sum_probs=472.4
Q ss_pred CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHcCCcEEEEE
Q 010753 1 MDFELRRAREKLEKEQKERKERARLKLEREKKAKEEAKKQREAIEAAQRSRRLDAIDAQLKADQEMQESLLAGGGIVFYH 80 (502)
Q Consensus 1 m~~~l~~~~~k~~~e~~~r~~~~~~~~~~e~~~~~~a~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~g~~~~~ 80 (502)
||||||+|++||+|||++|+++||+|+++||++|+||+|||||||++||||||||++||++|+|+|+|++++|+||.|++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ 80 (567)
T PLN03086 1 MDFELRRAREKLEREQRERKQRAKLKLERERKAKEEAAKQREAIEAAQRSRRLDAIEAQIKADQQMQESLQAGRGIVFSR 80 (567)
T ss_pred CchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCeEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeeeccCCCCCCeEEeChhHHHHHHcCCCCCCCceEEEEEecCCCCCCCCCCCccCCCCeEEEEEeeeeeCCCceeccHH
Q 010753 81 TLEALPFQGSGDKIKLPPSCFTELSGQGAFDKGPLHFKLSVLHQEGPSNMEDGEKESNRSTHSGVLEFTADEGFVGLPPH 160 (502)
Q Consensus 81 ~~~~~~~~~~gDKIiLP~SaL~~L~~~~~~~~~Pl~F~l~n~~~~~~~~~~~~~~~~~~~th~GVlEFsA~EG~v~LP~w 160 (502)
.|.++|+.+.||||+||||||++|+++++.++|||+|+|+|.++.+++.+++++ .+++||||||||+|+||+|+||+|
T Consensus 81 ~~~~~~~~~~GdKI~LPpSaL~~L~~~~~~~~~Pm~F~l~~~~~~~~~~~~~~~--~~~~th~GVlEF~A~EG~v~lP~w 158 (567)
T PLN03086 81 IFEAVSFQGNGDKIKLPPSCFTELSDQGAFDKGPLYFRLSVVHQEGSGEMKDTD--SQKTTHSGVLEFTAEEGSVGLPPH 158 (567)
T ss_pred EeeccccCCCCCeEEcCHHHHHHHHhcCCCCCCCeEEEEecccccccccccccc--CCcEEEEEEEEEEcCCCeEEcCHH
Confidence 999999999999999999999999999987899999999998776666665555 478999999999999999999999
Q ss_pred HHHhcCCCCCCCCceEEEEEEecCCcceEEEeeccCCCCCCCChHHHHHHHhccCcccccCCEEEEEECCEEEEEEEEEE
Q 010753 161 VWRNLFPSDTPNNSFVEVRYVRLPKGTYAKLQPEGIGFAELPNQKAVLETSLRQHATLSQDDVLTVNYGELAYKLKVLEL 240 (502)
Q Consensus 161 m~~~L~~~~~~~~~~V~v~~~~LPkGt~vkLqP~~~~f~di~n~KavLE~~LR~~stLT~Gd~I~I~~~~~~y~l~V~e~ 240 (502)
||++|++.+..++++|+|++++|||||||||||++.+|+||+|||||||++||||+|||+||+|.|+|+++.|+|+|+++
T Consensus 159 m~~~L~~~~~~~~~~v~v~~~~Lpkgt~vklqP~~~~f~di~npKavLE~~Lr~~stLT~Gd~i~i~~~~~~y~~~V~ev 238 (567)
T PLN03086 159 VWSNLFPSDPPDVPLVEVRYIWLPKGTYAKLQPDGVGFSDLPNHKAVLETALRQHATLSEDDVLVVNYGQLTYKLKVLEL 238 (567)
T ss_pred HHhhcCCCCCCCCCeEEEEEeecCCCCEEEEeeccCCcCCcccHHHHHHHHhhcCccccCCCEEEEecCCEEEEEEEEEE
Confidence 99999987655688999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCceEEEcCceEEeccCCCCCCCccCccccceeecCCccceeeccCceeEEEEEecccccccccCCceeEEEEEeecC
Q 010753 241 KPSSSVSVLETDIEVDIVSPDDMSAGTDQYTLKPLLFGKSESGMVEEGKYVFYKFTIDDDTRKKIVSGEKRAEVRVDSEI 320 (502)
Q Consensus 241 ~P~~aVsIidTDleVD~~~~~~~~~~~~~~~~~~l~i~~~~sg~v~~g~y~~y~l~l~~~~~~~l~~~~~~i~i~l~~~~ 320 (502)
+|++|||||||||+|||+||+++.+++++.+.++|++|+.++|+|.+|.|+||+|++++.+||+++++++.|+++++...
T Consensus 239 ~P~~aVsiieTDi~VDf~~p~~~~~~~~q~~~~~l~~~~~~~g~v~~g~y~~y~~~~~~~~~~~~~~~~~~~~~~i~~~~ 318 (567)
T PLN03086 239 KPASSVSVLETDIEVDIVGPDSVSNEENQHVLKPLEFGKSESGMVEEGNYRYYKFSIDEDTWEKVASGDARVEVKIDAET 318 (567)
T ss_pred cCCCeeEEEeCceEEEeccCCcchhcchhhhcceeecccccccceecccccceeeecccchhhhhccCCceEEEEEeecc
Confidence 99999999999999999999998877888999999999999999999999999999999999999999999999987777
Q ss_pred CCCceeEEEcCCCCCCCcccceeeccCCCCCceEEecCCCCccccceEEEEEeccCCCeeEEEEEEEecCCCCcCccccC
Q 010753 321 DGGDTSIYVSRHPLLFPTRHLHEWSSHDAGSKVVILSSKDKSVDVGTYSIGVYGFKDMTKFQVLVTLEDDSGRKVGQEAT 400 (502)
Q Consensus 321 ~~~d~DlfvS~~~~~~p~~~~h~~ss~d~~sk~i~i~~~~~~l~a~~~~i~v~~~~~~~~~~l~v~~~~~~~~~~g~~~~ 400 (502)
+++|+|||||++|+++|+.++|+|||+++++|+|+|+|+|++|+++.|||+||||+++++|+|+|++++..++..|+++.
T Consensus 319 ~~~~~dlfvS~~~~~~p~~~~h~~ss~~~~~k~l~~~~~~~~l~~~~~~i~v~~~~~~~~~~l~~~~~~~~~~~~~~~~~ 398 (567)
T PLN03086 319 SGGDTDLYVSKHPLVFPTRHQHEWSSHDMGSKVLILKSKDASLSSGTYSIGVYGFKGTTKYQVSVSVQDNNNQKVGEQAS 398 (567)
T ss_pred CCCceEEEEcccccccccccccccccCccccceeEecCCCcccccceEEEEEeccCCceeEEEEEEeecccccccccccC
Confidence 89999999999999999999999999999999999999999999999999999999999999999999988876665454
Q ss_pred CCCcccccCcccccccCcccccchHHhHhhhccCceeeccccccCcccccccccCcccCccCCCccChhhHHHhhhcccc
Q 010753 401 SSSSSIEMDTVQCKNCKRFIPSRSIVLHEAYCSRHSVACQHAGCGMVLRTEEARDHVHCDKCGQGLQRREMEKHMKVFHE 480 (502)
Q Consensus 401 ~~~~~~~~~~~~C~nC~k~~~~~~l~lHe~~C~rn~~~C~~~~Cgk~F~k~~l~~H~hC~~Cgk~f~~s~l~kH~~i~Ht 480 (502)
++++++.+...|+||+++++.++|.+|++||.||++.||+++||.+|.+.+|++||||++||++|+.+.|++|+++||.
T Consensus 399 -~~~s~~~~~V~C~NC~~~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~~s~LekH~~~~Hk 477 (567)
T PLN03086 399 -SSSSMDVDTVECRNCKHYIPSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQQGEMEKHMKVFHE 477 (567)
T ss_pred -ccccCCCCeEECCCCCCccchhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccchHHHHHHHHhcCC
Confidence 3367899999999999999999999999999999999997679999999999999999999999998899999999999
Q ss_pred eeeecCCccccccccc----ccCCC
Q 010753 481 QCSCPCGVVLENAAMV----SYCPL 501 (502)
Q Consensus 481 p~~C~Cg~~f~~~~~~----~~Cp~ 501 (502)
|+.|+||+.|.+..+. .+||.
T Consensus 478 pv~CpCg~~~~R~~L~~H~~thCp~ 502 (567)
T PLN03086 478 PLQCPCGVVLEKEQMVQHQASTCPL 502 (567)
T ss_pred CccCCCCCCcchhHHHhhhhccCCC
Confidence 9999999988776665 56764
|
|
| >KOG1816 consensus Ubiquitin fusion-degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway | Back alignment and domain information |
|---|
| >COG5140 UFD1 Ubiquitin fusion-degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3576 consensus Ovo and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3608 consensus Zn finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >KOG1074 consensus Transcriptional repressor SALM [Transcription] | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF02933 CDC48_2: Cell division protein 48 (CDC48), domain 2; InterPro: IPR004201 This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG3654 consensus Uncharacterized CH domain protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11029 FtsH protease regulator HflC; Provisional | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00247 putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05502 Dynactin_p62: Dynactin p62 family; InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein | Back alignment and domain information |
|---|
| >PF09262 PEX-1N: Peroxisome biogenesis factor 1, N-terminal ; InterPro: IPR015342 This domain adopts a double psi beta-barrel fold, similar in structure to the Cdc48 N-terminal domain | Back alignment and domain information |
|---|
| >PF06936 Selenoprotein_S: Selenoprotein S (SelS); InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3054 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >TIGR01932 hflC HflC protein | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 502 | ||||
| 2yuj_A | 190 | Solution Structure Of Human Ubiquitin Fusion Degrad | 6e-26 | ||
| 1zc1_A | 208 | Ufd1 Exhibits The Aaa-Atpase Fold With Two Distinct | 2e-22 |
| >pdb|2YUJ|A Chain A, Solution Structure Of Human Ubiquitin Fusion Degradation Protein 1 Homolog Ufd1 Length = 190 | Back alignment and structure |
|
| >pdb|1ZC1|A Chain A, Ufd1 Exhibits The Aaa-Atpase Fold With Two Distinct Ubiquitin Interaction Sites Length = 208 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 502 | |||
| 2yuj_A | 190 | Ubiquitin fusion degradation 1-like; ubiquitin-dep | 9e-51 | |
| 1zc1_A | 208 | Ubiquitin fusion degradation protein 1; UFD1, doub | 1e-48 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 1e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-04 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 8e-04 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 3e-04 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 4e-04 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 8e-04 |
| >2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
Score = 170 bits (433), Expect = 9e-51
Identities = 67/167 (40%), Positives = 90/167 (53%), Gaps = 18/167 (10%)
Query: 91 GDKIKLPPSCFTELSGQGAFDKGPLHFKLSVLHQEGPSNMEDGEKESNRSTHSGVLEFTA 150
G KI +PPS +LS P+ FKL+ K S+R TH GVLEF A
Sbjct: 40 GGKIIMPPSALDQLSRLNI--TYPMLFKLT-------------NKNSDRMTHCGVLEFVA 84
Query: 151 DEGFVGLPPHVWRNLFPSDTPNNSFVEVRYVRLPKGTYAKLQPEGIGFAELPNQKAVLET 210
DEG LP + +NL V+V V L TY+K QP+ F ++ N KAVLE
Sbjct: 85 DEGICYLPHWMMQNLL---LEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLEN 141
Query: 211 SLRQHATLSQDDVLTVNYGELAYKLKVLELKPSSSVSVLETDIEVDI 257
+LR A L+ DV+ +NY E Y+L+V+E KP +VS++E D+ VD
Sbjct: 142 ALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDF 188
|
| >1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Length = 208 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 502 | |||
| 1zc1_A | 208 | Ubiquitin fusion degradation protein 1; UFD1, doub | 100.0 | |
| 2yuj_A | 190 | Ubiquitin fusion degradation 1-like; ubiquitin-dep | 100.0 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.47 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.46 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.38 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.34 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.3 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.27 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.18 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.15 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.11 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.1 | |
| 1cz4_A | 185 | VCP-like ATPase; double-PSI beta-barrel, beta-CLAM | 99.09 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.09 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.08 | |
| 3qwz_A | 211 | Transitional endoplasmic reticulum ATPase; UBX, P9 | 99.08 | |
| 3tiw_A | 187 | Transitional endoplasmic reticulum ATPase; beta-ba | 99.08 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.07 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.06 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.02 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.0 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.99 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.99 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.98 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 98.96 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.95 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.94 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 98.93 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 98.93 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.91 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.91 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 98.91 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 98.89 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 98.88 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 98.87 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 98.86 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 98.86 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 98.84 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 98.82 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 98.82 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.82 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 98.81 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 98.8 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 98.78 | |
| 1wlf_A | 179 | PEX1, peroxisome biogenesis factor 1; N-terminal d | 98.75 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 98.75 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.66 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 98.65 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 98.59 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 98.53 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.51 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.5 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 98.47 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.46 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.45 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 98.43 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.42 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 98.41 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 98.41 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.4 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.36 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 98.34 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.33 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 98.33 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 98.32 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 98.31 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.29 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.26 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.26 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.23 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.22 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.15 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.15 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 98.14 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 98.12 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 98.07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.07 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.06 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.06 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 98.05 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.03 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 98.02 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 98.0 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.0 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 97.99 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 97.93 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 97.91 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.87 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 97.85 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 97.82 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 97.81 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.75 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.75 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 97.75 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.74 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.74 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.74 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.73 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.73 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.72 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.72 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.72 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.71 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.71 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.71 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.7 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.7 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.7 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.7 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.69 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.69 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.69 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.69 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.68 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.68 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.68 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.68 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.67 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.67 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.67 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.67 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.67 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.66 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.66 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.66 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.66 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.66 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.65 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.65 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.65 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 97.64 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.64 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.63 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.62 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.61 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.61 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.6 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.59 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 97.59 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.59 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.57 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.57 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.55 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 97.52 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 97.51 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 97.49 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.48 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.47 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.44 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.44 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.43 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 97.42 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.37 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 97.36 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 97.36 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.35 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.34 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.34 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.34 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.33 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.32 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.32 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.32 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.31 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.31 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 97.31 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 97.31 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.31 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.31 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 97.3 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.3 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.3 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.3 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.3 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.3 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 97.29 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.29 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.29 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.29 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.29 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.29 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 97.29 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.29 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.29 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.29 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.28 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.28 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.27 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.27 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.27 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.27 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.27 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.27 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.27 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.27 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.26 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.26 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.26 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.26 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.26 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.25 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.25 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.24 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.24 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.24 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.24 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.24 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.24 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.23 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.23 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.23 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.22 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.22 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.22 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.22 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.22 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.22 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.22 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.22 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.22 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.22 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 97.22 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.21 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.2 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.2 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.2 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.2 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.2 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.2 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.19 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 97.19 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.19 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.19 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.19 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.18 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.18 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.18 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.12 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 97.1 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 97.09 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.07 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 97.06 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.06 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.05 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 97.04 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 97.03 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.02 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.02 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.01 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 97.01 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 97.0 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.99 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.99 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.99 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.98 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.98 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.97 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.97 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.96 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.96 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.95 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.95 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.94 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.94 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.94 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.94 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.94 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.94 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.94 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.93 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.93 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.92 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.92 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.92 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.9 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.89 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.88 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.88 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 96.88 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.87 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 96.87 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.87 | |
| 2jv2_A | 83 | Putative uncharacterized protein PH1500; AAA ATPas | 96.86 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 96.85 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.84 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.84 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.83 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 96.83 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.81 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.8 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.8 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.8 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 96.8 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.79 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.79 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 96.73 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 96.72 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 96.65 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.65 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 96.65 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 96.63 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 96.63 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.54 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.53 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 96.45 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 96.43 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.41 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 96.36 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.33 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 96.33 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 96.32 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 96.29 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 96.26 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 96.26 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 96.19 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.18 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 96.17 | |
| 1wjv_A | 79 | Cell growth regulating nucleolar protein LYAR; DNA | 96.14 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 96.1 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 96.09 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.08 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 95.02 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.02 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.0 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 95.97 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.91 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 95.82 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.79 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.79 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 95.79 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.77 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 95.72 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.67 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.62 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 95.58 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.57 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.55 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.54 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 95.52 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.5 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 95.48 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 95.43 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 95.38 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.36 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 95.17 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 95.17 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.07 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.05 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.94 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.9 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.9 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 94.79 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 94.77 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 94.68 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.62 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 94.52 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 94.47 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.42 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.18 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.18 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.12 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.07 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 93.82 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 93.77 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 93.67 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 93.61 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 93.53 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.44 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 93.38 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 92.46 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 93.31 | |
| 2yuc_A | 76 | TNF receptor-associated factor 4; ZF-TRAF, cystein | 93.28 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.23 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.22 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.17 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.1 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.03 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 92.95 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 92.9 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.8 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 92.6 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 91.98 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 90.97 | |
| 1wjv_A | 79 | Cell growth regulating nucleolar protein LYAR; DNA | 90.83 | |
| 3jqw_A | 121 | COLH protein, collagenase; beta-barrel, dual calci | 90.69 | |
| 4ayb_P | 48 | DNA-directed RNA polymerase; transferase, multi-su | 90.34 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 90.2 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 89.66 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 88.39 | |
| 1nqj_A | 119 | Class 1 collagenase; beta sandwich, metalloproteas | 88.29 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 85.04 | |
| 1cr5_A | 189 | SEC18P (residues 22 - 210); double-PSI beta barrel | 82.98 | |
| 3tiw_A | 187 | Transitional endoplasmic reticulum ATPase; beta-ba | 80.78 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 80.63 |
| >1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-59 Score=449.03 Aligned_cols=173 Identities=37% Similarity=0.614 Sum_probs=163.8
Q ss_pred EEEEEEeeeccC-----------CCCCCeEEeChhHHHHHHcCCCCCCCceEEEEEecCCCCCCCCCCCccCCCCeEEEE
Q 010753 76 IVFYHTLEALPF-----------QGSGDKIKLPPSCFTELSGQGAFDKGPLHFKLSVLHQEGPSNMEDGEKESNRSTHSG 144 (502)
Q Consensus 76 ~~~~~~~~~~~~-----------~~~gDKIiLP~SaL~~L~~~~~~~~~Pl~F~l~n~~~~~~~~~~~~~~~~~~~th~G 144 (502)
-.|...|+++|. .+.||||+||||||++|++.++ +|||+|+|+|.. ++++||||
T Consensus 19 ~~f~~~~rc~~~~~~p~~~~r~~~~~GdKIiLP~SaL~~L~~~~i--~~Pm~F~l~n~~-------------~~~~th~G 83 (208)
T 1zc1_A 19 QTFEEFFRCYPIAMMNDRIRKDDANFGGKIFLPPSALSKLSMLNI--RYPMLFKLTANE-------------TGRVTHGG 83 (208)
T ss_dssp EEEEEEEEEEEGGGSCTTTSCHHHHHSSEEEECHHHHHHHHHTTC--CSSCCEEEECTT-------------TCCEEEEE
T ss_pred ccccceEEEEEEEeccCcccccccCCCCeEECCHHHHHHHHHCCC--CcCEEEEEEeCC-------------CCCEEEEE
Confidence 679999999872 2689999999999999999887 899999999953 57899999
Q ss_pred EeeeeeCCCceeccHHHHHhcCCCCCCCCceEEEEEEecCCcceEEEeeccCCCCCCCChHHHHHHHhccCcccccCCEE
Q 010753 145 VLEFTADEGFVGLPPHVWRNLFPSDTPNNSFVEVRYVRLPKGTYAKLQPEGIGFAELPNQKAVLETSLRQHATLSQDDVL 224 (502)
Q Consensus 145 VlEFsA~EG~v~LP~wm~~~L~~~~~~~~~~V~v~~~~LPkGt~vkLqP~~~~f~di~n~KavLE~~LR~~stLT~Gd~I 224 (502)
||||+|+||+|+||+|||++|++. +++.|+|++++|||||||||||++.+|+||+|||||||++||||+|||+||+|
T Consensus 84 VlEF~A~EG~v~lP~wmm~~L~l~---~gd~V~i~~~~LPkgt~vklqP~~~~Fldi~npKavLE~~LRnfstLT~Gd~I 160 (208)
T 1zc1_A 84 VLEFIAEEGRVYLPQWMMETLGIQ---PGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVI 160 (208)
T ss_dssp EEEECCSSCEEEECHHHHHHHTCC---TTCEEEEEEEECCCCSEEEEECCHHHHHTSSCHHHHHHHHHHHCSCEESSSEE
T ss_pred EEEEEcCCCeEEcCHHHHHhcCCC---CCCEEEEEEeEcCCCCEEEEeECccccccccCHHHHHHHHhhcCccccCCCEE
Confidence 999999999999999999999998 68899999999999999999999999999999999999999999999999999
Q ss_pred EEEECCEEEEEEEEEEcCCC---ceEEEcCceEEeccCCCCCCCc
Q 010753 225 TVNYGELAYKLKVLELKPSS---SVSVLETDIEVDIVSPDDMSAG 266 (502)
Q Consensus 225 ~I~~~~~~y~l~V~e~~P~~---aVsIidTDleVD~~~~~~~~~~ 266 (502)
.|+|+++.|+|+|++++|++ |||||||||+|||+||.+|.+.
T Consensus 161 ~i~~~~~~y~l~V~e~kP~~~~~aV~IidTDleVDf~~p~~y~ep 205 (208)
T 1zc1_A 161 EISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEP 205 (208)
T ss_dssp EEEETTEEEEEEEEEEECSSTTCEECCSSSCSEEEECCCCCCCCC
T ss_pred EEEeCCEEEEEEEEEEcCCCCCceEEEEeCceEEEecCCCCCcCC
Confidence 99999999999999999997 9999999999999999999854
|
| >2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B | Back alignment and structure |
|---|
| >3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 | Back alignment and structure |
|---|
| >3jqw_A COLH protein, collagenase; beta-barrel, dual calcium site, cell adhesion; 2.00A {Clostridium histolyticum} SCOP: b.23.2.0 PDB: 3jqx_A | Back alignment and structure |
|---|
| >4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1nqj_A Class 1 collagenase; beta sandwich, metalloprotease, collagen-binding domain, lithium, chlorine, hydrolase; 1.00A {Clostridium histolyticum} SCOP: b.23.2.1 PDB: 2o8o_A 1nqd_A | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 | Back alignment and structure |
|---|
| >3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 502 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.79 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 98.29 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.7 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 97.67 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.62 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 97.54 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.54 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.51 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.46 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 97.42 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 97.38 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 97.32 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.3 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.13 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 97.11 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.93 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.82 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.81 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 96.78 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 96.77 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 96.77 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 96.76 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.74 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.66 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.66 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 96.51 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.5 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.43 | |
| d1e32a3 | 94 | Membrane fusion atpase p97 domain 2, P97-Nc {Mouse | 96.32 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.18 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 95.5 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 95.48 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 95.44 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 95.26 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 95.17 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 94.97 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.85 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.54 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 94.51 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 94.2 | |
| d1nqja_ | 101 | Class 1 collagenase {Bacteria (Clostridium histoly | 94.17 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 93.96 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.47 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.1 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 92.8 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 92.61 | |
| d1cz5a2 | 94 | C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm | 92.18 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 92.09 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 92.04 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 91.77 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 90.99 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 90.76 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 90.3 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 90.15 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 89.77 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 89.68 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 89.02 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 88.96 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 88.76 | |
| d1wlfa1 | 80 | Peroxisome biogenesis factor 1 (PEX-1), domain 2 { | 87.92 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 84.18 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 83.51 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 83.51 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 82.9 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 82.51 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 82.47 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 82.05 | |
| d2dkta1 | 74 | RING finger and CHY zinc finger domain-containing | 80.4 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.79 E-value=1.2e-09 Score=80.96 Aligned_cols=49 Identities=18% Similarity=0.421 Sum_probs=41.3
Q ss_pred cCcccccccCcccc-cchHHhHhh-hccCceeeccccccCcccccccccCcccCccCCCccC-hhhHHHhhhc
Q 010753 408 MDTVQCKNCKRFIP-SRSIVLHEA-YCSRHSVACQHAGCGMVLRTEEARDHVHCDKCGQGLQ-RREMEKHMKV 477 (502)
Q Consensus 408 ~~~~~C~nC~k~~~-~~~l~lHe~-~C~rn~~~C~~~~Cgk~F~k~~l~~H~hC~~Cgk~f~-~s~l~kH~~i 477 (502)
+++|.| +||+.|. +.+|..|++ |.+++||.|++ ||++|. .++|..|+++
T Consensus 1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--------------------C~k~F~~~~~L~~H~r~ 52 (53)
T d2csha1 1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGV--------------------CGKKFKMKHHLVGHMKI 52 (53)
T ss_dssp CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTT--------------------TSCEESSSHHHHHHHTT
T ss_pred CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCC--------------------cCCEecCHHHHHHHHhc
Confidence 468999 5999998 599999998 88999988875 556777 7888888887
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqja_ b.23.2.1 (A:) Class 1 collagenase {Bacteria (Clostridium histolyticum) [TaxId: 1498]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|