Citrus Sinensis ID: 010770

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEYKKLLAD
ccEEEEcccccccccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEccEEcccccccccccccccEEEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEcccccccccccEEEEEcccccEEEEcccccccccccccEEEEEccEEEEEccccccccccccccccccccccccccccEEEEcccccccccccccccEEEccEEEEEcccccccccccccccccEEEEEEcccccEEEEccccccccccccEEEEEEccEEEEEcccccccccccEEEEEcccccccccccccccccccccccEEEEEcccEEEEcccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHcc
ccccEEcccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccccccEEEEEEccEEEEEEccccccccccEEEEccccccEEEEcccccccccccccEEEEEccEEEEEEccccccccccccHHcccEEEEccccccEEEccccccccccccccEEEEEccEEEEEEccccccccccHHHccccEEEEccccccEEEcccccccccccccEEEEEEccEEEEEEccccccccccEEEEcccccccEEEcccccccccccccccccEEEEEccEEccccccccccccccHccccccccccccccccccccccccEEcccEEEEEcccccccccEEEEEccccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEccccHccHccHHHHHHHHHHHHcc
mhywvrasssdfggtvpqprsghsavnigkSKVVVFGGLVDKRFLSDVVVYDIdnklwfqpectgngsngqvgpgprAFHIAVAIDCHmfifggrfgsrrlgdfwvldtdiwqwseltsfgdlpsprdfAAASAIGNRKIVMYggwdgkkwlsDVYVLDTISLEwmqlpvtgsvppprcghtaTMVEKRLLIyggrggggpimGDLWALKGlieeenetpgwtqlklpgqapssrcghtitsgGHYLLLfgghgtggwlsrydiyynDTIILDRLSAQwkrlpigneppparayhsmTCLGSLYllfggfdgkstfgdiwwlvpeedpiakrytesppkvlpenkdvgmenynsqfavkeSQRESSAIVELQKKLDIsvslsrpglqimdeLEDEEFLELASRLMGagvfsngqvSRIQATQVLRDhwkkstprsipikelgpLLRDYQRLIARHLANLqstelglpgkeaytfyhlknssqlhmVDIPKLLEEYKKLLAD
mhywvrasssdfggtvpqprsghsavnigKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSEltsfgdlpsPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQkkldisvslsrpglqiMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQvlrdhwkkstprsipikelgPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLknssqlhmvdIPKLLEEYKKLLAD
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYggrggggPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSgghylllfgghgtggwlSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMdeledeeflelASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEYKKLLAD
*************************VNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL*******RCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE**************************************************I*V*****GLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEY******
MHYWVRASSS*****VPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLP****PPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPI********************ENYNSQFAVKESQRESSAIVELQKKLDISVSL********************************************************************************************FYHLKNSSQLHMVDIPKLLEEYKKL***
**********************HSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKL********CGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFA***********VELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEYKKLLAD
**YWVRASS*DFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEYKKLLA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAGVFSNGQVSRIQATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHLANLQSTELGLPGKEAYTFYHLKNSSQLHMVDIPKLLEEYKKLLAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query501 2.2.26 [Sep-21-2011]
Q7M3S9 943 RING finger protein B OS= no no 0.473 0.251 0.285 1e-23
A8JAM0 1159 Coiled-coil domain-contai N/A no 0.349 0.150 0.342 2e-22
Q6AXB2366 Rab9 effector protein wit N/A no 0.534 0.732 0.263 1e-21
Q9V4C8 1500 Host cell factor OS=Droso yes no 0.580 0.194 0.282 3e-21
P87061 1147 Tip elongation aberrant p yes no 0.483 0.210 0.276 4e-21
P51611 2090 Host cell factor 1 OS=Mes N/A no 0.592 0.142 0.289 6e-21
Q61191 2045 Host cell factor 1 OS=Mus yes no 0.592 0.145 0.289 6e-21
P51610 2035 Host cell factor 1 OS=Hom no no 0.592 0.145 0.287 1e-20
Q5EA50372 Rab9 effector protein wit no no 0.528 0.712 0.294 9e-19
Q8RWD9648 Acyl-CoA-binding domain-c no no 0.560 0.433 0.274 1e-18
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function desciption
 Score =  111 bits (278), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 122/259 (47%), Gaps = 22/259 (8%)

Query: 14  GTVPQPRSGHSAVNIGKS--------KVVVFGGLVDKRFLSDV-VVYDIDNKLWFQPECT 64
           G  P  R GHSAV             +++ FGG    +  SD+ ++Y   N+ +   + T
Sbjct: 62  GNAPSERYGHSAVLYQSQSRPYSDSYQIIFFGGRATSKPFSDINILYVNSNRSFIWKQVT 121

Query: 65  GNGSNGQVGPGPRAFHIAVAIDCHMFIFGG--RFGSRRLGDFWVLDTDIWQWSELTSFGD 122
                G+ G      H AV    ++ +FGG     S+      +   +  +W +    G 
Sbjct: 122 TKSIEGRAG------HTAVVYRQNLVVFGGHNNHKSKYYNSVLLFSLESNEWRQQVCGGV 175

Query: 123 LPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHT 182
           +PS R   +   + N K+ ++GG+DGKK+ +D+Y LD  +  W ++   G+ P PR GH+
Sbjct: 176 IPSARATHSTFQVNNNKMFIFGGYDGKKYYNDIYYLDLETWIWKKVEAKGTPPKPRSGHS 235

Query: 183 ATMVE-KRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPG-QAPSSRCGHTI 240
           ATM++  +L+I+GG G     + D+  L   IE  NE   W Q    G + P +R  HT 
Sbjct: 236 ATMIQNNKLMIFGGCGSDSNFLNDIHILH--IEGANEYR-WEQPSYLGLEIPQARFRHTT 292

Query: 241 TSGGHYLLLFGGHGTGGWL 259
              G  + ++ G G+G  +
Sbjct: 293 NFIGGRVYIYAGTGSGNLM 311

Dictyostelium discoideum (taxid: 44689)
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 Back     alignment and function description
>sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 Back     alignment and function description
>sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 Back     alignment and function description
>sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query501
225449698507 PREDICTED: rab9 effector protein with ke 0.998 0.986 0.787 0.0
296090416509 unnamed protein product [Vitis vinifera] 0.998 0.982 0.780 0.0
255564088501 conserved hypothetical protein [Ricinus 0.990 0.990 0.782 0.0
224100649494 predicted protein [Populus trichocarpa] 0.974 0.987 0.735 0.0
356576309497 PREDICTED: acyl-CoA-binding domain-conta 0.984 0.991 0.744 0.0
334184721503 galactose oxidase/kelch repeat-containin 0.988 0.984 0.711 0.0
30686755496 galactose oxidase/kelch repeat-containin 0.976 0.985 0.714 0.0
356576311505 PREDICTED: acyl-CoA-binding domain-conta 0.984 0.976 0.732 0.0
297827115498 kelch repeat-containing protein [Arabido 0.972 0.977 0.703 0.0
334184719511 galactose oxidase/kelch repeat-containin 0.988 0.968 0.700 0.0
>gi|225449698|ref|XP_002267817.1| PREDICTED: rab9 effector protein with kelch motifs-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/508 (78%), Positives = 447/508 (87%), Gaps = 8/508 (1%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           MHYWVRAS SDF GT+PQ RSGH+AVNIGKSK+VVFGGLVDKRF+SD+ VYDI+NKLWFQ
Sbjct: 1   MHYWVRASPSDFSGTLPQRRSGHTAVNIGKSKIVVFGGLVDKRFISDLCVYDIENKLWFQ 60

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSF 120
           PECTGNGS GQVGP PRAFHIA+AIDCHMF+FGGR G +RLGDFWVLDTDIWQWSELTSF
Sbjct: 61  PECTGNGSVGQVGPSPRAFHIAIAIDCHMFVFGGRSGGKRLGDFWVLDTDIWQWSELTSF 120

Query: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCG 180
           GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDV+VLDTISLEWM+L V+GS+PPPRCG
Sbjct: 121 GDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVFVLDTISLEWMELSVSGSLPPPRCG 180

Query: 181 HTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTI 240
           HTATMVEKR+L+YGGRGGGGPIMGDLWALKGL+EEENETPGWTQLKLPGQAPS RCGHTI
Sbjct: 181 HTATMVEKRMLVYGGRGGGGPIMGDLWALKGLLEEENETPGWTQLKLPGQAPSPRCGHTI 240

Query: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCL 300
           TSGGHYLLLFGGHGTGGWLSRYDIYYN+ I+LDR+S QWKRLP  NEPPPARAYHSMTC+
Sbjct: 241 TSGGHYLLLFGGHGTGGWLSRYDIYYNECIVLDRVSVQWKRLPTSNEPPPARAYHSMTCI 300

Query: 301 GSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKE 360
           GS YLLFGGFDGKSTF D+WWLVPEEDPIAKR T SP K +PE+KD+ +    +Q + + 
Sbjct: 301 GSRYLLFGGFDGKSTFDDLWWLVPEEDPIAKRLTSSPAKNIPEDKDLAIAK-ETQLSHEA 359

Query: 361 SQRESSAIVELQKKLDISVSLSRPGLQIMDELEDEEFLELASRLMGAG--VFSNGQVSRI 418
           SQ+E SA+ EL+K+LDISVS+S P LQI+DELED+EFLELA  L+G G  V SNGQ+S  
Sbjct: 360 SQKEESAVSELRKRLDISVSISVPELQIIDELEDKEFLELALSLIGVGEKVSSNGQISHT 419

Query: 419 QATQVLRDHWKKSTPRSIPIKELGPLLRDYQRLIARHL-----ANLQSTELGLPGKEAYT 473
           QA Q LRDHW +STP+ IP+KELGPLLRDYQRLI RH      ++ Q TE    GKEAY 
Sbjct: 420 QAAQALRDHWGESTPKLIPLKELGPLLRDYQRLITRHHTGNGPSDSQFTESCFSGKEAYR 479

Query: 474 FYHLKNSSQLHMVDIPKLLEEYKKLLAD 501
           FYH+K++SQL M DIPKLL EYKKLL++
Sbjct: 480 FYHVKSASQLRMDDIPKLLAEYKKLLSN 507

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090416|emb|CBI40235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564088|ref|XP_002523042.1| conserved hypothetical protein [Ricinus communis] gi|223537725|gb|EEF39346.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224100649|ref|XP_002311962.1| predicted protein [Populus trichocarpa] gi|222851782|gb|EEE89329.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576309|ref|XP_003556275.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|334184721|ref|NP_001189691.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254150|gb|AEC09244.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30686755|ref|NP_850263.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|79324451|ref|NP_001031493.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|20260248|gb|AAM13022.1| unknown protein [Arabidopsis thaliana] gi|22136502|gb|AAM91329.1| unknown protein [Arabidopsis thaliana] gi|222423480|dbj|BAH19710.1| AT2G36360 [Arabidopsis thaliana] gi|330254146|gb|AEC09240.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254147|gb|AEC09241.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356576311|ref|XP_003556276.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|297827115|ref|XP_002881440.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327279|gb|EFH57699.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334184719|ref|NP_001189690.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] gi|330254149|gb|AEC09243.1| galactose oxidase/kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query501
UNIPROTKB|A8JAM0 1159 FAP50 "Coiled-coil domain-cont 0.343 0.148 0.337 2.6e-19
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.431 0.445 0.286 1e-18
DICTYBASE|DDB_G0272080 1523 gacHH "RhoGAP domain-containin 0.227 0.074 0.365 1.6e-18
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.433 0.230 0.284 1.3e-16
GENEDB_PFALCIPARUM|PF14_0630 889 PF14_0630 "protein serine/thre 0.429 0.241 0.272 4.4e-16
UNIPROTKB|Q8IKH5 889 PF14_0630 "Serine/threonine-pr 0.429 0.241 0.272 4.4e-16
UNIPROTKB|F1P3T0252 RABEPK "Rab9 effector protein 0.335 0.666 0.303 6.1e-16
UNIPROTKB|F1RZU3 2074 HCFC1 "Uncharacterized protein 0.435 0.105 0.316 1.2e-15
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.443 0.596 0.275 1.3e-15
UNIPROTKB|E1BGF3 2001 Bt.44379 "Uncharacterized prot 0.423 0.105 0.319 1.5e-15
UNIPROTKB|A8JAM0 FAP50 "Coiled-coil domain-containing protein lobo homolog" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 2.6e-19, P = 2.6e-19
 Identities = 61/181 (33%), Positives = 91/181 (50%)

Query:    14 GTVPQPRSGHSAV-NIGKSKVVVFGG-LVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQ 71
             G  P PR  H+A  +   +++VVFGG   +++ L+D+   D+D+  WF+P   G      
Sbjct:   344 GEKPPPRYNHAACYDEENNRLVVFGGRTAERKRLNDIYFLDLDSWTWFKPSTEGTA---- 399

Query:    72 VGPGPRAFHIAVAIDCHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAA 131
               P PR   +A      M +FGG     R  D ++LD   WQWS+    G  PSPR  A 
Sbjct:   400 --PTPREQAVATFWAGSMVLFGGHAIGGRTNDLFLLDLGAWQWSQPAFSGTAPSPRQ-AC 456

Query:   132 ASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLL 191
             A  IG+  ++   G      L D++V+D +S  W ++P  G VPPPR  H  T+   +L 
Sbjct:   457 ALCIGHGNLLFVHGGRNNFVLEDLHVMDFVSKNWTEIPCEGRVPPPRHSHRITVHRDQLY 516

Query:   192 I 192
             +
Sbjct:   517 L 517
GO:0031514 "motile cilium" evidence=IDA
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272080 gacHH "RhoGAP domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0630 PF14_0630 "protein serine/threonine phosphatase" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IKH5 PF14_0630 "Serine/threonine-protein phosphatase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3T0 RABEPK "Rab9 effector protein with kelch motifs" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZU3 HCFC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGF3 Bt.44379 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VIII0206
hypothetical protein (494 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query501
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-14
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 1e-12
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 5e-11
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-09
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 1e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 7e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-06
PLN02772398 PLN02772, PLN02772, guanylate kinase 7e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 9e-06
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-04
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 8e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.001
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.002
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.002
smart0061247 smart00612, Kelch, Kelch domain 0.003
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.004
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information 
 Score = 72.7 bits (178), Expect = 6e-14
 Identities = 66/258 (25%), Positives = 98/258 (37%), Gaps = 10/258 (3%)

Query: 59  FQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFGSRRL--GDFWVLDTDIWQWSE 116
            Q         G  GPGPR  H    +   ++ FGG          D +V D +   WS 
Sbjct: 5   LQGGWIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSI 64

Query: 117 LTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEW---MQLPVTGS 173
             + GD+P              K+ ++GG D K+  SD Y  DT+  EW    +L   G 
Sbjct: 65  APANGDVPRISCLGVRMVAVGTKLYIFGGRDEKREFSDFYSYDTVKNEWTFLTKLDEEGG 124

Query: 174 VPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPG-WTQLKLPGQAP 232
            P  R  H+    E  + ++GG   GG +M      +  IE  N   G W QL  PG+  
Sbjct: 125 -PEARTFHSMASDENHVYVFGGVSKGG-LMKTPERFR-TIEAYNIADGKWVQLPDPGENF 181

Query: 233 SSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTI-ILDRLSAQWKRLPIGNEPPPA 291
             R G         + +  G  T         Y ++ +   D  S +W  +      P A
Sbjct: 182 EKRGGAGFAVVQGKIWVVYGFATSILPGGKSDYESNAVQFFDPASGKWTEVETTGAKPSA 241

Query: 292 RAYHSMTCLGSLYLLFGG 309
           R+  +   +G   ++FGG
Sbjct: 242 RSVFAHAVVGKYIIIFGG 259

Length = 341
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 501
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 99.97
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.96
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.96
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.76
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.71
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.6
PF1396450 Kelch_6: Kelch motif 99.15
PF1396450 Kelch_6: Kelch motif 99.09
PLN02772398 guanylate kinase 98.97
PF1341549 Kelch_3: Galactose oxidase, central domain 98.89
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.88
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.85
PF1341549 Kelch_3: Galactose oxidase, central domain 98.85
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.82
PLN02772398 guanylate kinase 98.77
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.77
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.71
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.67
PF1385442 Kelch_5: Kelch motif 98.63
PF1385442 Kelch_5: Kelch motif 98.62
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.55
smart0061247 Kelch Kelch domain. 98.53
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.47
smart0061247 Kelch Kelch domain. 98.46
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.32
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.3
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.25
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.97
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.05
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.58
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.4
PF12768281 Rax2: Cortical protein marker for cell polarity 96.32
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.18
KOG2055514 consensus WD40 repeat protein [General function pr 96.07
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.77
PF12768281 Rax2: Cortical protein marker for cell polarity 95.75
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.4
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.23
PRK13684334 Ycf48-like protein; Provisional 94.99
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.94
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.46
PRK00178430 tolB translocation protein TolB; Provisional 94.46
PRK04792448 tolB translocation protein TolB; Provisional 94.13
PRK04922433 tolB translocation protein TolB; Provisional 94.12
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.79
PRK05137435 tolB translocation protein TolB; Provisional 93.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.61
PRK05137435 tolB translocation protein TolB; Provisional 93.47
PRK04792448 tolB translocation protein TolB; Provisional 93.41
PRK13684334 Ycf48-like protein; Provisional 93.39
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.08
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.94
PRK00178430 tolB translocation protein TolB; Provisional 92.76
KOG2055514 consensus WD40 repeat protein [General function pr 92.42
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.39
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.12
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 91.63
PRK03629429 tolB translocation protein TolB; Provisional 91.55
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.16
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 90.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 90.76
PRK04922433 tolB translocation protein TolB; Provisional 90.47
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.15
KOG0310487 consensus Conserved WD40 repeat-containing protein 89.52
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.2
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 88.54
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 88.52
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.37
PF09910339 DUF2139: Uncharacterized protein conserved in arch 88.02
KOG0310487 consensus Conserved WD40 repeat-containing protein 87.5
PRK04043419 tolB translocation protein TolB; Provisional 87.35
PRK03629429 tolB translocation protein TolB; Provisional 87.2
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 86.98
PF12217367 End_beta_propel: Catalytic beta propeller domain o 86.3
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 86.03
PLN00033398 photosystem II stability/assembly factor; Provisio 85.83
PLN00181793 protein SPA1-RELATED; Provisional 85.24
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.82
PRK02889427 tolB translocation protein TolB; Provisional 84.56
PRK11028330 6-phosphogluconolactonase; Provisional 84.03
PRK11028330 6-phosphogluconolactonase; Provisional 83.14
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 83.14
COG4946 668 Uncharacterized protein related to the periplasmic 81.99
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 80.85
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 80.53
PF09910339 DUF2139: Uncharacterized protein conserved in arch 80.37
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-48  Score=349.16  Aligned_cols=349  Identities=23%  Similarity=0.358  Sum_probs=291.4

Q ss_pred             CcceEEeeeCCCCCCCCCCCcCcEEEEECCcEEEEEcccCCCc-----cCCceEEEEcCCCcEEeceecC--C--CCCCC
Q 010770            1 MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKR-----FLSDVVVYDIDNKLWFQPECTG--N--GSNGQ   71 (501)
Q Consensus         1 ~~~W~~~~~~~~~g~~P~~R~~h~~~~~~~~~iyv~GG~~~~~-----~~~~v~~yd~~t~~W~~l~~~~--~--~~~~~   71 (501)
                      |+.|+---.   .   -..|.+|+++.++ ++||.|||+..+.     ..-|+.++|..+-+|+++++.-  .  ...-+
T Consensus         1 m~~WTVHLe---G---GPrRVNHAavaVG-~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp   73 (392)
T KOG4693|consen    1 MATWTVHLE---G---GPRRVNHAAVAVG-SRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYP   73 (392)
T ss_pred             CceEEEEec---C---Ccccccceeeeec-ceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCC
Confidence            677876543   2   2579999999999 7999999986543     3458999999999999988621  1  11234


Q ss_pred             CCCCCcceeEEEEeCCEEEEEccccC-CCCCCcEEEEECCCCeEEEEecCCCCCCcCCccEEEEEcCcEEEEEecCCC--
Q 010770           72 VGPGPRAFHIAVAIDCHMFIFGGRFG-SRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDG--  148 (501)
Q Consensus        72 ~~p~~R~~h~~~~~~~~iyv~GG~~~-~~~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~--  148 (501)
                      ..|-.|++|+.+.+++++||+||+++ ....|-+++||+++++|.+....+-.|.+|.+|++|++++ .+|||||+..  
T Consensus        74 ~VPyqRYGHtvV~y~d~~yvWGGRND~egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn-~MyiFGGye~~a  152 (392)
T KOG4693|consen   74 AVPYQRYGHTVVEYQDKAYVWGGRNDDEGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGN-QMYIFGGYEEDA  152 (392)
T ss_pred             ccchhhcCceEEEEcceEEEEcCccCcccccceeeeeccccccccccceeeecCCccCCceeeEECc-EEEEecChHHHH
Confidence            55778999999999999999999987 6678899999999999999988889999999999999987 9999999864  


Q ss_pred             CcccccEEEEECCCCceEEcccCCCCCCCCcceeEEEeCCEEEEEcccCCCCCc---ccccccccccccccCCCCceEEe
Q 010770          149 KKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPI---MGDLWALKGLIEEENETPGWTQL  225 (501)
Q Consensus       149 ~~~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~---~~d~~~l~~~~~Yd~~t~~W~~~  225 (501)
                      ..+.++++++|..|.+|+.+.+.|..|.-|..|+++++++.+|||||+......   .++.| .+.+..+|..|..|+..
T Consensus       153 ~~FS~d~h~ld~~TmtWr~~~Tkg~PprwRDFH~a~~~~~~MYiFGGR~D~~gpfHs~~e~Y-c~~i~~ld~~T~aW~r~  231 (392)
T KOG4693|consen  153 QRFSQDTHVLDFATMTWREMHTKGDPPRWRDFHTASVIDGMMYIFGGRSDESGPFHSIHEQY-CDTIMALDLATGAWTRT  231 (392)
T ss_pred             HhhhccceeEeccceeeeehhccCCCchhhhhhhhhhccceEEEeccccccCCCccchhhhh-cceeEEEeccccccccC
Confidence            467899999999999999999999999999999999999999999998764322   22333 36677889999999999


Q ss_pred             ecCCCCCCCceeeEEEEeCCEEEEEcCCCCCCCCcccccccCeEEEEEcCCCceEEcccCCCCCCcccceEEEEECCEEE
Q 010770          226 KLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYL  305 (501)
Q Consensus       226 ~~~g~~p~~r~~~s~~~~~~~i~v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iy  305 (501)
                      +..+-.|..|..|++.++++++|+|||+++.-     +.-++++|.|||.+..|+.+...+..|++|..++++++++++|
T Consensus       232 p~~~~~P~GRRSHS~fvYng~~Y~FGGYng~l-----n~HfndLy~FdP~t~~W~~I~~~Gk~P~aRRRqC~~v~g~kv~  306 (392)
T KOG4693|consen  232 PENTMKPGGRRSHSTFVYNGKMYMFGGYNGTL-----NVHFNDLYCFDPKTSMWSVISVRGKYPSARRRQCSVVSGGKVY  306 (392)
T ss_pred             CCCCcCCCcccccceEEEcceEEEecccchhh-----hhhhcceeecccccchheeeeccCCCCCcccceeEEEECCEEE
Confidence            87778899999999999999999999998632     5678999999999999999999999999999999999999999


Q ss_pred             EEccCCCCC--ccCcEEEecCCCCccccceecCCCCCCCCCCcccccccccceeeccccccchhhhhhhhhcCceec
Q 010770          306 LFGGFDGKS--TFGDIWWLVPEEDPIAKRYTESPPKVLPENKDVGMENYNSQFAVKESQRESSAIVELQKKLDISVS  380 (501)
Q Consensus       306 v~GG~~~~~--~~~d~w~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  380 (501)
                      +|||.....  .++.           ++.--..++..+.+.+.+++      |++.|++++++.+.+|+.+++++.+
T Consensus       307 LFGGTsP~~~~~~Sp-----------t~~~G~~~~~~LiD~SDLHv------LDF~PsLKTLa~~~Vl~~~ldqs~L  366 (392)
T KOG4693|consen  307 LFGGTSPLPCHPLSP-----------TNYNGMISPSGLIDLSDLHV------LDFAPSLKTLAMQSVLMFELDQSEL  366 (392)
T ss_pred             EecCCCCCCCCCCCc-----------cccCCCCCccccccccccee------eecChhHHHHHHHHHHHHhhhhhhc
Confidence            999976522  1111           11111334456677777777      9999999999999999999988776

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query501
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-54
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-41
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-30
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-23
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-20
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-16
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-10
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-26
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-15
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-09
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-21
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-15
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  192 bits (488), Expect = 5e-54
 Identities = 58/334 (17%), Positives = 106/334 (31%), Gaps = 36/334 (10%)

Query: 1   MHYWVRASSSDFGGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQ 60
           +    +    +     P  R        G + V   GG    R +++++   I       
Sbjct: 373 VDEDYQLLECEC----PINRKFGDVDVAG-NDVFYMGGSNPYR-VNEILQLSIHYDKIDM 426

Query: 61  PECTGNGSNGQVGPGPRAFHIAVAI--DCHMFIFGGRFGSRR-LGDFWVLDTDIWQWSEL 117
                + S     P  R  H    I  +  + + GGR    + L D W+ D    +WS +
Sbjct: 427 KNIEVSSSEV---PVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 118 TSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPP 177
                L   R   +A ++ +  +++ GG         + + +     +  +         
Sbjct: 484 ---KSLSHTRFRHSACSLPDGNVLILGGVTEG---PAMLLYNVTEEIFKDVTPKDEFFQN 537

Query: 178 RCGHTA----TMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPS 233
                      + ++ +++ GG      +       K   + EN T   T +K       
Sbjct: 538 SLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFK--YDAENATEPITVIKKLQHPLF 595

Query: 234 SRCGHTITS-GGHYLLLFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGN----EP 288
            R G  I       LL+ GG    G         N  I LD LS     +PI      + 
Sbjct: 596 QRYGSQIKYITPRKLLIVGGTSPSGLFD----RTNSIISLDPLSETLTSIPISRRIWEDH 651

Query: 289 PPARAYHSMTCL--GSLYLLFGGFDGKSTFGDIW 320
               A  S+     G+++++ GG      FG + 
Sbjct: 652 SLMLAGFSLVSTSMGTIHIIGGGATCYG-FGSVT 684
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query501
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.96
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.79
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.74
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.59
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.42
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.15
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.11
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.09
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.08
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.06
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.02
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.01
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.99
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.86
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.83
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.83
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.71
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.67
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.6
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.54
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.54
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.5
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.48
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.44
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.41
3jrp_A379 Fusion protein of protein transport protein SEC13 96.37
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.35
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.31
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.29
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.18
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.11
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.08
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.05
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.01
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.01
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.93
3jro_A 753 Fusion protein of protein transport protein SEC13 95.88
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.87
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.87
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.79
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.73
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.67
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.58
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.58
3ott_A758 Two-component system sensor histidine kinase; beta 95.5
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.45
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.44
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.41
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.41
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.32
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.29
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.28
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.27
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.21
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.18
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.17
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.14
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.12
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.11
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.11
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.0
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.92
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.86
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.84
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.75
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 94.73
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.7
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.69
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.68
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.62
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.59
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 94.56
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.53
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.51
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.48
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.43
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 94.39
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.36
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.34
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.32
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.29
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.28
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.1
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.04
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.04
3jrp_A379 Fusion protein of protein transport protein SEC13 94.03
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.01
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.97
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.93
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.89
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.87
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.85
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.74
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.7
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 93.54
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 93.48
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.44
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.37
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.32
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.31
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.2
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 93.08
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 92.75
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.73
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.63
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.62
2pm7_B297 Protein transport protein SEC13, protein transport 92.54
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.53
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.37
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 92.36
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.31
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 92.2
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 92.06
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 91.75
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 91.56
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.46
3jro_A 753 Fusion protein of protein transport protein SEC13 91.41
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 91.38
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 91.14
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.13
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 91.02
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.73
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.68
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.64
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.58
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.44
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 90.27
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.27
3ott_A 758 Two-component system sensor histidine kinase; beta 90.25
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 89.97
2fp8_A322 Strictosidine synthase; six bladed beta propeller 89.91
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 89.89
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 89.89
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 89.83
2xyi_A430 Probable histone-binding protein CAF1; transcripti 89.82
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.61
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.5
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 89.48
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 89.45
4e54_B435 DNA damage-binding protein 2; beta barrel, double 89.43
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 89.33
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 89.31
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 89.2
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 89.11
1itv_A195 MMP9; adaptive molecular recognition, beta propell 88.85
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 88.64
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 88.37
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 88.03
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 87.68
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 87.68
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 87.57
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 87.32
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 87.17
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.03
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.63
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 86.32
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 86.32
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.24
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.16
1itv_A195 MMP9; adaptive molecular recognition, beta propell 86.15
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 86.11
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 86.1
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.31
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.28
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 85.07
2p4o_A306 Hypothetical protein; putative lactonase, structur 84.93
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 84.87
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.68
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 84.03
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 83.61
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 83.28
2xyi_A430 Probable histone-binding protein CAF1; transcripti 82.99
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 82.92
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 82.86
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 82.27
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 82.13
2pm7_B297 Protein transport protein SEC13, protein transport 81.9
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 81.56
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 80.48
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 80.32
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=3e-46  Score=369.14  Aligned_cols=288  Identities=18%  Similarity=0.246  Sum_probs=244.0

Q ss_pred             CCCCCCCCcCcEEEEECCcEEEEEcccCCCccCCceEEEEcCCCcEEeceecCCCCCCCCCCCCcceeEEEEeCCEEEEE
Q 010770           13 GGTVPQPRSGHSAVNIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIF   92 (501)
Q Consensus        13 ~g~~P~~R~~h~~~~~~~~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~l~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~   92 (501)
                      .++.|.+|.+|+++.++ ++||+|||. ....++++++||+.+++|..++         ++|.+|.+|++++++++||++
T Consensus         8 ~~~~~~~~~~~~~~~~~-~~i~v~GG~-~~~~~~~~~~~d~~~~~W~~~~---------~~p~~r~~~~~~~~~~~lyv~   76 (308)
T 1zgk_A            8 HHSSGLVPRGSHAPKVG-RLIYTAGGY-FRQSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAV   76 (308)
T ss_dssp             -------------CCCC-CCEEEECCB-SSSBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEE
T ss_pred             cccCCeeeCCccccCCC-CEEEEEeCc-CCCCcceEEEEcCCCCeEeECC---------CCCcccccceEEEECCEEEEE
Confidence            35678899999999998 799999999 5677899999999999999985         478899999999999999999


Q ss_pred             ccc----cCCCCCCcEEEEECCCCeEEEEecCCCCCCcCCccEEEEEcCcEEEEEecCCCCcccccEEEEECCCCceEEc
Q 010770           93 GGR----FGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQL  168 (501)
Q Consensus        93 GG~----~~~~~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~t~~W~~~  168 (501)
                      ||.    .+...++++++||+.+++|+++++   +|.+|..|++++++ ++||++||.+.....+++++||+.+++|+.+
T Consensus        77 GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~-~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~  152 (308)
T 1zgk_A           77 GGRNNSPDGNTDSSALDCYNPMTNQWSPCAP---MSVPRNRIGVGVID-GHIYAVGGSHGCIHHNSVERYEPERDEWHLV  152 (308)
T ss_dssp             CCEEEETTEEEECCCEEEEETTTTEEEECCC---CSSCCBTCEEEEET-TEEEEECCEETTEECCCEEEEETTTTEEEEC
T ss_pred             CCCcCCCCCCeecceEEEECCCCCeEeECCC---CCcCccccEEEEEC-CEEEEEcCCCCCcccccEEEECCCCCeEeEC
Confidence            998    555678999999999999999984   99999999999995 4999999998877889999999999999999


Q ss_pred             ccCCCCCCCCcceeEEEeCCEEEEEcccCCCCCcccccccccccccccCCCCceEEeecCCCCCCCceeeEEEEeCCEEE
Q 010770          169 PVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLL  248 (501)
Q Consensus       169 ~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~d~~~l~~~~~Yd~~t~~W~~~~~~g~~p~~r~~~s~~~~~~~i~  248 (501)
                      +   ++|.+|.+|++++++++|||+||.....       .++.+++||+.+++|+.++   .+|.+|..|+++..+++||
T Consensus       153 ~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~-------~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~iy  219 (308)
T 1zgk_A          153 A---PMLTRRIGVGVAVLNRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIY  219 (308)
T ss_dssp             C---CCSSCCBSCEEEEETTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEE
T ss_pred             C---CCCccccceEEEEECCEEEEEeCCCCCC-------cCceEEEEeCCCCeEeeCC---CCCCccccceEEEECCEEE
Confidence            8   8999999999999999999999987654       2577888999999999997   7899999999999999999


Q ss_pred             EEcCCCCCCCCcccccccCeEEEEEcCCCceEEcccCCCCCCcccceEEEEECCEEEEEccCCCCCccCcEEEecCCCCc
Q 010770          249 LFGGHGTGGWLSRYDIYYNDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDP  328 (501)
Q Consensus       249 v~GG~~~~~~~~~~~~~~~~v~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~d~w~~~~~~d~  328 (501)
                      ++||.+...       ..+++++||+.+++|+.++.   .|.+|..|++++++++|||+||.++...++++|.|+    +
T Consensus       220 v~GG~~~~~-------~~~~v~~yd~~~~~W~~~~~---~p~~r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~yd----~  285 (308)
T 1zgk_A          220 AAGGYDGQD-------QLNSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYD----P  285 (308)
T ss_dssp             EECCBCSSS-------BCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEE----T
T ss_pred             EEeCCCCCC-------ccceEEEEeCCCCcEEECCC---CCCCccceEEEEECCEEEEEcCcCCCcccceEEEEc----C
Confidence            999987532       57899999999999999986   467999999999999999999998877788888655    5


Q ss_pred             cccceecCCCCCCC
Q 010770          329 IAKRYTESPPKVLP  342 (501)
Q Consensus       329 ~~~~w~~~~~~~~~  342 (501)
                      .+++|+..+..+.+
T Consensus       286 ~~~~W~~~~~~p~~  299 (308)
T 1zgk_A          286 DTDTWSEVTRMTSG  299 (308)
T ss_dssp             TTTEEEEEEECSSC
T ss_pred             CCCEEeecCCCCCC
Confidence            58889877544433
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 501
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-12
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-09
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-07
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 63.8 bits (153), Expect = 8e-12
 Identities = 42/301 (13%), Positives = 89/301 (29%), Gaps = 34/301 (11%)

Query: 27  NIGKSKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAID 86
            +G+  +   GG   ++ LS +  Y+  N  W +               PR+      + 
Sbjct: 2   KVGR-LIYTAGGY-FRQSLSYLEAYNPSNGTWLR---------LADLQVPRSGLAGCVVG 50

Query: 87  CHMFIFGGRFGSRRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGW 146
             ++  GGR  S          + +  ++ +T+     +P                    
Sbjct: 51  GLLYAVGGRNNSPDGNTDS---SALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAV 107

Query: 147 DGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMVEKRLLIYGGRGGGGPIMGDL 206
            G         ++    E  +  +   +   R G    ++ + L   GG           
Sbjct: 108 GGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF---------- 157

Query: 207 WALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY 266
                L   E   P   + ++     + R G  +    + +   GG+     L+  + Y 
Sbjct: 158 DGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD 217

Query: 267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEE 326
            +T     ++    R          R+   +T       + GG+DG +    +    P+ 
Sbjct: 218 VETETWTFVAPMKHR----------RSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDT 267

Query: 327 D 327
           D
Sbjct: 268 D 268
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query501
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.98
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.36
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.98
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.92
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.53
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.29
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.1
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.56
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.54
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.42
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.16
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.03
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.73
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 92.6
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 92.32
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 91.39
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 90.98
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.62
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.47
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 90.12
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 89.71
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.7
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 89.6
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 88.14
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.71
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 87.64
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 87.35
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 87.1
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 86.54
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 86.35
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 85.94
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 85.43
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.81
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 83.64
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 83.49
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 83.18
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 82.86
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 80.13
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.2e-39  Score=313.31  Aligned_cols=272  Identities=18%  Similarity=0.252  Sum_probs=238.8

Q ss_pred             cEEEEEcccCCCccCCceEEEEcCCCcEEeceecCCCCCCCCCCCCcceeEEEEeCCEEEEEccccC----CCCCCcEEE
Q 010770           31 SKVVVFGGLVDKRFLSDVVVYDIDNKLWFQPECTGNGSNGQVGPGPRAFHIAVAIDCHMFIFGGRFG----SRRLGDFWV  106 (501)
Q Consensus        31 ~~iyv~GG~~~~~~~~~v~~yd~~t~~W~~l~~~~~~~~~~~~p~~R~~h~~~~~~~~iyv~GG~~~----~~~~~~~~~  106 (501)
                      +.||||||... ..++++++||+.+++|+.++         ++|.+|.+|++++++++|||+||...    ...++++++
T Consensus         5 ~~iyv~GG~~~-~~~~~~~~yd~~t~~W~~~~---------~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~   74 (288)
T d1zgka1           5 RLIYTAGGYFR-QSLSYLEAYNPSNGTWLRLA---------DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDC   74 (288)
T ss_dssp             CCEEEECCBSS-SBCCCEEEEETTTTEEEECC---------CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEE
T ss_pred             CEEEEECCcCC-CCCceEEEEECCCCeEEECC---------CCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhh
Confidence            68999999864 57899999999999999986         57899999999999999999999853    345789999


Q ss_pred             EECCCCeEEEEecCCCCCCcCCccEEEEEcCcEEEEEecCCCCcccccEEEEECCCCceEEcccCCCCCCCCcceeEEEe
Q 010770          107 LDTDIWQWSELTSFGDLPSPRDFAAASAIGNRKIVMYGGWDGKKWLSDVYVLDTISLEWMQLPVTGSVPPPRCGHTATMV  186 (501)
Q Consensus       107 yd~~t~~W~~~~~~~~~p~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~t~~W~~~~~~~~~p~~r~~~~~~~~  186 (501)
                      ||+.+++|+++++   +|.+|..|+++++++ +||++||.......++.+.||+.+++|....   .++.+|.+|+++.+
T Consensus        75 yd~~~~~w~~~~~---~p~~r~~~~~~~~~~-~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~~  147 (288)
T d1zgka1          75 YNPMTNQWSPCAP---MSVPRNRIGVGVIDG-HIYAVGGSHGCIHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAVL  147 (288)
T ss_dssp             EETTTTEEEECCC---CSSCCBTCEEEEETT-EEEEECCEETTEECCCEEEEETTTTEEEECC---CCSSCCBSCEEEEE
T ss_pred             ccccccccccccc---ccceecceeccccce-eeEEecceecccccceeeeeccccCcccccc---ccccccccceeeee
Confidence            9999999999874   999999999999955 9999999988888999999999999999887   88899999999999


Q ss_pred             CCEEEEEcccCCCCCcccccccccccccccCCCCceEEeecCCCCCCCceeeEEEEeCCEEEEEcCCCCCCCCccccccc
Q 010770          187 EKRLLIYGGRGGGGPIMGDLWALKGLIEEENETPGWTQLKLPGQAPSSRCGHTITSGGHYLLLFGGHGTGGWLSRYDIYY  266 (501)
Q Consensus       187 ~~~lyv~GG~~~~~~~~~d~~~l~~~~~Yd~~t~~W~~~~~~g~~p~~r~~~s~~~~~~~i~v~GG~~~~~~~~~~~~~~  266 (501)
                      ++++|++||.....       .++.++.||+.+++|....   ..+..+..++++..+++|+++||....       ...
T Consensus       148 ~~~~~~~GG~~~~~-------~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~i~i~GG~~~~-------~~~  210 (288)
T d1zgka1         148 NRLLYAVGGFDGTN-------RLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNCIYAAGGYDGQ-------DQL  210 (288)
T ss_dssp             TTEEEEECCBCSSC-------BCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCBCSS-------SBC
T ss_pred             eecceEecCccccc-------ccceEEEeecccccccccc---ccccccccccccceeeeEEEecCcccc-------ccc
Confidence            99999999986543       3467788999999999887   677888999999999999999998764       367


Q ss_pred             CeEEEEEcCCCceEEcccCCCCCCcccceEEEEECCEEEEEccCCCCCccCcEEEecCCCCccccceecCCCCCCCC
Q 010770          267 NDTIILDRLSAQWKRLPIGNEPPPARAYHSMTCLGSLYLLFGGFDGKSTFGDIWWLVPEEDPIAKRYTESPPKVLPE  343 (501)
Q Consensus       267 ~~v~~yd~~~~~W~~v~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~d~w~~~~~~d~~~~~w~~~~~~~~~~  343 (501)
                      ++++.||+.+++|..++.   .|.+|..|+++.++++||||||.++...++++|.|    |+.+++|+...+.+.++
T Consensus       211 ~~~~~~~~~~~~~~~~~~---~p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~y----d~~~~~W~~~~~~p~~R  280 (288)
T d1zgka1         211 NSVERYDVETETWTFVAP---MKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECY----DPDTDTWSEVTRMTSGR  280 (288)
T ss_dssp             CCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEE----ETTTTEEEEEEECSSCC
T ss_pred             cceeeeeecceeeecccC---ccCcccceEEEEECCEEEEEecCCCCeecceEEEE----ECCCCEEEECCCCCCCc
Confidence            899999999999999986   46799999999999999999999988888998865    55588999885444443
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure