Citrus Sinensis ID: 010799


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-
MAAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLLEISGKITSAENVDSAKKTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGGSKVEKQLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQDEVDEESSLDDLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccccccccEEEEHHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHccccccccccccccccEEccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHccccccccccEEEEEcccHHHHHHccccccccccccccHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHccEccccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccHHHHccccEEEEEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccccccEEEEEEccHHHHHHccccccccHHccccHHHHHHHHHHHccccccccccccccccccHcHHHccccccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccccccccEEEEEEccHHHHHHcccccccEccccccHHHHHHHHHHHccc
MAAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLLEISGKItsaenvdsakktGILDLNKEVNKLADFLIRSHSSLFTISVVDVAgsvmttdlwksyecetvkeyfqcrawvpvpeelERRELVTDILKQvggskvekqldpQKKLRKLFTENRYLVVIINARTPDIWDILKylfpnssngsrVILSFQEADAARCRnmsffggessfkpkYIAYAAseddggnddralpkqvpdeeiSEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYEssytkknfpcrawanvyvsqdfdmRSVFADILRQLTQdevdeesslddleseFTGILYEKRYLVVLddvhspgawydlkrifspqaspigsrVILITREAyvarsfspsiflhqlrplneeesGKLFQRRLKA
maaeativpvvrilkelsrekfedeglvaqlinsseeLEKVRKSWEEKeindvspkllnaVSQVQDITDTFRIENCKRVYLGVislrsstvqarfRKKIKELVSGIREESEKMLLEISgkitsaenvdsakkTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILkqvggskvekqldpqkklrklftenrYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSffggessfkPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVagaagsgktALVKTIYESsytkknfpcrAWANVYVSQDFDMRSVFADILRQLTqdevdeesslddlESEFTGILYEKRYLVVLDDVHSPGAWYDLkrifspqaspigSRVILITREAYVARSFSpsiflhqlrplneeesgklfqrrlka
MAAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLLEISGKITSAENVDSAKKTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGGSKVEKQLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQdevdeesslddleseFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
*****TIVPVVRILKELSREKFEDEGLVAQLI********************VSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGI*******LLEI**************KTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGG***********KLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAY***************************TAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLT************LESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQL******************
MAAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVS******************************ILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQV************KKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILR****************ESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
MAAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLLEISGKITSAENVDSAKKTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGGSKVEKQLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQD**********LESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
*AAEATIVPVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLL************D*AK*TGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGGSKVEKQLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGN*********PDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQDEVDEESSLDDLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAEATIVPVVRILKELSREKFEDEGLxxxxxxxxxxxxxxxxxxxxxEINDVSPKLLNAVSQVQDITDTFRIENCKRVYLGVISLRSSTVQARFRKKIKELVSGIREESEKMLLEISGKITSAENVDSAKKTGILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECETVKEYFQCRAWVPVPEELERRELVTDILKQVGGSKVEKQLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPKYIAYAASEDDGGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADIxxxxxxxxxxxxxxxxxxxxxFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQRRLKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query501 2.2.26 [Sep-21-2011]
Q9M667 835 Disease resistance protei yes no 0.385 0.231 0.354 9e-22
Q9STE7 847 Putative disease resistan no no 0.339 0.200 0.384 2e-20
Q9SX38 857 Putative disease resistan no no 0.335 0.196 0.352 3e-16
Q9STE5 847 Putative disease resistan no no 0.307 0.181 0.35 7e-15
Q9LQ54 870 Probable disease resistan no no 0.335 0.193 0.293 5e-14
P0DI16 1017 Probable disease resistan no no 0.411 0.202 0.285 6e-13
F4IBE4 1017 Probable disease resistan no no 0.411 0.202 0.285 6e-13
P0DI18 1049 Probable disease resistan no no 0.409 0.195 0.288 9e-13
P0DI17 1049 Probable disease resistan no no 0.409 0.195 0.288 9e-13
Q9FJB5 901 Disease resistance RPP8-l no no 0.287 0.159 0.322 2e-12
>sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 104/203 (51%), Gaps = 10/203 (4%)

Query: 302 GGNDDRALPKQVPDEEISEEVTAVVSMENDILKLAKLTLNSSDKN-FLISVAGAAGSGKT 360
           GGN      +Q+      ++   VV +E+D   L +  L+  +KN F+IS+ G  G GKT
Sbjct: 140 GGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILLEKLLDYEEKNRFIISIFGMGGLGKT 199

Query: 361 ALVKTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQDEVDEESSL-----D 415
           AL + +Y S   K+ F  RAW   YVSQ++    +   I+R L     +E   +     +
Sbjct: 200 ALARKLYNSRDVKERFEYRAWT--YVSQEYKTGDILMRIIRSLGMTSGEELEKIRKFAEE 257

Query: 416 DLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFS 475
           +LE    G+L  K+YLVV+DD+    AW  LKR         GSRVI+ TR   VA    
Sbjct: 258 ELEVYLYGLLEGKKYLVVVDDIWEREAWDSLKRALPCNHE--GSRVIITTRIKAVAEGVD 315

Query: 476 PSIFLHQLRPLNEEESGKLFQRR 498
              + H+LR L  EES +LF++R
Sbjct: 316 GRFYAHKLRFLTFEESWELFEQR 338




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to other resistance proteins, it works independently of ESD1 and NSD1 proteins and does not require the accumulation of salicylic acid, suggesting the existence of an independent signaling pathway. The specificity to avirulence proteins differs in the different cultivars.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description
>sp|Q9STE5|R13L2_ARATH Putative disease resistance RPP13-like protein 2 OS=Arabidopsis thaliana GN=RPP13L2 PE=3 SV=1 Back     alignment and function description
>sp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g59620 OS=Arabidopsis thaliana GN=At1g59620 PE=2 SV=3 Back     alignment and function description
>sp|P0DI16|DRL44_ARATH Probable disease resistance protein RDL5 OS=Arabidopsis thaliana GN=RDL5 PE=1 SV=1 Back     alignment and function description
>sp|F4IBE4|DRL10_ARATH Probable disease resistance protein RF45 OS=Arabidopsis thaliana GN=RF45 PE=1 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query501
255544065 936 Disease resistance protein RPM1, putativ 0.395 0.211 0.410 2e-27
255544075 884 Disease resistance protein RPM1, putativ 0.357 0.202 0.4 2e-26
357135028 1220 PREDICTED: disease resistance protein RP 0.792 0.325 0.259 2e-21
297819252 829 hypothetical protein ARALYDRAFT_323301 [ 0.385 0.232 0.348 2e-21
356538242 912 PREDICTED: disease resistance RPP8-like 0.397 0.218 0.347 8e-21
125562371585 hypothetical protein OsI_30077 [Oryza sa 0.616 0.528 0.273 9e-21
93211069 842 disease resistance protein RPP13 variant 0.385 0.229 0.359 2e-20
224566960 842 disease resistance protein RPP13 variant 0.385 0.229 0.359 2e-20
46410165 842 disease resistance protein RPP13 variant 0.385 0.229 0.359 2e-20
224566976 830 disease resistance protein RPP13 variant 0.385 0.232 0.354 2e-20
>gi|255544065|ref|XP_002513095.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223548106|gb|EEF49598.1| Disease resistance protein RPM1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 120/207 (57%), Gaps = 9/207 (4%)

Query: 299 EDDGGNDDRALPKQVPD-EEISEEVTAVVSMENDILKLAKLTLNSSDK---NFLISVAGA 354
           E++ G+  R  PK+     +  +E   +V +E+    L +L L+   +   + +I+V GA
Sbjct: 141 EEENGSQSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGA 200

Query: 355 AGSGKTALVKTIYES-SYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQDEVDEESS 413
           AGSGKT LVK IY      K++F C AW NV  S++F  R V   ILRQ+++   +E  S
Sbjct: 201 AGSGKTTLVKFIYNRVQEVKQHFECCAWVNV--SEEFQERDVLISILRQISEVTEEETLS 258

Query: 414 LDDLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARS 473
           L+ L       L  + YL+VLDD+HS  AW  LK  FS   S +GSRVIL  R   VARS
Sbjct: 259 LEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFS--TSVMGSRVILTMRSIEVARS 316

Query: 474 FSPSIFLHQLRPLNEEESGKLFQRRLK 500
            +P I L Q+RPLN +ES +LF ++L+
Sbjct: 317 LTPWISLFQIRPLNPQESWQLFLQKLR 343




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255544075|ref|XP_002513100.1| Disease resistance protein RPM1, putative [Ricinus communis] gi|223548111|gb|EEF49603.1| Disease resistance protein RPM1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357135028|ref|XP_003569114.1| PREDICTED: disease resistance protein RPM1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|297819252|ref|XP_002877509.1| hypothetical protein ARALYDRAFT_323301 [Arabidopsis lyrata subsp. lyrata] gi|297323347|gb|EFH53768.1| hypothetical protein ARALYDRAFT_323301 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356538242|ref|XP_003537613.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|125562371|gb|EAZ07819.1| hypothetical protein OsI_30077 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|93211069|gb|ABF00977.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224566960|gb|ACN56771.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|46410165|gb|AAS93942.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] gi|46410167|gb|AAS93943.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] gi|46410169|gb|AAS93944.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] gi|93211063|gb|ABF00974.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] gi|224566940|gb|ACN56761.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224566976|gb|ACN56779.1| disease resistance protein RPP13 variant [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query501
TAIR|locus:504956483 847 AT3G46730 [Arabidopsis thalian 0.367 0.217 0.365 1.9e-20
TAIR|locus:2075170 835 RPP13 "RECOGNITION OF PERONOSP 0.385 0.231 0.344 6.8e-18
TAIR|locus:2102857 847 AT3G46710 [Arabidopsis thalian 0.367 0.217 0.322 1.3e-13
TAIR|locus:2011982 857 AT1G50180 [Arabidopsis thalian 0.335 0.196 0.318 3.7e-11
TAIR|locus:2077572 926 RPM1 "RESISTANCE TO P. SYRINGA 0.383 0.207 0.281 8.4e-10
TAIR|locus:2169523 901 AT5G35450 [Arabidopsis thalian 0.375 0.208 0.295 3.7e-09
TAIR|locus:2176486 908 RPP8 "RECOGNITION OF PERONOSPO 0.361 0.199 0.291 3.7e-09
TAIR|locus:2197409 727 LOV1 "LOCUS ORCHESTRATING VICT 0.361 0.248 0.281 9.6e-09
TAIR|locus:2152536 908 AT5G48620 [Arabidopsis thalian 0.361 0.199 0.286 1.3e-08
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.411 0.202 0.263 5.3e-08
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 1.9e-20, P = 1.9e-20
 Identities = 73/200 (36%), Positives = 104/200 (52%)

Query:   307 RALPKQVPDEEISEEVTAVVSMENDI-LKLAKLTL-NSSDKNFLISVAGAAGSGKTALVK 364
             R L +  P ++  EE+  VV +E+D+ + L KL   N  DK+++IS+ G  G GKTAL +
Sbjct:   148 RQLRRAPPVDQ--EEL--VVGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALAR 203

Query:   365 TIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQL------TQXXXXXXXXXXXXX 418
              +Y S   K+ F CRAW   YVSQ++  R +   I+R L                     
Sbjct:   204 KLYNSGDVKRRFDCRAWT--YVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELE 261

Query:   419 XXFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSFSPSI 478
                 G+L  K Y+VV+DDV  P AW  LKR   P     GS+VI+ TR   +A     ++
Sbjct:   262 VYLYGLLEGKNYMVVVDDVWDPDAWESLKRAL-P-CDHRGSKVIITTRIRAIAEGVEGTV 319

Query:   479 FLHQLRPLNEEESGKLFQRR 498
             + H+LR L  EES  LF+R+
Sbjct:   320 YAHKLRFLTFEESWTLFERK 339


GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197409 LOV1 "LOCUS ORCHESTRATING VICTORIN EFFECTS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh1_pm.C_scaffold_5000845
annotation not avaliable (829 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query501
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 4e-20
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-10
pfam13401124 pfam13401, AAA_22, AAA domain 2e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 2e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 90.1 bits (224), Expect = 4e-20
 Identities = 56/173 (32%), Positives = 80/173 (46%), Gaps = 11/173 (6%)

Query: 329 ENDILKLAKLTLNSSDKNFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRAWANVYVSQ 388
           E+ I  L +  L  SD   ++ + G  G GKT L K IY       +F   AW  V VS+
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAW--VVVSK 59

Query: 389 DFDMRSVFADILRQLTQDEVDEESSLDDLESEFTGILYE----KRYLVVLDDVHSPGAWY 444
            +    +  DIL++L     D+   ++  ESE    + E    KR+L+VLDDV     W 
Sbjct: 60  TYTEFRLQKDILQELGL---DDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKNDWD 116

Query: 445 DLKRIFSPQASPIGSRVILITREAYVARSFSPSIFLHQLRPLNEEESGKLFQR 497
            +   F    +  GSRVI+ TR   VA     +   H++  L  EES +LF  
Sbjct: 117 KIGVPFPDGEN--GSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSN 167


Length = 285

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 501
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.92
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.9
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.29
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 99.22
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.16
PF05729166 NACHT: NACHT domain 99.15
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.03
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.0
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 98.94
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.9
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 98.85
CHL00095 821 clpC Clp protease ATP binding subunit 98.83
PRK06893229 DNA replication initiation factor; Validated 98.81
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.81
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.8
PRK13342 413 recombination factor protein RarA; Reviewed 98.79
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.76
PF13173128 AAA_14: AAA domain 98.74
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.69
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.69
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.67
PRK12402 337 replication factor C small subunit 2; Reviewed 98.67
PTZ00202 550 tuzin; Provisional 98.66
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.65
KOG2028 554 consensus ATPase related to the helicase subunit o 98.65
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.63
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.62
PRK04841 903 transcriptional regulator MalT; Provisional 98.61
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.6
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.6
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.6
cd01128249 rho_factor Transcription termination factor rho is 98.58
PF05729166 NACHT: NACHT domain 98.58
PRK13341 725 recombination factor protein RarA/unknown domain f 98.57
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.57
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.57
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.57
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.56
PRK08727233 hypothetical protein; Validated 98.56
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.55
PLN03025 319 replication factor C subunit; Provisional 98.55
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.54
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.54
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.52
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.52
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.51
PRK09376416 rho transcription termination factor Rho; Provisio 98.49
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.49
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 98.49
PRK09302509 circadian clock protein KaiC; Reviewed 98.48
PRK05564 313 DNA polymerase III subunit delta'; Validated 98.48
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.47
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.46
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.46
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.46
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.45
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.45
PRK04195 482 replication factor C large subunit; Provisional 98.44
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.43
PRK08084235 DNA replication initiation factor; Provisional 98.41
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.41
PHA02544 316 44 clamp loader, small subunit; Provisional 98.39
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.39
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.38
PTZ00202550 tuzin; Provisional 98.38
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.38
PRK09112 351 DNA polymerase III subunit delta'; Validated 98.38
PF13173128 AAA_14: AAA domain 98.38
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.38
PRK03992389 proteasome-activating nucleotidase; Provisional 98.37
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.37
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.37
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.36
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.36
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.35
COG0488530 Uup ATPase components of ABC transporters with dup 98.35
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.32
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.32
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.32
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.32
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.31
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.31
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.31
PRK09087226 hypothetical protein; Validated 98.3
PRK05642234 DNA replication initiation factor; Validated 98.3
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.3
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.29
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.29
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.25
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.25
TIGR00767415 rho transcription termination factor Rho. Members 98.22
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.21
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.21
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.21
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.21
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.2
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.19
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.19
cd01128249 rho_factor Transcription termination factor rho is 98.19
CHL00095 821 clpC Clp protease ATP binding subunit 98.18
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.17
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.17
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.16
CHL00181287 cbbX CbbX; Provisional 98.15
PRK12422 445 chromosomal replication initiation protein; Provis 98.15
COG1123539 ATPase components of various ABC-type transport sy 98.14
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.14
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.14
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.14
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.14
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.13
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.12
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.12
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.11
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.11
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.11
PRK14087 450 dnaA chromosomal replication initiation protein; P 98.11
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.1
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.1
PRK05564313 DNA polymerase III subunit delta'; Validated 98.07
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.07
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.05
PRK10865 857 protein disaggregation chaperone; Provisional 98.05
PRK06620214 hypothetical protein; Validated 98.03
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.03
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 98.02
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.02
PRK07399 314 DNA polymerase III subunit delta'; Validated 98.01
PRK13409590 putative ATPase RIL; Provisional 97.99
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.98
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.97
CHL00176 638 ftsH cell division protein; Validated 97.97
PRK04841 903 transcriptional regulator MalT; Provisional 97.97
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 97.96
PRK13342413 recombination factor protein RarA; Reviewed 97.96
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 97.95
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.95
PRK11288501 araG L-arabinose transporter ATP-binding protein; 97.94
PRK14086 617 dnaA chromosomal replication initiation protein; P 97.93
PRK08058 329 DNA polymerase III subunit delta'; Validated 97.93
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 97.92
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.91
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.9
smart00382148 AAA ATPases associated with a variety of cellular 97.88
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.86
PF00004132 AAA: ATPase family associated with various cellula 97.86
PRK09376416 rho transcription termination factor Rho; Provisio 97.85
PRK08116268 hypothetical protein; Validated 97.84
PRK05707 328 DNA polymerase III subunit delta'; Validated 97.84
PRK11147 635 ABC transporter ATPase component; Reviewed 97.82
PRK12377248 putative replication protein; Provisional 97.8
CHL00195489 ycf46 Ycf46; Provisional 97.78
COG0593 408 DnaA ATPase involved in DNA replication initiation 97.77
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.77
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.77
KOG0927614 consensus Predicted transporter (ABC superfamily) 97.76
PRK08181269 transposase; Validated 97.75
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.75
TIGR00767415 rho transcription termination factor Rho. Members 97.75
KOG2028554 consensus ATPase related to the helicase subunit o 97.71
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.71
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.7
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.7
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 97.69
PRK06526254 transposase; Provisional 97.69
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.68
PRK03003 472 GTP-binding protein Der; Reviewed 97.68
PRK04195 482 replication factor C large subunit; Provisional 97.68
COG3903 414 Predicted ATPase [General function prediction only 97.67
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.67
PRK10762501 D-ribose transporter ATP binding protein; Provisio 97.67
PRK06893229 DNA replication initiation factor; Validated 97.65
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.64
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.63
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.62
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.61
PRK07952244 DNA replication protein DnaC; Validated 97.6
PRK10536262 hypothetical protein; Provisional 97.59
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.59
PRK12402337 replication factor C small subunit 2; Reviewed 97.57
KOG1514 767 consensus Origin recognition complex, subunit 1, a 97.57
PRK13531 498 regulatory ATPase RavA; Provisional 97.56
PRK13341 725 recombination factor protein RarA/unknown domain f 97.56
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.55
PRK10865 857 protein disaggregation chaperone; Provisional 97.53
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.53
PRK10938490 putative molybdenum transport ATP-binding protein 97.53
PRK08118167 topology modulation protein; Reviewed 97.52
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.52
PRK09700510 D-allose transporter ATP-binding protein; Provisio 97.52
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.5
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.5
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.49
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.49
PRK09183259 transposase/IS protein; Provisional 97.48
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.48
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.47
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.47
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.46
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.46
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.46
cd01394218 radB RadB. The archaeal protein radB shares simila 97.46
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.45
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.45
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 97.45
COG3899 849 Predicted ATPase [General function prediction only 97.45
PRK09354 349 recA recombinase A; Provisional 97.45
PRK06835329 DNA replication protein DnaC; Validated 97.45
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.44
PTZ001121164 origin recognition complex 1 protein; Provisional 97.44
PLN03025319 replication factor C subunit; Provisional 97.43
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 97.43
smart00382148 AAA ATPases associated with a variety of cellular 97.43
PHA02544316 44 clamp loader, small subunit; Provisional 97.42
PRK11608 326 pspF phage shock protein operon transcriptional ac 97.42
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.41
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.41
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 97.4
PRK00440319 rfc replication factor C small subunit; Reviewed 97.39
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 97.38
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.38
PRK08116268 hypothetical protein; Validated 97.37
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.37
PRK06871 325 DNA polymerase III subunit delta'; Validated 97.37
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.36
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.34
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.34
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.32
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.31
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.3
PF10443 431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.3
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.3
cd00983 325 recA RecA is a bacterial enzyme which has roles in 97.29
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.29
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.29
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 97.28
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.28
PRK06921266 hypothetical protein; Provisional 97.28
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.28
PRK04296190 thymidine kinase; Provisional 97.27
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.27
PRK08939306 primosomal protein DnaI; Reviewed 97.27
PRK10536262 hypothetical protein; Provisional 97.27
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.27
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.26
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.26
PHA00729226 NTP-binding motif containing protein 97.26
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.25
PRK06964 342 DNA polymerase III subunit delta'; Validated 97.25
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 97.25
PRK08769 319 DNA polymerase III subunit delta'; Validated 97.25
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.25
PRK07940394 DNA polymerase III subunit delta'; Validated 97.24
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.24
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.24
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 97.24
CHL00181287 cbbX CbbX; Provisional 97.24
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.23
PRK07993 334 DNA polymerase III subunit delta'; Validated 97.22
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.22
PF00004132 AAA: ATPase family associated with various cellula 97.21
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 97.21
PF14516 331 AAA_35: AAA-like domain 97.2
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 97.19
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.19
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.19
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 97.17
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 97.16
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.15
PRK08118167 topology modulation protein; Reviewed 97.14
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.13
KOG2228 408 consensus Origin recognition complex, subunit 4 [R 97.13
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.13
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 97.12
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.11
PRK08699 325 DNA polymerase III subunit delta'; Validated 97.11
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.1
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.1
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.1
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.1
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 97.1
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.1
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.09
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.09
PRK07261171 topology modulation protein; Provisional 97.07
PRK06090 319 DNA polymerase III subunit delta'; Validated 97.07
KOG0736 953 consensus Peroxisome assembly factor 2 containing 97.07
PRK05022 509 anaerobic nitric oxide reductase transcription reg 97.06
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.05
PRK08727233 hypothetical protein; Validated 97.04
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 97.02
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.02
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.01
PRK06067234 flagellar accessory protein FlaH; Validated 97.0
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.0
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.99
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.99
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.98
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.98
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.98
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 96.97
COG2204 464 AtoC Response regulator containing CheY-like recei 96.96
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.96
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.96
PRK08084235 DNA replication initiation factor; Provisional 96.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.94
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.93
PRK09087226 hypothetical protein; Validated 96.92
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.91
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 96.9
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.89
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 96.89
PRK00093 435 GTP-binding protein Der; Reviewed 96.88
PRK07261171 topology modulation protein; Provisional 96.88
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 96.87
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.87
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.87
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 96.86
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 96.85
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.84
PRK15455 644 PrkA family serine protein kinase; Provisional 96.84
PRK03992389 proteasome-activating nucleotidase; Provisional 96.84
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.82
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.82
PRK12377248 putative replication protein; Provisional 96.81
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.81
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 96.8
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.8
COG4172534 ABC-type uncharacterized transport system, duplica 96.8
PRK04328249 hypothetical protein; Provisional 96.8
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.79
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.78
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.78
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.77
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.77
PRK06526254 transposase; Provisional 96.76
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.76
PRK08181269 transposase; Validated 96.76
PRK05642234 DNA replication initiation factor; Validated 96.75
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.75
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 96.75
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.74
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.74
PRK06696223 uridine kinase; Validated 96.73
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 96.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.73
PRK13695174 putative NTPase; Provisional 96.73
PRK12608380 transcription termination factor Rho; Provisional 96.72
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.71
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 96.71
PRK14088440 dnaA chromosomal replication initiation protein; P 96.71
PRK08939306 primosomal protein DnaI; Reviewed 96.71
PHA02244 383 ATPase-like protein 96.7
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 96.7
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.7
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.69
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 96.68
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.68
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.68
PRK05541176 adenylylsulfate kinase; Provisional 96.64
PRK12608380 transcription termination factor Rho; Provisional 96.64
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.64
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 96.64
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.63
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.61
cd03246173 ABCC_Protease_Secretion This family represents the 96.6
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 96.6
PRK07471365 DNA polymerase III subunit delta'; Validated 96.59
PRK11823 446 DNA repair protein RadA; Provisional 96.56
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.56
PRK09183259 transposase/IS protein; Provisional 96.55
PRK07667193 uridine kinase; Provisional 96.54
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.54
TIGR00763775 lon ATP-dependent protease La. This protein is ind 96.54
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 96.53
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.52
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.52
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.51
PRK06620214 hypothetical protein; Validated 96.49
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 96.49
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.48
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.48
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.47
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.47
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.47
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 96.47
PRK14087450 dnaA chromosomal replication initiation protein; P 96.46
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.46
PRK09112351 DNA polymerase III subunit delta'; Validated 96.46
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 96.45
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.45
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.45
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.44
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 96.43
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.43
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.43
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.43
PRK15424 538 propionate catabolism operon regulatory protein Pr 96.42
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 96.41
PTZ00035337 Rad51 protein; Provisional 96.41
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 96.4
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.39
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.38
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 96.38
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.38
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.37
PRK06696223 uridine kinase; Validated 96.37
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.36
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 96.36
PRK06921266 hypothetical protein; Provisional 96.36
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.35
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 96.35
PRK06762166 hypothetical protein; Provisional 96.35
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.34
cd03215182 ABC_Carb_Monos_II This family represents domain II 96.34
PRK07132 299 DNA polymerase III subunit delta'; Validated 96.33
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.33
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.33
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.33
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.32
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.31
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 96.31
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.3
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.29
PRK05973237 replicative DNA helicase; Provisional 96.29
PRK07667193 uridine kinase; Provisional 96.28
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 96.28
PRK00149450 dnaA chromosomal replication initiation protein; R 96.28
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.28
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.27
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.27
PRK08233182 hypothetical protein; Provisional 96.27
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.27
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.27
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.25
PTZ00494 664 tuzin-like protein; Provisional 96.23
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 96.23
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.22
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.21
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.21
PRK10867 433 signal recognition particle protein; Provisional 96.2
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 96.2
PF00154 322 RecA: recA bacterial DNA recombination protein; In 96.19
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.19
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.19
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.18
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.18
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 96.18
PRK14086617 dnaA chromosomal replication initiation protein; P 96.18
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 96.18
COG4619223 ABC-type uncharacterized transport system, ATPase 96.17
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.16
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.16
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.16
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.15
PRK05917 290 DNA polymerase III subunit delta'; Validated 96.15
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.14
cd03115173 SRP The signal recognition particle (SRP) mediates 96.14
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.13
PRK07952244 DNA replication protein DnaC; Validated 96.13
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 96.11
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.11
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.11
CHL00176638 ftsH cell division protein; Validated 96.09
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.09
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.08
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 96.08
PRK15455 644 PrkA family serine protein kinase; Provisional 96.08
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.08
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.07
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.06
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.06
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 96.05
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.05
COG1160 444 Predicted GTPases [General function prediction onl 96.05
PRK14974336 cell division protein FtsY; Provisional 96.04
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.04
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 96.03
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.03
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.03
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.03
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 96.03
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 96.03
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.02
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 96.01
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.0
PRK06835329 DNA replication protein DnaC; Validated 96.0
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.0
KOG0062582 consensus ATPase component of ABC transporters wit 96.0
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 95.99
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.99
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.99
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.98
TIGR00064272 ftsY signal recognition particle-docking protein F 95.98
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=8.7e-34  Score=307.84  Aligned_cols=290  Identities=19%  Similarity=0.274  Sum_probs=219.2

Q ss_pred             cccchH-HHHHHHHHHhHhhhhhHhHHHHHHHHHHHHHHHHHHHHHhhh--------cChhhHHHHHHHHHHhHHHHHHH
Q 010799            3 AEATIV-PVVRILKELSREKFEDEGLVAQLINSSEELEKVRKSWEEKEI--------NDVSPKLLNAVSQVQDITDTFRI   73 (501)
Q Consensus         3 a~~~v~-~v~kl~~~l~~e~~~~~~~~~~l~~~~~~l~~~~~~~e~~~~--------~~~~~~l~~~~~~~edllD~~~~   73 (501)
                      +++.++ .+.|+.+++.++...+.+..+.+..++..|..++.++++++.        .+|.+.+++..|++++.++.+.+
T Consensus         1 ~~~~~s~~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v   80 (889)
T KOG4658|consen    1 MGACVSFGVEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLV   80 (889)
T ss_pred             CCeEEEEehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            356677 888999999999999999999999999999999999998886        23778899999999999999998


Q ss_pred             Hhhhhhhccccc--------cCcchHHHH-------HHHHHHHHHHHHHHHHHHhhhhcccc-ccc---ccccccccccc
Q 010799           74 ENCKRVYLGVIS--------LRSSTVQAR-------FRKKIKELVSGIREESEKMLLEISGK-ITS---AENVDSAKKTG  134 (501)
Q Consensus        74 ~~~~~~~~~~~~--------~~~~~~~~~-------~~~~i~~l~~~i~~~~~~~~~~~~~~-~~~---~~~~~~~~~~~  134 (501)
                      +....+......        .+.....+.       +.+++-.....++....+..+...+. ..+   ....+......
T Consensus        81 ~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~  160 (889)
T KOG4658|consen   81 EEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD  160 (889)
T ss_pred             HHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc
Confidence            765543322111        111123333       44444444444444333222222121 111   11111122333


Q ss_pred             cccchhhHHHHHHHHhcCCCCeeEEEEEeeCChhhHHHHhhhhcccc-cccccceeEEEEcCCCCCHHHHHHHHHHHhcC
Q 010799          135 ILDLNKEVNKLADFLIRSHSSLFTISVVDVAGSVMTTDLWKSYECET-VKEYFQCRAWVPVPEELERRELVTDILKQVGG  213 (501)
Q Consensus       135 ~vg~~~~~~~l~~~L~~~~~~~~vi~I~G~~GvGKTtLa~~v~~~~~-v~~~F~~~~wv~vs~~~~~~~l~~~i~~~~~~  213 (501)
                       ||.+..++++.+.|.+++.  .+++|+||||+||||||+++||+.. ++.+||..+||+||+.|+...++.+|++.++.
T Consensus       161 -VG~e~~~~kl~~~L~~d~~--~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~  237 (889)
T KOG4658|consen  161 -VGLETMLEKLWNRLMEDDV--GIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGL  237 (889)
T ss_pred             -ccHHHHHHHHHHHhccCCC--CEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhcc
Confidence             9999999999999998764  8999999999999999999999998 99999999999999999999999999999987


Q ss_pred             CCCcC----cchHHHHHHHHccCCeEEEEEecCCChhHHHHHhhcCCCCCCCcEEEEEeccccchhc-ccCCCCCCCccc
Q 010799          214 SKVEK----QLDPQKKLRKLFTENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARC-RNMSFFGGESSF  288 (501)
Q Consensus       214 ~~~~~----~~~~~~~l~~~l~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTtr~~~va~~-~~~~~l~~~~~~  288 (501)
                      .....    ...++..|.+.|++|||||||||||+..+|+.++.++|...+||||++|||+++||.. ++.     .+.+
T Consensus       238 ~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~-----~~~~  312 (889)
T KOG4658|consen  238 LDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGV-----DYPI  312 (889)
T ss_pred             CCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccC-----Cccc
Confidence            43331    2356899999999999999999999999999999999999999999999999999974 222     2455


Q ss_pred             CcceeeeccccC
Q 010799          289 KPKYIAYAASED  300 (501)
Q Consensus       289 ~~~~~~~~~s~~  300 (501)
                      +++++....+|.
T Consensus       313 ~v~~L~~~eaW~  324 (889)
T KOG4658|consen  313 EVECLTPEEAWD  324 (889)
T ss_pred             cccccCccccHH
Confidence            555555554444



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query501
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-30
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 5e-26
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-08
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-22
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-10
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 6e-08
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 5e-06
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  123 bits (310), Expect = 5e-30
 Identities = 62/352 (17%), Positives = 112/352 (31%), Gaps = 80/352 (22%)

Query: 180 ETVKEYFQCRAWVPVPEELERREL----VTDILKQVGGSKVEKQL----DPQKKLRKLFT 231
           ET +  +Q +  + V E+          V D+ K +   +    +    D      +LF 
Sbjct: 10  ETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLF- 68

Query: 232 ENRYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCRNMSFFGGESSFKPK 291
                              L       S    ++  F E +  R  N  F       + +
Sbjct: 69  -----------------WTLL------SKQEEMVQKFVE-EVLR-INYKFLMSPIKTEQR 103

Query: 292 -----YIAYAASEDDGGNDDRALPK-QVPDEEISEEVTAVVSMENDILKLAKLTLNSSDK 345
                   Y    D   ND++   K  V   +   +           L+ A L L  +  
Sbjct: 104 QPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLK-----------LRQALLELRPAKN 152

Query: 346 NFLISVAGAAGSGKTALVKTIYESSYTKKNFPCRA-WANV-YVSQDFDMRSVFADILRQL 403
              + + G  GSGKT +   +  S   +     +  W N+   +    +  +   +L Q+
Sbjct: 153 ---VLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQI 209

Query: 404 TQDEVDEESS-------LDDLESEFTGILYEKRY---LVVLDDVHSPGAWYDLKRIFSPQ 453
             +              +  +++E   +L  K Y   L+VL +V +  AW      F+  
Sbjct: 210 DPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAW----NAFN-- 263

Query: 454 ASPIGSRVILITREAYVARSFSPS----IFL-HQLRPLNEEESGKLFQRRLK 500
              +  +++L TR   V    S +    I L H    L  +E   L  + L 
Sbjct: 264 ---LSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD 312


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query501
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.91
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.9
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.82
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.82
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.82
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 99.79
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.77
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.72
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 99.39
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 99.35
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 99.35
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 99.31
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.29
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 99.29
2fna_A 357 Conserved hypothetical protein; structural genomic 99.24
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.13
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 99.04
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.03
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.02
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 98.99
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.96
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.92
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.86
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.83
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.79
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.77
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.76
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.72
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.71
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.7
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.7
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.7
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.69
2fna_A357 Conserved hypothetical protein; structural genomic 98.65
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.64
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.63
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.6
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.57
3pvs_A 447 Replication-associated recombination protein A; ma 98.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.54
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.52
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.51
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.5
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.48
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.48
3bos_A242 Putative DNA replication factor; P-loop containing 98.44
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.44
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.41
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 98.4
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.4
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.4
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.4
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.35
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.34
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.34
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.33
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.33
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.32
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.32
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.3
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.3
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.29
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.29
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 98.27
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.26
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.26
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.22
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.22
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.2
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.2
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.2
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.19
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.19
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.19
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.18
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 98.1
3co5_A143 Putative two-component system transcriptional RES 98.09
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.09
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.07
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.04
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.03
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.01
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.99
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.99
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.98
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.98
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.97
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.95
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.93
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.9
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.84
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.84
3co5_A143 Putative two-component system transcriptional RES 97.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.77
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.75
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.74
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.73
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.7
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.66
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.64
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.62
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.57
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.56
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.55
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.55
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.52
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 97.48
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.46
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.46
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.45
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.42
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.42
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 97.42
2qgz_A308 Helicase loader, putative primosome component; str 97.41
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.4
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.4
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.4
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.39
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.39
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.39
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.38
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 97.38
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.38
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.34
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.28
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.23
3pvs_A447 Replication-associated recombination protein A; ma 97.2
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.19
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.15
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.14
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.12
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.11
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.09
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.06
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.03
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.02
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.99
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.98
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.97
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.97
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.95
3io5_A 333 Recombination and repair protein; storage dimer, i 96.94
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.92
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.91
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.91
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.91
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.89
1xp8_A 366 RECA protein, recombinase A; recombination, radior 96.87
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.87
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 96.87
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.84
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.83
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.81
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.8
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.74
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.73
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.7
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.69
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.62
2z43_A324 DNA repair and recombination protein RADA; archaea 96.61
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.6
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.6
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.59
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.58
2qgz_A308 Helicase loader, putative primosome component; str 96.53
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 96.49
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.46
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.4
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.33
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.3
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.3
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.19
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.16
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.11
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.04
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.95
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.91
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.9
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.87
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.87
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.85
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.85
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 95.84
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.83
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.81
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.8
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 95.79
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 95.78
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.78
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.77
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.75
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.75
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.75
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.73
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.71
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.67
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.66
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.65
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.65
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.57
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.56
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.52
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.52
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 95.52
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.51
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.51
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.49
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.48
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.47
2z43_A324 DNA repair and recombination protein RADA; archaea 95.46
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.45
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.44
3bos_A242 Putative DNA replication factor; P-loop containing 95.41
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.38
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.36
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.35
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.34
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.34
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.34
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.31
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.31
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.27
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.27
1tue_A212 Replication protein E1; helicase, replication, E1E 95.26
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.23
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.23
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 95.22
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.2
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.19
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.17
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.17
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.13
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.12
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.11
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 95.11
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.09
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.07
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.05
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.05
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.04
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.03
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.01
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.0
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.0
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 94.99
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.95
3io5_A333 Recombination and repair protein; storage dimer, i 94.93
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.93
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.93
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.93
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.92
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 94.9
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 94.86
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.84
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.83
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.82
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.81
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.81
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 94.81
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.8
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.8
2xxa_A 433 Signal recognition particle protein; protein trans 94.79
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.79
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.78
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.78
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.77
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.76
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.76
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.74
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.72
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.71
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.7
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.7
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.68
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.67
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.67
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.67
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 94.66
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.66
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.64
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.64
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.64
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.63
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.61
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.61
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.6
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.6
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.57
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.56
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.55
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.54
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 94.53
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 94.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.49
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.48
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.48
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.47
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.46
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.46
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.45
1via_A175 Shikimate kinase; structural genomics, transferase 94.42
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.42
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.42
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 94.41
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.41
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.41
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.4
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.4
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.4
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.37
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.37
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.36
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.35
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.34
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.31
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.31
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.3
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.28
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.28
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.27
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.26
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.26
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.26
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.24
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.24
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.23
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.23
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.22
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 94.21
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.21
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.21
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 94.21
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.2
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.2
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.19
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.19
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 94.18
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.18
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.17
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.15
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.14
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.13
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 94.11
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.1
3fwy_A 314 Light-independent protochlorophyllide reductase I 94.08
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.08
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.08
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.06
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.02
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.01
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.01
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.99
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 93.99
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.99
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.99
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 93.99
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.96
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.96
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.95
3fwy_A314 Light-independent protochlorophyllide reductase I 93.92
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 93.92
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.92
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.91
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.9
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.89
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.88
2xxa_A433 Signal recognition particle protein; protein trans 93.86
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.85
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.82
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.82
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.82
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.82
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.82
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.81
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.81
3ice_A422 Transcription termination factor RHO; transcriptio 93.8
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.77
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.77
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.77
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 93.75
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.74
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.74
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.73
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.73
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.73
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.72
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.72
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.72
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.71
1via_A175 Shikimate kinase; structural genomics, transferase 93.7
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.7
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.69
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.67
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 93.67
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.67
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.65
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.64
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.64
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.64
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.63
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 93.62
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.62
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.6
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 93.6
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.59
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.56
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.53
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.53
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.52
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.51
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.5
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.49
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.49
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 93.48
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.46
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 93.44
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.43
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.43
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.42
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.41
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.4
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.39
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.39
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.38
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.37
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.35
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.33
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 93.32
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.31
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.31
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.3
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.3
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.29
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 93.27
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.27
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.26
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.26
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 93.25
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.25
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.23
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.23
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.23
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.22
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.17
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.17
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.12
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.12
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 93.12
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.1
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.1
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.09
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.09
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.04
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.02
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.02
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.02
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.99
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.98
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 92.97
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.97
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 92.96
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 92.94
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.91
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.91
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.89
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 92.89
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.88
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.87
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.85
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 92.8
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.79
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.76
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.75
1vma_A306 Cell division protein FTSY; TM0570, structural gen 92.74
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.74
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.74
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.73
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.69
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 92.68
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.67
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.65
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.64
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.63
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.63
2og2_A359 Putative signal recognition particle receptor; nuc 92.62
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.61
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 92.61
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 92.6
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.58
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 92.57
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.91  E-value=3.3e-24  Score=226.54  Aligned_cols=149  Identities=10%  Similarity=0.084  Sum_probs=121.1

Q ss_pred             ccchhhHHHHHHHHhcC-CCCeeEEEEEeeCChhhHHHHhhhhc--ccccccccceeEEEEcCCCC--CHHHHHHHHHHH
Q 010799          136 LDLNKEVNKLADFLIRS-HSSLFTISVVDVAGSVMTTDLWKSYE--CETVKEYFQCRAWVPVPEEL--ERRELVTDILKQ  210 (501)
Q Consensus       136 vg~~~~~~~l~~~L~~~-~~~~~vi~I~G~~GvGKTtLa~~v~~--~~~v~~~F~~~~wv~vs~~~--~~~~l~~~i~~~  210 (501)
                      +||+.++++|.++|... +...++|+|+||||+||||||+.+|+  +.+++.+|++++||++++.+  +...++..|+.+
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~  210 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM  210 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence            59999999999999865 44689999999999999999999998  78999999999999999985  899999999999


Q ss_pred             hcCCCC---c------CcchHHHHHHHHccCC-eEEEEEecCCChhHHHHHhhcCCCCCCCcEEEEEeccccchhcc---
Q 010799          211 VGGSKV---E------KQLDPQKKLRKLFTEN-RYLVVIINARTPDIWDILKYLFPNSSNGSRVILSFQEADAARCR---  277 (501)
Q Consensus       211 ~~~~~~---~------~~~~~~~~l~~~l~~k-r~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTtr~~~va~~~---  277 (501)
                      ++....   .      +...+...+++.|++| ||||||||||+.+.+ .+..     .+||+||||||+..||..+   
T Consensus       211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~  284 (549)
T 2a5y_B          211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAASQT  284 (549)
T ss_dssp             HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCCSC
T ss_pred             HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcCCC
Confidence            986532   1      1122578999999996 999999999998764 1111     2799999999999998743   


Q ss_pred             ----cCCCCCCCcccCc
Q 010799          278 ----NMSFFGGESSFKP  290 (501)
Q Consensus       278 ----~~~~l~~~~~~~~  290 (501)
                          .+++|+.+++|..
T Consensus       285 ~~~~~l~~L~~~ea~~L  301 (549)
T 2a5y_B          285 CEFIEVTSLEIDECYDF  301 (549)
T ss_dssp             EEEEECCCCCHHHHHHH
T ss_pred             CeEEECCCCCHHHHHHH
Confidence                3344554555444



>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 501
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-20
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 88.3 bits (218), Expect = 4e-20
 Identities = 30/204 (14%), Positives = 60/204 (29%), Gaps = 24/204 (11%)

Query: 305 DDRALPKQVPDEEISEEVTAVVSMENDILKL-AKLTLNSSDKNFLISVAGAAGSGKTALV 363
           D + L   VP +            E  + ++  KL       +F + + G AGSGK+ + 
Sbjct: 8   DRKLLLGNVPKQ------MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIA 61

Query: 364 KTIYESSYTKKNFPCRAWANVYVSQDFDMRSVFADILRQLTQDEVD---------EESSL 414
                 S         +   +  S      +        L     D           +S+
Sbjct: 62  SQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSV 121

Query: 415 DDLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYVARSF 474
                    ++     L V DDV         +         +  R ++ TR+  ++ + 
Sbjct: 122 VLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAA 173

Query: 475 SPSIFLHQLRPLNEEESGKLFQRR 498
           S +    ++  L  +E     +  
Sbjct: 174 SQTCEFIEVTSLEIDECYDFLEAY 197


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query501
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.93
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.92
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.06
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.85
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.73
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.72
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.61
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.6
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.6
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.53
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.5
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.48
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.48
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.48
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.39
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.37
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.23
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.2
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.17
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.17
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.08
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.0
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.96
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.91
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.84
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.83
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.83
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.71
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.7
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.59
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 97.58
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.29
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.27
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.26
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.25
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.17
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.16
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.1
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.07
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.99
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.95
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.9
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.9
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.81
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.81
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.75
d2qy9a2211 GTPase domain of the signal recognition particle r 96.75
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.72
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.69
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.68
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.68
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.64
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.63
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.62
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.62
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.61
d1vmaa2213 GTPase domain of the signal recognition particle r 96.6
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.6
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.59
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.58
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.57
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.55
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.55
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.54
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.53
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.53
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.52
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.49
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.49
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.48
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.45
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.43
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.42
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.4
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.34
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.3
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.28
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.27
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.23
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.19
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.18
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.17
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.15
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.09
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.07
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.06
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.05
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.02
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.99
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.96
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.95
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.95
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.95
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.88
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.84
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.84
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.81
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 95.79
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.79
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.78
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.78
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.76
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.74
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.73
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.73
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.71
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.69
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.67
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 95.65
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.64
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.63
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.62
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.59
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.59
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.55
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.53
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.53
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.5
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.48
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.48
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.42
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 95.4
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 95.37
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.35
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.35
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.34
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.31
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.3
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.27
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.27
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.27
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.26
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.25
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.22
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.17
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.17
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.13
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.12
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.12
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.08
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.02
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.02
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.98
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.97
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.94
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.87
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.83
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.78
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.77
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.71
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 94.7
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.69
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.6
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.56
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.56
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.44
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.41
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.38
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.36
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.31
d1okkd2207 GTPase domain of the signal recognition particle r 94.31
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.28
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.27
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.26
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.24
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.24
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.2
d2qy9a2211 GTPase domain of the signal recognition particle r 94.18
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.15
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.07
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.06
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.06
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.99
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.94
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.81
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.81
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.79
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.77
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.72
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.69
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.67
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.54
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.53
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.52
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.5
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.48
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.45
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.44
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.41
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.4
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.37
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.33
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.3
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.27
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 93.26
d1vmaa2213 GTPase domain of the signal recognition particle r 93.21
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.1
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.1
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.08
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.97
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.95
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.95
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.95
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.93
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.93
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.89
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.88
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.85
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.84
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.84
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.83
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.81
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.79
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.78
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.73
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.69
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.64
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.64
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.62
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.58
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.55
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.53
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.52
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.52
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 92.51
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.5
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.41
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.35
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.35
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.32
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.31
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.29
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.28
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.23
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.18
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.14
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.04
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.04
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.04
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.03
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.02
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.0
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.99
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.96
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 91.93
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.93
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.92
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.91
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.88
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.88
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.87
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.81
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.78
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 91.78
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.76
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.75
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.71
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.71
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.64
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.64
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.56
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.53
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.51
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.5
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.46
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.43
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.42
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.41
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.4
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.4
d2fh5b1207 Signal recognition particle receptor beta-subunit 91.39
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.39
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.39
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.38
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.36
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.36
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.32
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.29
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.26
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.25
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.25
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.23
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.19
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.19
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.17
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.16
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.15
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.12
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.12
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.1
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.1
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.09
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 91.07
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.06
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.05
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.04
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.03
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.99
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.99
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.96
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.92
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.92
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.92
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 90.9
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.89
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.88
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.85
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.85
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.79
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 90.76
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.74
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.73
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.72
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.69
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.65
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.65
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.65
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 90.64
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.63
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.61
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.59
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.57
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.56
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.53
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.52
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.5
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.48
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.46
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.44
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.41
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.41
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.37
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.35
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.32
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.28
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.26
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.25
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.21
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.19
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.17
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.14
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.1
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.09
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.08
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.06
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.04
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.03
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.99
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.93
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.91
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.91
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.91
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.89
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.81
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.78
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.72
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.69
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.68
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.67
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 89.65
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.62
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 89.62
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.6
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.59
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.48
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.44
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.42
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.4
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.37
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.36
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.34
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 89.27
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.09
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.02
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.02
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.02
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.0
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.98
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.98
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.82
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.79
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.77
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.72
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.67
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.54
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.39
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.37
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.35
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 88.31
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.31
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.3
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.23
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.14
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.95
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.92
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.91
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 87.72
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.7
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.7
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.55
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.43
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.13
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 87.09
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.97
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.65
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 86.57
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.73
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.36
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 85.3
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.1
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 84.37
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 84.09
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 83.94
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.57
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.49
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.34
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 83.14
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 82.93
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 82.43
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.43
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 81.85
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.82
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 81.75
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 81.46
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 81.43
d1tuea_205 Replication protein E1 helicase domain {Human papi 81.02
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 80.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 80.76
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 80.67
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 80.28
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.01
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.93  E-value=1.7e-25  Score=213.05  Aligned_cols=168  Identities=16%  Similarity=0.126  Sum_probs=132.3

Q ss_pred             cceeecchhHHHHHHHhhc-CCCCceEEEEEecCCCChHHHHHHHHcccc--cccCCccceeEEEEeCCCCChHHHHHHH
Q 010799          323 TAVVSMENDILKLAKLTLN-SSDKNFLISVAGAAGSGKTALVKTIYESSY--TKKNFPCRAWANVYVSQDFDMRSVFADI  399 (501)
Q Consensus       323 ~~fvGR~~~~~~l~~~L~~-~~~~~~~v~I~G~gGvGKT~LA~~~~~~~~--~~~~f~~~~w~~v~~~~~~~~~~~~~~i  399 (501)
                      ..++||+.++++|.++|.. .+...++|+|+||||+||||||+++|++..  ...+|++++|  ++++...+...+...+
T Consensus        20 ~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~W--v~vs~~~~~~~l~~~~   97 (277)
T d2a5yb3          20 MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW--LKDSGTAPKSTFDLFT   97 (277)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEE--EECCCCSTTHHHHHHH
T ss_pred             CceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEE--EEecCCCCHHHHHHHH
Confidence            4588999999999999854 445678999999999999999999998533  5677899999  9999888877766655


Q ss_pred             HHHhcc---CCCC------CCCCHHHHHHHHHHhcCCceEEEEEcCCCChhhHHHHHHhcCCCCCCCCCEEEEEeCChHH
Q 010799          400 LRQLTQ---DEVD------EESSLDDLESEFTGILYEKRYLVVLDDVHSPGAWYDLKRIFSPQASPIGSRVILITREAYV  470 (501)
Q Consensus       400 ~~~l~~---~~~~------~~~~~~~~~~~l~~~l~~~r~LlVlDnv~~~~~~~~l~~~l~~~~~~~~~~iIiTtR~~~~  470 (501)
                      ...+..   ....      ...........+.+.+.++++|+||||+|+..++..+.        ..+++||||||+..+
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~--------~~~srilvTTR~~~v  169 (277)
T d2a5yb3          98 DILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEI  169 (277)
T ss_dssp             HHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEESBGGG
T ss_pred             HHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc--------ccCceEEEEeehHHH
Confidence            544322   1111      11222334556888899999999999999988877653        247899999999999


Q ss_pred             HhhcCCCCcceeCCCCChHHHHHHHHHhhc
Q 010799          471 ARSFSPSIFLHQLRPLNEEESGKLFQRRLK  500 (501)
Q Consensus       471 ~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~  500 (501)
                      +..+.....+|+|++|+.+||++||.++++
T Consensus       170 ~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~  199 (277)
T d2a5yb3         170 SNAASQTCEFIEVTSLEIDECYDFLEAYGM  199 (277)
T ss_dssp             GGGCCSCEEEEECCCCCHHHHHHHHHHTSC
T ss_pred             HHhcCCCCceEECCCCCHHHHHHHHHHHhC
Confidence            988764557899999999999999998765



>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure