Citrus Sinensis ID: 010819

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500
MSLLSPSSFFFLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV
cccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccEEEcccccccccccEEEccccccccccccEEEEccccccccccEEEEccccccEEEEEEEEccccccccccccEEEEEccEEEEEEcccccccccccccEEEEEEEEEcccEEEEEEEccccccEEEEEEEEEcccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEcEEEEEccccccccccHHHHHHHcccccccEEEEcccccccEEEEEEEEEcccccccccEEEEEEEEccEEEEccccccccccEEEEEEcEEEEccccEEEEEEEcccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEccccccccccEEEEEcccccccEEEccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEcccHHcccccccccccccccccccccEEEEcccccccccEEEEEcccccEEEEEEEEEEcccccccccccEEEEEcccEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEEccccccEEEEEEEcccccccccccccccccEEHEEEEccccccccccEEEccccccccEEcccccccccccccccEEcccccccccccccccccHHHHHHHcccccccEEEEccccccccEEEEEEEHHHHHHcccccEEEEEEEEcccccccccccccccccEEEccccccccccEEEEEEEccccccccEEEHEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccEEEEEEcccccccccccHHHHHHHHHcEEEccccccccccccHccccccEEEEcccccccccccHHHHHccccccc
msllspssfFFLSLLLVLPlslassypykasyridcgsatsttdpfnttwqaddryytsgatsivseplhfrfphektlryfppssgkkncyiipnlppgryyirtftvydnydgkshspsfdvsvegtlvfswrspwpeglardgaySDLFAFvkdgeldlcfysfatdppviaslevqqidplsydaatignnhILVNygrltsgsnqwgpgfsndaddfgrswqsdaasrspnakssiksvttreritntnqppnyypmklYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVndknvtrvdIFNSVGSFAAYSWHYVAKNlssteltvKLVPVVGAALISglenyalvpndlstVPEQVIAMRALKEslrvpdrmgwngdpcaptnwdawegitchpnkdeTAVVISQIDlgsqglkgyiSDKISLLSNLVNLnlstnslggtlpsglgqqslvrldlsdnqftgsipdsltsssklqlv
MSLLSPSSFFFLSLLLVLPLSLASSYPYKASYRIDCGsatsttdpfnttwQADDRYYTSGATSIVSEPLHFRFPHEKTlryfppssgkkncYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWqsdaasrspnakssiksvttreritntnqppnyypMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKEslrvpdrmgwNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQftgsipdsltsssklqlv
MsllspssffflslllvlplslassYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKIsllsnlvnlnlstnslggtlPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV
*******SFFFLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQW**********************************************NYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGT*************************************
******S***FLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGA***********FPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV
MSLLSPSSFFFLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRS********************TRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDS**********
*SLLSPSSFFFLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLSPSSFFFLSLLLVLPLSLASSYPYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFNSVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query500 2.2.26 [Sep-21-2011]
Q9FZB1 872 Probable LRR receptor-lik no no 0.834 0.478 0.286 1e-32
O81069 884 Probable leucine-rich rep no no 0.864 0.488 0.265 5e-29
Q9LIG2 899 Receptor-like protein kin no no 0.91 0.506 0.270 1e-28
C0LGT5 866 Probable LRR receptor-lik no no 0.778 0.449 0.271 2e-28
Q9FZB8 871 Probable LRR receptor-lik no no 0.896 0.514 0.262 4e-28
Q9FN94 868 Receptor-like protein kin no no 0.846 0.487 0.273 1e-27
Q9ZQQ7 886 Putative leucine-rich rep no no 0.906 0.511 0.249 2e-27
C0LGD8 864 Probable LRR receptor-lik no no 0.866 0.501 0.276 2e-27
Q9SNA3 889 Putative receptor-like pr no no 0.858 0.482 0.265 2e-27
C0LGD6 852 Probable LRR receptor-lik no no 0.834 0.489 0.286 6e-26
>sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 225/489 (46%), Gaps = 72/489 (14%)

Query: 34  IDCG----SATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEK-TLRYFPPSSGK 88
           +DCG    +AT T    N T+++D  Y  SG    +S     +   +  T+R FP   G+
Sbjct: 32  LDCGLVPKNATYTEKTTNITYKSDANYIDSGLVGRISAEYKAQLQQQTWTVRSFP--EGE 89

Query: 89  KNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAY 148
           +NCY        RY IR    Y NYDG    P FD+ +  +    W S   +G+  +GA 
Sbjct: 90  RNCYNFNLTAKSRYLIRATFTYGNYDGLRQVPKFDIHIGPS---KWTSVKLDGVG-NGAV 145

Query: 149 SDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTSGS 208
            ++   +    L +C        P I+SLE++ ++  +Y    +  +  L+ + R+   +
Sbjct: 146 LEMIHVLTQDRLQICLVKTGKGIPFISSLELRPLNNNTY----LTQSGSLIGFARVFFSA 201

Query: 209 NQWGPGFSN-DADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQT 267
               P F   D D   R W            + +KS++T   +  +N  P   P  + +T
Sbjct: 202 T---PTFIRYDEDIHDRVWVRQFG-------NGLKSISTDLLVDTSN--PYDVPQAVAKT 249

Query: 268 AIVSSGAIQYNLAVDAKLDYL-----IWFHFAEI----DSSVTK------AGQRVFDILV 312
           A V S A Q  L  D  LD +     ++ HFAEI    D+ + +       GQ V+  L 
Sbjct: 250 ACVPSNASQ-PLIFDWTLDNITSQSYVYMHFAEIQTLKDNDIREFNITYNGGQNVYSYLR 308

Query: 313 NDKNVTRVDIFNSV------GSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYA 366
            +K      +F+S       GSF+          LS T+     +P     LI+GLE Y 
Sbjct: 309 PEKFEIST-LFDSKPLSSPDGSFS----------LSFTKTGNSTLP----PLINGLEIYK 353

Query: 367 LVP-NDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITC-HPNKDETAV 424
           ++   +L T  ++V AM  +K +  +  ++ W GDPCAP ++  WEG+ C +PN D+  +
Sbjct: 354 VLDLLELETDQDEVSAMINIKATYDLSKKVSWQGDPCAPKSYQ-WEGLNCSYPNSDQPRI 412

Query: 425 VISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRL-DLSDN-Q 482
           +   ++L    L G I+ +IS L+ L+ L+LS N L G +P       L++L +LS N  
Sbjct: 413 I--SLNLAENKLTGTITPEISKLTQLIELDLSKNDLSGEIPEFFADMKLLKLINLSGNLG 470

Query: 483 FTGSIPDSL 491
              +IPDS+
Sbjct: 471 LNSTIPDSI 479

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O81069|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 Back     alignment and function description
>sp|C0LGT5|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZB8|Y5181_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1 Back     alignment and function description
>sp|Q9FN94|RLK7_ARATH Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQQ7|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=1 SV=1 Back     alignment and function description
>sp|C0LGD8|Y1755_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07550 OS=Arabidopsis thaliana GN=At1g07550 PE=2 SV=1 Back     alignment and function description
>sp|Q9SNA3|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1 Back     alignment and function description
>sp|C0LGD6|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query500
255566849 674 serine-threonine protein kinase, plant-t 0.942 0.698 0.754 0.0
225423893 630 PREDICTED: Di-glucose binding protein wi 0.986 0.782 0.698 0.0
449445156 626 PREDICTED: putative leucine-rich repeat 0.966 0.771 0.702 0.0
449526481591 PREDICTED: receptor-like protein kinase 0.966 0.817 0.702 0.0
356499717 636 PREDICTED: putative leucine-rich repeat 0.932 0.732 0.677 0.0
356498336 642 PREDICTED: putative leucine-rich repeat 0.942 0.733 0.660 0.0
357488299 632 Receptor-like protein kinase [Medicago t 0.974 0.770 0.648 0.0
42562316 628 Di-glucose binding protein with Leucine- 0.934 0.743 0.690 0.0
12320747585 hypothetical protein [Arabidopsis thalia 0.922 0.788 0.675 1e-180
356574639 626 PREDICTED: probable LRR receptor-like se 0.976 0.779 0.605 1e-173
>gi|255566849|ref|XP_002524408.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223536369|gb|EEF38019.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/476 (75%), Positives = 415/476 (87%), Gaps = 5/476 (1%)

Query: 27  PYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSS 86
           PY  SY IDCG  T+TTDPFNTTW +D R++T G+TS+VSEPLHFRFP EK LRYFP SS
Sbjct: 19  PYDISYYIDCGGPTNTTDPFNTTWLSD-RFFTGGSTSVVSEPLHFRFPQEKNLRYFPLSS 77

Query: 87  GKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDG 146
           GKKNCYI+P LP GRYYIRTFTVYDNYDGK HSPSFDVSVEGTLVFSWRSPW E LARDG
Sbjct: 78  GKKNCYILP-LPNGRYYIRTFTVYDNYDGKLHSPSFDVSVEGTLVFSWRSPWSENLARDG 136

Query: 147 AYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTS 206
           AYSDLF F+ DGE D+CFYS ATDPPVI SLE++Q+DP SYD+ T+GNN ILVNYGRL+ 
Sbjct: 137 AYSDLFTFIDDGEADICFYSIATDPPVIGSLEIRQVDPASYDSITVGNNSILVNYGRLSC 196

Query: 207 GSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSI--KSVTTRERITNTNQPPNYYPMKL 264
           GS QWGPGFSND D+FGRSWQSD   R+P    ++  +S++TRE+I+ T+QPPNY+PMKL
Sbjct: 197 GSVQWGPGFSNDTDNFGRSWQSDLEFRTPTTTKTMAFRSLSTREKISGTDQPPNYFPMKL 256

Query: 265 YQTAIVSSGAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFN 324
           YQTA+  +GA++Y L VDAKLDYL+WFHFAEIDS+VTK GQRVFD++VNDKN +RVDIF 
Sbjct: 257 YQTAVTGNGALEYELTVDAKLDYLLWFHFAEIDSTVTKKGQRVFDVVVNDKNASRVDIFA 316

Query: 325 SVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRA 384
           +VGSFAAYS+ Y  +NLS+  LTVK+VP +GA LISG+ENYALVPND+ST P+QV AMRA
Sbjct: 317 AVGSFAAYSFSYAVRNLSNGALTVKIVPHIGAPLISGIENYALVPNDISTAPDQVAAMRA 376

Query: 385 LKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKI 444
           LKESLRVPDRMGWNGDPCAPTNWDAWEG+TCHPNK+ TA+VISQIDLGSQGLKGYI+D+I
Sbjct: 377 LKESLRVPDRMGWNGDPCAPTNWDAWEGVTCHPNKNGTALVISQIDLGSQGLKGYINDQI 436

Query: 445 SLLSNLVNLNLSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV 500
           S LSNLV+LNLS+NSLGG LP GLG +SL+RLDLS+NQF+G IP+SL SSS LQLV
Sbjct: 437 SQLSNLVSLNLSSNSLGGMLPPGLGHKSLMRLDLSNNQFSGPIPESLASSS-LQLV 491

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225423893|ref|XP_002281668.1| PREDICTED: Di-glucose binding protein with Leucine-rich repeat domain-like [Vitis vinifera] gi|297737862|emb|CBI27063.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445156|ref|XP_004140339.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526481|ref|XP_004170242.1| PREDICTED: receptor-like protein kinase At3g21340-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499717|ref|XP_003518683.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Back     alignment and taxonomy information
>gi|356498336|ref|XP_003518009.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Back     alignment and taxonomy information
>gi|357488299|ref|XP_003614437.1| Receptor-like protein kinase [Medicago truncatula] gi|355515772|gb|AES97395.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|42562316|ref|NP_564237.2| Di-glucose binding protein with Leucine-rich repeat domain [Arabidopsis thaliana] gi|332192522|gb|AEE30643.1| Di-glucose binding protein with Leucine-rich repeat domain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12320747|gb|AAG50525.1|AC084221_7 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356574639|ref|XP_003555453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g16900-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query500
TAIR|locus:2031175 628 AT1G25570 [Arabidopsis thalian 0.942 0.75 0.659 1.5e-175
TAIR|locus:2032221 626 RLP4 "receptor like protein 4" 0.924 0.738 0.342 2.9e-64
TAIR|locus:2094103519 AT3G19230 [Arabidopsis thalian 0.89 0.857 0.279 1.5e-37
TAIR|locus:2195855 876 AT1G51910 [Arabidopsis thalian 0.86 0.490 0.268 4.6e-29
TAIR|locus:2028446 888 AT1G49100 [Arabidopsis thalian 0.886 0.498 0.260 2.7e-26
TAIR|locus:2078171 883 AT3G46400 [Arabidopsis thalian 0.878 0.497 0.253 3.8e-25
TAIR|locus:2055160 886 AT2G14440 [Arabidopsis thalian 0.87 0.490 0.253 6.9e-25
TAIR|locus:2024987 864 AT1G07550 [Arabidopsis thalian 0.864 0.5 0.260 2.6e-24
TAIR|locus:2126540 876 AT4G29990 [Arabidopsis thalian 0.864 0.493 0.264 2.7e-24
TAIR|locus:2066158 884 AT2G28990 [Arabidopsis thalian 0.888 0.502 0.238 5.6e-23
TAIR|locus:2031175 AT1G25570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1687 (598.9 bits), Expect = 1.5e-175, Sum P(2) = 1.5e-175
 Identities = 314/476 (65%), Positives = 378/476 (79%)

Query:    27 PYKASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSS 86
             P+  S+ IDCGS  ++TD FN TW   D++Y+ G+T++VSEPL F    EKT+RYFP S 
Sbjct:    25 PFNTSFFIDCGSPETSTDVFNRTW-LPDQFYSGGSTAVVSEPLRFHLIAEKTIRYFPLSF 83

Query:    87 GKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDG 146
             GKKNCY++P LPPGRYY+RTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPE L RDG
Sbjct:    84 GKKNCYVVP-LPPGRYYLRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPESLLRDG 142

Query:   147 AYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSYDAATIGNNHILVNYGRLTS 206
             +YSDLFAF+ DGELDLCFYS ATDPP++ SLEV Q+DP SYDA   G N +LVNYGRL+ 
Sbjct:   143 SYSDLFAFIGDGELDLCFYSIATDPPIVGSLEVLQVDPSSYDADGTGQNVLLVNYGRLSC 202

Query:   207 GSNQWGPGFSNDADDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQ 266
             GS+QWGPGF+N  D+FGRSWQSD   RS +++S  +S++T E+I   +Q PNY+PMKLYQ
Sbjct:   203 GSDQWGPGFTNHTDNFGRSWQSDEDFRSEDSRSVARSLSTLEKIKGVDQAPNYFPMKLYQ 262

Query:   267 TAIVSSG--AIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTRVDIFN 324
             TA+  SG  ++ Y L VDAKLDYL+WFHF+EIDS+V KAGQRVFD++VND NV+RVD+F+
Sbjct:   263 TAVTVSGGGSLVYELEVDAKLDYLLWFHFSEIDSTVKKAGQRVFDLVVNDNNVSRVDVFH 322

Query:   325 SVGSFAAYSWHYVAKNLSSTELTVKLVPVVGAALISGLENYALVPNDLSTVPEQVIAMRA 384
              VG FAAYS +Y  KNLSST +TVKL  V GA +ISGLENYA+VP D++TVPEQV AM+A
Sbjct:   323 EVGGFAAYSLNYTVKNLSSTIVTVKLSSVSGAPIISGLENYAIVPADMATVPEQVTAMKA 382

Query:   385 LKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKI 444
             LK+SLRVPDRMGWNGDPCAPT+WDAWEG++C PN   +A+VI QIDLGSQGLKG+IS++I
Sbjct:   383 LKDSLRVPDRMGWNGDPCAPTSWDAWEGVSCRPNSQGSALVIFQIDLGSQGLKGFISEQI 442

Query:   445 XXXXXXXXXXXXXXXXXXXXPSGLGQQSLVRLDLSDNQFTGSIPDSLTSSSKLQLV 500
                                 P GLG +SLV LDLS+NQ TG IP+SLT SS L+LV
Sbjct:   443 SLLTNLNSLNLSSNTLSGQLPLGLGHKSLVSLDLSNNQLTGPIPESLTLSS-LKLV 497
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2032221 RLP4 "receptor like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094103 AT3G19230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195855 AT1G51910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028446 AT1G49100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078171 AT3G46400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055160 AT2G14440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024987 AT1G07550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126540 AT4G29990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066158 AT2G28990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G25570
leucine-rich repeat protein-related; leucine-rich repeat protein-related; FUNCTIONS IN- protein binding; LOCATED IN- plasma membrane, vacuole; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Leucine-rich repeat (InterPro-IPR001611), Leucine-rich repeat, N-terminal (InterPro-IPR013210); BEST Arabidopsis thaliana protein match is- AtRLP4 (Receptor Like Protein 4); protein binding (TAIR-AT1G28340.1); Has 22991 Blast hits to 6621 proteins in 344 species- Archae - 2; Bacteria - 311; Metazoa - 61; Fungi - 5; Plants - 21791; Viruses - 0; Othe [...] (628 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT4G10790
UBX domain-containing protein; UBX domain-containing protein; INVOLVED IN- biological_process u [...] (480 aa)
      • 0.966
AT2G04870
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (72 aa)
      • 0.966
AT1G26330
DNA binding; DNA binding; FUNCTIONS IN- DNA binding; INVOLVED IN- biological_process unknown; L [...] (1189 aa)
      • 0.966
AtGRF6
AtGRF6 (GROWTH-REGULATING FACTOR 6); transcription activator; Growth regulating factor encoding [...] (244 aa)
      • 0.927
AT1G42980
formin homology 2 domain-containing protein / FH2 domain-containing protein; formin homology 2 [...] (299 aa)
      • 0.921
AT5G56000
heat shock protein 81-4 (HSP81-4); heat shock protein 81-4 (HSP81-4); FUNCTIONS IN- unfolded pr [...] (699 aa)
      • 0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query500
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-107
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 7e-58
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 9e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-08
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  332 bits (854), Expect = e-107
 Identities = 183/503 (36%), Positives = 261/503 (51%), Gaps = 23/503 (4%)

Query: 9   FFFLSLLLVLPLSLASSYPYKASYRIDCGS-ATSTTDPFNTTWQADDRYYTSGATSIVSE 67
               S LL +  SLAS  P+  + RI CG+     T P NT W   D  YT G  +  + 
Sbjct: 5   LLAASALLAVLASLASPEPF--TMRISCGARVNVRTAPTNTLW-YKDFAYTGGIPANATR 61

Query: 68  PLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVE 127
           P  F  P  KTLRYFP S G +NCY I  +P G Y +R F            P FDVSVE
Sbjct: 62  P-SFIAPPLKTLRYFPLSDGPENCYNINRVPKGHYSVRVFFGLVAEPNFDSEPLFDVSVE 120

Query: 128 GTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSFATDPPVIASLEVQQIDPLSY 187
           GT + S +S W      +  +++   F+ DG   +CF+S     P I S+E+ Q+D  +Y
Sbjct: 121 GTQISSLKSGWSS--HDEQVFAEALVFLTDGSASICFHSTGHGDPAILSIEILQVDDKAY 178

Query: 188 D-AATIGNNHILVNYGRLTSGSNQWGPGFSNDADDFGRSWQSDA--ASRSPNAKSSIKSV 244
           +   + G   IL    RL+ G+ +    F  D D  G  W  D            S +++
Sbjct: 179 NFGPSWGQGVILRTAKRLSCGAGK--SKF--DEDYSGDHWGGDRFWNRMQTFGSGSDQAI 234

Query: 245 TTRERITNTNQPPNYYPMKLYQTAIVSSG---AIQYNLAVDAKLDYLIWFHFAEIDSSVT 301
           +T   I   +  PN+YP  LYQ+A+VS+     + Y + VD   +Y +W HFAEID+S+T
Sbjct: 235 STENVIKKASNAPNFYPESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSIT 294

Query: 302 KAGQRVFDILVN-DKNVTRVDIFNSVGS-FAAYSWHYVAKNLSSTELTVKLVPVVGA-AL 358
             G+RVFD+L+N D     VDI    G  + A   +     +S   LT+ L P  G  A+
Sbjct: 295 AEGKRVFDVLINGDTAFKDVDIVKMSGERYTALVLNKTVA-VSGRTLTIVLQPKKGTHAI 353

Query: 359 ISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWNGDPCAPTNWDAWEGITCHPN 418
           I+ +E + ++  +  T+ E+V A++ LK SL +P R GWNGDPC P     W G  C  +
Sbjct: 354 INAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQ-HPWSGADCQFD 412

Query: 419 KDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQ-QSLVRLD 477
             +    I  + L +QGL+G+I + IS L +L ++NLS NS+ G +P  LG   SL  LD
Sbjct: 413 STKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLD 472

Query: 478 LSDNQFTGSIPDSLTSSSKLQLV 500
           LS N F GSIP+SL   + L+++
Sbjct: 473 LSYNSFNGSIPESLGQLTSLRIL 495

Length = 623
>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 500
PLN03150 623 hypothetical protein; Provisional 100.0
PF12819347 Malectin_like: Carbohydrate-binding protein of the 100.0
PLN03150623 hypothetical protein; Provisional 99.88
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.69
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.62
PF12819347 Malectin_like: Carbohydrate-binding protein of the 99.16
KOG0617264 consensus Ras suppressor protein (contains leucine 99.05
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.51
KOG0617264 consensus Ras suppressor protein (contains leucine 98.4
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.39
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.31
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.28
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.06
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.65
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.34
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.33
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.87
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.78
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.52
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 96.46
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.31
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.29
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.19
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.13
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.93
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 95.53
KOG3593355 consensus Predicted receptor-like serine/threonine 95.4
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 94.96
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 94.79
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.54
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 94.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.8
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.21
KOG3593355 consensus Predicted receptor-like serine/threonine 91.67
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 91.59
KOG2982 418 consensus Uncharacterized conserved protein [Funct 91.14
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.82
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 88.94
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 88.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.34
smart0037026 LRR Leucine-rich repeats, outliers. 87.34
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 87.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 87.16
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 86.83
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 83.99
smart0037026 LRR Leucine-rich repeats, outliers. 83.13
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.13
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.96
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.3e-85  Score=709.44  Aligned_cols=482  Identities=36%  Similarity=0.650  Sum_probs=389.5

Q ss_pred             HHHHHHHHHhhhhhcccCCCCccEEEecCCCCCC-cCCCCceEeecCCceecCCcccccCCCCCCCCcCceeeeeCCCCC
Q 010819            9 FFFLSLLLVLPLSLASSYPYKASYRIDCGSATST-TDPFNTTWQADDRYYTSGATSIVSEPLHFRFPHEKTLRYFPPSSG   87 (500)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~i~CG~~~~~-~d~~~~~w~~Dd~~~~~g~~~~~~~~~~~~~~~y~t~R~f~~~~g   87 (500)
                      |.|+.+.++++..++++.+.+++|+||||++++. +|.+||+|++|..+ ++|.......+ ....++|+|+|+||..+|
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~I~CGs~~~~~~d~~~~~w~~D~~~-~~~~~~~~~~~-~~~~~~~~t~R~F~~~~g   80 (623)
T PLN03150          3 LWLLAASALLAVLASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAY-TGGIPANATRP-SFIAPPLKTLRYFPLSDG   80 (623)
T ss_pred             eHHHHHHHHHHhhcccccCCCccEEEeCCCCCCcccCCCCCEEcCCccc-ccCccccccCc-ccccchhhccccCCcccc
Confidence            4444444444444444555677799999999776 67899999997444 43333222222 234578999999997779


Q ss_pred             CCceeEeecCCCccEEEEEEeeccCCCCCCCCCceEEEECCEEEEecCCCCccccCCCceEEEEEEEeeCCceEEEEeec
Q 010819           88 KKNCYIIPNLPPGRYYIRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFVKDGELDLCFYSF  167 (500)
Q Consensus        88 ~~~~Y~~~v~~~~~ylvRl~F~y~~yd~~~~~~~F~v~~~~~~~l~~~~~~~~~~~~~~~~~e~i~~~~~~~l~v~f~~~  167 (500)
                      +++||+||+.++|+|+||+||+||+||+.++.|.|||++|++.|.+....+..  ....++||+|+.++++.++|||+|+
T Consensus        81 ~~~cY~~~~~~~g~ylVRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~--~~~~v~~E~i~~~~~~~l~vcf~~~  158 (623)
T PLN03150         81 PENCYNINRVPKGHYSVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSS--HDEQVFAEALVFLTDGSASICFHST  158 (623)
T ss_pred             cccceEeeecCCCcEEEEEEeecCCcCCCCCCCceEEEECcEEEEEEecCccc--CCCcEEEEEEEEecCCcEEEEEecC
Confidence            99999999989999999999999999998888999999999776554322222  2356889999999999999999999


Q ss_pred             CCCCceeeeeeeeecCCCCccccC-cCccceEEEEeeeccCCCCCCCCCCCCCCCC--CCccccCCCCCCCCCCCCceee
Q 010819          168 ATDPPVIASLEVQQIDPLSYDAAT-IGNNHILVNYGRLTSGSNQWGPGFSNDADDF--GRSWQSDAASRSPNAKSSIKSV  244 (500)
Q Consensus       168 ~~~~pfIn~iEl~~l~~~~y~~~~-~~~~~~l~~~~R~n~G~~~~~~~~~~~~D~~--dR~W~~d~~~~~~~~~~~~~~~  244 (500)
                      +.++||||+||||+||+++|.... .+++.+|++++|+||||......++|+||++  ||+|.+|..|..+    .+..+
T Consensus       159 ~~~~pFIs~iEv~~l~~~~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~----~~~~~  234 (623)
T PLN03150        159 GHGDPAILSIEILQVDDKAYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSG----SDQAI  234 (623)
T ss_pred             CCCCCceeEEEEEEcCcccccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCC----ccccc
Confidence            999999999999999999996432 2456679999999999976555578999999  9999999887632    35567


Q ss_pred             eeceeecCCCCCCCCchHHHHHHHhccC---CceEEEEecCCCCcEEEEEEEEeeccCCCCCcceEEEEEECCe-eccce
Q 010819          245 TTRERITNTNQPPNYYPMKLYQTAIVSS---GAIQYNLAVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDK-NVTRV  320 (500)
Q Consensus       245 st~~~i~~~~~~~~~~P~~Vy~TA~~~~---~~lt~~~~v~~~~~y~v~lhF~Ei~~~~~~~~~R~F~I~lng~-~l~~~  320 (500)
                      ++...|+++...++.+|+.|||||+++.   .+++|.|++++++.|+|||||||++......++|+|+|++||+ .+.++
T Consensus       235 st~~~I~~~~~~~~~~P~~VyqTA~~~~~~~~~lty~~~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~  314 (623)
T PLN03150        235 STENVIKKASNAPNFYPESLYQSALVSTDTQPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDV  314 (623)
T ss_pred             ccccccccccCCCccChHHHhhhhccccCCCCceEEEeecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeeccc
Confidence            7777787765567779999999999983   4799999999999999999999998644566799999999998 56778


Q ss_pred             eeeccCCC-ccceeeeeeEeecCCCcEEEEecCcchh-hhhhcccccccccCCCCCChhHHHHHHHHHHhcCCCCCCCCC
Q 010819          321 DIFNSVGS-FAAYSWHYVAKNLSSTELTVKLVPVVGA-ALISGLENYALVPNDLSTVPEQVIAMRALKESLRVPDRMGWN  398 (500)
Q Consensus       321 di~~~~g~-~~~~~~~l~~l~l~~n~L~~~l~~~~~~-piLnalEi~~l~~~~~~t~p~~~~~l~~lk~~l~~~~~~~w~  398 (500)
                      |+....|. ..+.++++.+.. .++.|++++.|..++ |+|||+|||++.+.+..+.+.|+.+|+.+|..+..+...+|+
T Consensus       315 di~~~~g~~~~~~~~~~~v~~-~~g~l~isl~p~~~s~pilNaiEI~~~~~~~~~t~~~~~~aL~~~k~~~~~~~~~~W~  393 (623)
T PLN03150        315 DIVKMSGERYTALVLNKTVAV-SGRTLTIVLQPKKGTHAIINAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWN  393 (623)
T ss_pred             ChhhhcCCcccceEEEeEEee-cCCeEEEEEeeCCCCcceeeeeeeeeccccccccCchHHHHHHHHHHhcCCcccCCCC
Confidence            88766654 456666554433 457899999998877 999999999999987889999999999999988765434899


Q ss_pred             CCCCCCCCCCCCceeeecCCCCCceeeEEEEEeCCCCCCccCCcccccCCCCCeEEcccCCCCccCCCcccc-CCccEEE
Q 010819          399 GDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLNLSTNSLGGTLPSGLGQ-QSLVRLD  477 (500)
Q Consensus       399 ~~pc~~~~~~~w~gv~c~~~~~~~~~~l~~L~Ls~n~l~g~ip~~~~~L~~L~~L~Ls~N~l~G~iP~~l~~-~~L~~L~  477 (500)
                      ++||.|.. +.|.|+.|..........++.|+|++|+|+|.+|++++.|++|+.|+|++|+|+|.+|+.++. ++|+.|+
T Consensus       394 g~~C~p~~-~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~Ld  472 (623)
T PLN03150        394 GDPCVPQQ-HPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLD  472 (623)
T ss_pred             CCCCCCcc-cccccceeeccCCCCceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEE
Confidence            99998865 689999996432212235888999999999999999999999999999999999999988888 8999999


Q ss_pred             ccCCCCCccCccccCCCCCCccC
Q 010819          478 LSDNQFTGSIPDSLTSSSKLQLV  500 (500)
Q Consensus       478 Ls~N~l~G~iP~~l~~l~~L~~L  500 (500)
                      |++|+|+|.+|+.+++|++|++|
T Consensus       473 Ls~N~lsg~iP~~l~~L~~L~~L  495 (623)
T PLN03150        473 LSYNSFNGSIPESLGQLTSLRIL  495 (623)
T ss_pred             CCCCCCCCCCchHHhcCCCCCEE
Confidence            99999999999999998888765

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query500
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 1e-18
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 4e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-15
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A 167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
 Score = 82.3 bits (203), Expect = 1e-18
 Identities = 30/159 (18%), Positives = 56/159 (35%), Gaps = 25/159 (15%)

Query: 220 DDFGRSWQSDAASRSPNAKSSIKSVTTRERITNTNQPPNYYPMKLYQTAIVSSGAIQYNL 279
           D  G  ++ D         S                  N     LYQT   +  +  Y++
Sbjct: 19  DVHGIHYRKDPLEGRVGRASDYGM-------KLPILRSNPEDQVLYQTERYNEDSFGYDI 71

Query: 280 AVDAKLDYLIWFHFAEIDSSVTKAGQRVFDILVNDKNVTR-VDIFNSVGSFAAYSWHYVA 338
            +  + +Y++   FAE+     ++ Q+VFD+ VN   V + +DIF+ VG   A+      
Sbjct: 72  PIKEEGEYVLVLKFAEVYF--AQSQQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPI 129

Query: 339 KNLSSTELTVKLVPVVGA--------------ALISGLE 363
            ++   +L+V+                       +  L 
Sbjct: 130 -SIKKGKLSVQGEVSTFTGKLSVEFVKGYYDNPKVCALF 167
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query500
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.92
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.86
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.27
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.99
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.98
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.98
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.97
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.94
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.92
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.9
3e6j_A 229 Variable lymphocyte receptor diversity region; var 98.89
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.86
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.81
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.81
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.81
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 98.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.77
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.73
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.73
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.71
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.71
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.68
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.67
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.66
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.63
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.63
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.62
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.62
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.59
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.59
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.57
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.57
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.56
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.56
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.55
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.54
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.53
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.51
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.5
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.49
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.48
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.46
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.45
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.45
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.43
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.4
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.4
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.39
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.39
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.39
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.39
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.38
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.38
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.37
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.35
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.31
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.31
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.29
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.29
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.2
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.2
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.19
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 98.17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.08
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.07
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 98.07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.03
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.96
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.77
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 97.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.6
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.25
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.09
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.02
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.86
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.37
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.12
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 95.94
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 94.89
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 94.64
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 94.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 94.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 93.99
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 93.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.26
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 92.59
2w47_A144 Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1. 90.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 90.12
2vzp_A127 Aocbm35, EXO-beta-D-glucosaminidase; family 35, CS 87.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.48
2w3j_A145 Carbohydrate binding module; sugar-binding protein 85.35
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 82.62
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
Probab=99.92  E-value=3.8e-25  Score=202.05  Aligned_cols=148  Identities=18%  Similarity=0.106  Sum_probs=113.1

Q ss_pred             ccEEEecCCCCCCcCCCCceEeecCCceecCCcccc------cCCCCCCCCcCceeeeeCCCCCCCceeEeecCCCccEE
Q 010819           30 ASYRIDCGSATSTTDPFNTTWQADDRYYTSGATSIV------SEPLHFRFPHEKTLRYFPPSSGKKNCYIIPNLPPGRYY  103 (500)
Q Consensus        30 ~~~~i~CG~~~~~~d~~~~~w~~Dd~~~~~g~~~~~------~~~~~~~~~~y~t~R~f~~~~g~~~~Y~~~v~~~~~yl  103 (500)
                      ..|+||||++.. +|..+|+|.+|+.|...|.....      ......+..+|+|+|+|+..    .+|.||+.++|+|+
T Consensus         6 ~~~~INcGg~~~-~d~~gr~w~~D~~~~~~g~~~~~~~~~~~~~~~~~~~~lY~TaR~~~~~----~tY~f~v~~~G~Y~   80 (174)
T 2jwp_A            6 VIWAVNAGGESH-VDVHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNEDS----FGYDIPIKEEGEYV   80 (174)
T ss_dssp             EEEEEEETSSSE-EETTTEEECSSCSSTTCCCCCCCCTTSCCSSSCHHHHHTTTCCCCCCSC----EEEEEECCSCEEEE
T ss_pred             EEEEEECCCCCc-cCCCCCEEcCCcCcccCCcccccccceEecccCCCCchhhhhhccCCCC----eEEEEEeCCCeEEE
Confidence            358999999753 56789999998665433322110      11112345699999999863    79999998889999


Q ss_pred             EEEEeeccCCCCCCCCCceEEEECCEEEEecCCCCccccCCCceEEEEEEEe-------------eCCceEEEEeecCCC
Q 010819          104 IRTFTVYDNYDGKSHSPSFDVSVEGTLVFSWRSPWPEGLARDGAYSDLFAFV-------------KDGELDLCFYSFATD  170 (500)
Q Consensus       104 vRl~F~y~~yd~~~~~~~F~v~~~~~~~l~~~~~~~~~~~~~~~~~e~i~~~-------------~~~~l~v~f~~~~~~  170 (500)
                      |||||..-.+... ..++|||+++|++++++||++.+++...++++|+.+.+             .++.|.|+|.|....
T Consensus        81 VrLhF~ei~~~~~-~~rvFdV~ing~~~l~~fdi~~~ag~~~~~~~~~~~~v~~~~l~i~~~~~~~~g~L~I~f~p~~~~  159 (174)
T 2jwp_A           81 LVLKFAEVYFAQS-QQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYYD  159 (174)
T ss_dssp             EEEEEECCSCCCS-SSSCEEEEETTEEEEEEECHHHHHSSSSCEEEEEEEEEETTEEEETTEEEECCSEEEEEEECSSSC
T ss_pred             EEEEEeccccCCC-CCeEeEEEECCEEeecCcCHHHhhCCCeeEEEEEEEEEecCceeeeeeecccCCeEEEEEeccCCC
Confidence            9999976555544 47999999999999999998776655567788887663             567899999987667


Q ss_pred             CceeeeeeeeecC
Q 010819          171 PPVIASLEVQQID  183 (500)
Q Consensus       171 ~pfIn~iEl~~l~  183 (500)
                      .||||||||++.+
T Consensus       160 ~a~inaIEI~~~~  172 (174)
T 2jwp_A          160 NPKVCALFIMKGT  172 (174)
T ss_dssp             SSSEEEEEEESSC
T ss_pred             CcEEEEEEEEeCc
Confidence            8999999999754
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2w47_A Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1.40A {Clostridium thermocellum} PDB: 2w1w_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2vzp_A Aocbm35, EXO-beta-D-glucosaminidase; family 35, CSXA, glucuronic acid, hydrolase; 1.05A {Amycolatopsis orientalis} PDB: 2vzq_A* 2vzr_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 500
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 52.1 bits (123), Expect = 6e-08
 Identities = 19/94 (20%), Positives = 38/94 (40%)

Query: 395 MGWNGDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKGYISDKISLLSNLVNLN 454
           + +  D        A   +     K   +  ++ +DL +  + G +   ++ L  L +LN
Sbjct: 215 VLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLN 274

Query: 455 LSTNSLGGTLPSGLGQQSLVRLDLSDNQFTGSIP 488
           +S N+L G +P G   Q       ++N+     P
Sbjct: 275 VSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSP 308
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query500
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.1
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.09
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.07
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.03
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.88
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.81
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.58
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.28
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.2
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 97.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.04
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.29
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 90.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 89.8
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 89.1
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 86.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 81.12
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.57  E-value=1.9e-15  Score=147.91  Aligned_cols=120  Identities=25%  Similarity=0.463  Sum_probs=101.8

Q ss_pred             CChhHHHHHHHHHHhcCCCC-CCCCC--CCCCCCCCCCCCceeeecCCCCCceeeEEEEEeCCCCCCc--cCCcccccCC
Q 010819          374 TVPEQVIAMRALKESLRVPD-RMGWN--GDPCAPTNWDAWEGITCHPNKDETAVVISQIDLGSQGLKG--YISDKISLLS  448 (500)
Q Consensus       374 t~p~~~~~l~~lk~~l~~~~-~~~w~--~~pc~~~~~~~w~gv~c~~~~~~~~~~l~~L~Ls~n~l~g--~ip~~~~~L~  448 (500)
                      +.|+|..||.++|+.+..+. ..+|.  +|+|.    +.|.||.|+....  ..+++.|+|++++++|  .||+++++|+
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~----~~w~gv~C~~~~~--~~~v~~L~L~~~~l~g~~~lp~~l~~L~   76 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN----RTWLGVLCDTDTQ--TYRVNNLDLSGLNLPKPYPIPSSLANLP   76 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT----TCSTTEEECCSSS--CCCEEEEEEECCCCSSCEECCGGGGGCT
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC----CcCCCeEEeCCCC--cEEEEEEECCCCCCCCCCCCChHHhcCc
Confidence            57899999999999886554 25794  35662    3699999986432  2479999999999998  5899999999


Q ss_pred             CCCeEEccc-CCCCccCCCcccc-CCccEEEccCCCCCccCccccCCCCCCcc
Q 010819          449 NLVNLNLST-NSLGGTLPSGLGQ-QSLVRLDLSDNQFTGSIPDSLTSSSKLQL  499 (500)
Q Consensus       449 ~L~~L~Ls~-N~l~G~iP~~l~~-~~L~~L~Ls~N~l~G~iP~~l~~l~~L~~  499 (500)
                      +|++|+|++ |+++|.||+.+++ ++|++|+|++|++.|..|..+.++.+|+.
T Consensus        77 ~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          77 YLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             TCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             cccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            999999997 8999999999999 99999999999999988887888877765
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure